Summary

This strain contains 20 protein-level mutations:

  • 10 mutations in Spike protein: LGV 141-143 deletion, LA 242-243 deletion, Y265C, E484K, N501Y, D614G, P681H, E1092K, H1101Y, V1176F
  • 1 mutation in N protein: 203-204 RG->KR
  • 1 mutation in NS9c protein: G50N
  • 2 mutations in NSP3 protein: D736G, S1807F
  • 2 mutations in NSP4 protein: D217N, L438P
  • 1 mutation in NSP7 protein: L71F
  • 1 mutation in NSP12 protein: P323L
  • 2 mutations in NSP13 protein: L280F, A368V

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

LGV 141-143 deletion

Reference  SLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTF
           |||||||||||||||||||||||||   |||||||||||||||||||||||||
Mutated    SLLIVNNATNVVIKVCEFQFCNDPF‑‑‑YYHKNNKSWMESEFRVYSSANNCTF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:06 FQFCNDPFL - 4 -
HLA-A*02:11 FQFCNDPFL - 6 -
HLA-A*02:06 FQFCNDPFLGV - 7 -
HLA-A*02:02 FQFCNDPFL - 9 -
HLA-A*02:01 FQFCNDPFL - 10 -
HLA-B*15:03 FQFCNDPFL - 16 -
HLA-A*02:11 FQFCNDPFLGV - 17 -
HLA-A*02:01 FQFCNDPFLGV - 39 -
HLA-A*02:02 FQFCNDPFLGV - 45 -
HLA-A*02:06 EFQFCNDPFLGV - 87 -
HLA-C*03:03 FQFCNDPFL - 120 -
HLA-C*03:04 FQFCNDPFL - 120 -
HLA-C*03:02 FQFCNDPFL - 183 -
HLA-A*02:06 FQFCNDPFLG - 207 -
HLA-B*38:01 FQFCNDPFL - 221 -
HLA-A*02:06 EFQFCNDPFL - 227 -
HLA-C*17:01 FQFCNDPFL - 227 -
HLA-A*23:01 VYYHKNNKSW - 230 -
HLA-C*12:02 FQFCNDPFL - 315 -
HLA-B*15:01 FQFCNDPFL - 321 -
HLA-A*24:02 VYYHKNNKSW - 326 -
HLA-C*14:02 VYYHKNNKSWM - 327 -
HLA-A*02:11 EFQFCNDPFLGV - 334 -
HLA-A*02:02 EFQFCNDPFL - 341 -
HLA-C*12:03 FQFCNDPFL - 350 -
HLA-A*02:11 KVCEFQFCNDPFL - 366 -
HLA-A*02:02 FQFCNDPFLG - 392 -
HLA-C*16:01 FQFCNDPFL - 473 -
HLA-A*02:02 EFQFCNDPFLGV - 477 -
HLA-A*02:06 KVCEFQFCNDPFL - 477 -
HLA-C*14:02 FLGVYYHKNNKSWM FYYHKNNKSWM 11817 69
HLA-A*23:01 FLGVYYHKNNKSW FYYHKNNKSW 7046 159
HLA-A*03:01 FLGVYYHKNNK FYYHKNNK 455 18399
HLA-A*29:02 FQFCNDPFLGVYY FQFCNDPFYY 184 5
HLA-A*24:02 FLGVYYHKNNKSW FYYHKNNKSW 8091 252
HLA-C*14:02 FLGVYYHKNNKSW FYYHKNNKSW 7891 285
HLA-A*30:02 FQFCNDPFLGVYY FQFCNDPFYY 1123 45
HLA-A*29:02 EFQFCNDPFLGVYY EFQFCNDPFYY 1507 68
HLA-C*02:02 FQFCNDPFLGVYY FQFCNDPFYY 4047 227
HLA-C*02:10 FQFCNDPFLGVYY FQFCNDPFYY 4047 227
HLA-B*35:01 FQFCNDPFLGVY FQFCNDPFY 1932 111
HLA-A*29:02 FQFCNDPFLGVYYH FQFCNDPFYYH 5473 318
HLA-C*03:02 FQFCNDPFLGVY FQFCNDPFY 736 47
HLA-A*29:02 EFQFCNDPFLGVY EFQFCNDPFY 1629 107
HLA-C*03:02 FQFCNDPFLGVYY FQFCNDPFYY 2016 144
HLA-A*29:02 FQFCNDPFLGVY FQFCNDPFY 388 28
HLA-B*35:01 FQFCNDPFLGVYY FQFCNDPFYY 3992 297
HLA-C*16:01 FQFCNDPFLGVY FQFCNDPFY 5396 421
HLA-C*12:03 FQFCNDPFLGVYY FQFCNDPFYY 4770 486
HLA-C*12:02 FQFCNDPFLGVYY FQFCNDPFYY 2524 259
HLA-A*29:02 QFCNDPFLGVY QFCNDPFY 192 1821
HLA-A*29:02 QFCNDPFLGVYY QFCNDPFYY 113 13
HLA-B*15:03 EFQFCNDPFLGVYY EFQFCNDPFYY 1912 249
HLA-C*02:02 FQFCNDPFLGVY FQFCNDPFY 2256 303
HLA-C*02:10 FQFCNDPFLGVY FQFCNDPFY 2256 303
HLA-C*12:03 FQFCNDPFLGVY FQFCNDPFY 2521 346
HLA-B*15:03 FQFCNDPFLGVYYH FQFCNDPFYYH 1280 202
HLA-A*68:01 FCNDPFLGVYYHK FCNDPFYYHK 3027 499
HLA-B*44:03 CEFQFCNDPFLGVY CEFQFCNDPFY 2838 469
HLA-C*12:02 FQFCNDPFLGVY FQFCNDPFY 1193 202
HLA-B*15:03 FQFCNDPFLGVYY FQFCNDPFYY 47 8
HLA-A*30:02 QFCNDPFLGVYY QFCNDPFYY 1591 292
HLA-B*15:01 FQFCNDPFLGVYY FQFCNDPFYY 129 25
HLA-A*02:11 FQFCNDPFLGVY FQFCNDPFY 488 1987
HLA-B*15:03 CEFQFCNDPFLGVY CEFQFCNDPFY 967 301
HLA-A*30:02 FQFCNDPFLGVY FQFCNDPFY 336 111
HLA-A*02:06 FQFCNDPFLGVYY FQFCNDPFYY 1024 367
HLA-B*15:03 FQFCNDPFLGVY FQFCNDPFY 11 4
HLA-A*02:06 FQFCNDPFLGVY FQFCNDPFY 135 290
HLA-B*15:01 EFQFCNDPFLGVY EFQFCNDPFY 953 470

LA 242-243 deletion

Reference  PQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVG
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    PQGFSALEPLVDLPIGINITRFQTL‑‑LHRSYLTPGDSSSGWTAGAAACYVG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*27:05 ITRFQTLLAL - 60 -
HLA-B*27:05 GINITRFQTLLAL - 99 -
HLA-A*30:01 ITRFQTLLAL - 126 -
HLA-B*27:05 INITRFQTLLAL - 213 -
HLA-A*30:01 NITRFQTLLA - 214 -
HLA-B*27:05 NITRFQTLLAL - 258 -
HLA-A*30:01 INITRFQTLLA - 356 -
HLA-A*02:06 ITRFQTLLAL - 431 -
HLA-B*15:03 ITRFQTLLAL - 451 -
HLA-A*02:02 TLLALHRSYL TLLHRSYL 59 4272
HLA-C*03:02 FQTLLALHRSY FQTLLHRSY 2052 32
HLA-A*02:11 TLLALHRSYL TLLHRSYL 33 2034
HLA-C*12:03 FQTLLALHRSY FQTLLHRSY 6248 108
HLA-C*16:01 FQTLLALHRSY FQTLLHRSY 6440 113
HLA-A*02:02 LLALHRSYLT LLHRSYLT 306 12739
HLA-A*02:01 TLLALHRSYL TLLHRSYL 174 6508
HLA-C*16:01 QTLLALHRSYL QTLLHRSYL 8730 259
HLA-B*27:05 INITRFQTLLALHR INITRFQTLLHR 11794 422
HLA-C*12:02 FQTLLALHRSY FQTLLHRSY 3734 139
HLA-B*27:05 TRFQTLLALH TRFQTLLH 147 3386
HLA-A*11:01 ITRFQTLLALHR ITRFQTLLHR 5196 255
HLA-A*30:01 QTLLALHRSYL QTLLHRSYL 4016 201
HLA-A*31:01 TRFQTLLALHR TRFQTLLHR 145 2825
HLA-A*02:11 FQTLLALHRSYLT FQTLLHRSYLT 5635 296
HLA-A*31:01 RFQTLLALHRS RFQTLLHRS 348 6089
HLA-C*14:02 FQTLLALHRSY FQTLLHRSY 6244 357
HLA-B*15:03 RFQTLLALHRSY RFQTLLHRSY 340 20
HLA-C*02:02 FQTLLALHRSY FQTLLHRSY 6171 380
HLA-C*02:10 FQTLLALHRSY FQTLLHRSY 6171 380
HLA-A*68:01 ITRFQTLLALHR ITRFQTLLHR 1475 107
HLA-B*15:01 QTLLALHRSY QTLLHRSY 363 4986
HLA-A*30:01 ITRFQTLLALH ITRFQTLLH 3187 238
HLA-A*02:11 TLLALHRSYLT TLLHRSYLT 944 85
HLA-B*27:05 ITRFQTLLALHR ITRFQTLLHR 1674 151
HLA-A*33:03 RFQTLLALHR RFQTLLHR 231 2560
HLA-A*30:02 QTLLALHRSY QTLLHRSY 214 2338
HLA-B*15:03 ITRFQTLLALHRSY ITRFQTLLHRSY 2610 265
HLA-A*31:01 RFQTLLALHR RFQTLLHR 12 109
HLA-B*18:01 FQTLLALHRSY FQTLLHRSY 3454 436
HLA-B*15:01 RFQTLLALHRSY RFQTLLHRSY 650 84
HLA-A*30:01 RFQTLLALHRSYL RFQTLLHRSYL 2049 278
HLA-B*15:03 FQTLLALHRSY FQTLLHRSY 29 4
HLA-C*14:02 RFQTLLALHRSY RFQTLLHRSY 1204 203
HLA-B*15:03 FQTLLALHRSYL FQTLLHRSYL 592 105
HLA-B*15:01 FQTLLALHRSYL FQTLLHRSYL 1826 412
HLA-A*33:03 ITRFQTLLALHR ITRFQTLLHR 656 156
HLA-B*15:01 FQTLLALHRSY FQTLLHRSY 126 32
HLA-B*27:05 TRFQTLLALHRSYL TRFQTLLHRSYL 500 145
HLA-A*68:01 NITRFQTLLALHR NITRFQTLLHR 652 198
HLA-B*15:03 TRFQTLLALHRSY TRFQTLLHRSY 396 124
HLA-A*30:02 FQTLLALHRSY FQTLLHRSY 1459 488
HLA-A*31:01 ITRFQTLLALHR ITRFQTLLHR 134 45
HLA-A*29:02 RFQTLLALHRSY RFQTLLHRSY 489 172
HLA-A*30:02 RFQTLLALHRSY RFQTLLHRSY 140 51
HLA-A*02:11 FQTLLALHRSYL FQTLLHRSYL 249 628
HLA-A*02:06 FQTLLALHRSYL FQTLLHRSYL 579 238
HLA-B*27:05 TRFQTLLALHR TRFQTLLHR 191 82
HLA-A*30:02 ITRFQTLLALHRSY ITRFQTLLHRSY 715 309
HLA-B*27:05 TRFQTLLALHRS TRFQTLLHRS 1078 482
HLA-A*33:03 NITRFQTLLALHR NITRFQTLLHR 548 261

Y265C

Reference  TLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TL‑‑LHRSYLTPGDSSSGWTAGAAACYVGYLQPRTFLLKYNENGTITDAVD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*30:02 SGWTAGAAAY SGWTAGAAAC 100 19672
HLA-A*30:02 SSSGWTAGAAAY SSSGWTAGAAAC 108 18810
HLA-A*30:02 SSGWTAGAAAY SSGWTAGAAAC 152 20737
HLA-B*15:03 SGWTAGAAAY SGWTAGAAAC 127 15161
HLA-A*29:02 SGWTAGAAAY SGWTAGAAAC 368 32767
HLA-A*29:02 GWTAGAAAY GWTAGAAAC 387 32767
HLA-A*01:01 SSSGWTAGAAAY SSSGWTAGAAAC 469 29119
HLA-B*15:01 SGWTAGAAAY SGWTAGAAAC 417 25851
HLA-C*03:02 WTAGAAAY WTAGAAAC 368 19293
HLA-C*14:02 GWTAGAAAY GWTAGAAAC 323 13881
HLA-C*14:02 AYYVGYLQPRTF ACYVGYLQPRTF 174 5593
HLA-A*23:01 AYYVGYLQPRTF ACYVGYLQPRTF 69 1870
HLA-A*23:01 AYYVGYLQPRTFLL ACYVGYLQPRTFLL 373 8243
HLA-A*24:02 AYYVGYLQPRTF ACYVGYLQPRTF 215 3791
HLA-A*02:11 YYVGYLQPRTFLL CYVGYLQPRTFLL 52 872
HLA-C*14:02 YYVGYLQPRTF CYVGYLQPRTF 26 382
HLA-C*07:02 YYVGYLQPRTF CYVGYLQPRTF 205 2945
HLA-C*14:02 YYVGYLQPRTFL CYVGYLQPRTFL 50 657
HLA-C*14:02 YYVGYLQPRTFLL CYVGYLQPRTFLL 121 1546
HLA-A*02:01 YYVGYLQPRTFLL CYVGYLQPRTFLL 257 3227
HLA-A*02:02 YYVGYLQPRTFLL CYVGYLQPRTFLL 88 969
HLA-A*26:01 DSSSGWTAGAAAYY DSSSGWTAGAAACY 344 3059
HLA-A*68:01 GWTAGAAAYY GWTAGAAACY 500 3832
HLA-A*68:01 WTAGAAAYY WTAGAAACY 22 167
HLA-A*29:02 SSGWTAGAAAYY SSGWTAGAAACY 301 2058
HLA-A*26:01 SSGWTAGAAAYY SSGWTAGAAACY 438 2795
HLA-A*26:01 GWTAGAAAYY GWTAGAAACY 318 1985
HLA-A*29:02 SGWTAGAAAYY SGWTAGAAACY 239 1462
HLA-A*23:01 YYVGYLQPRTFLL CYVGYLQPRTFLL 68 386
HLA-A*29:02 GWTAGAAAYY GWTAGAAACY 81 453
HLA-A*68:02 TAGAAAYYV TAGAAACYV 30 166
HLA-C*02:02 WTAGAAAYY WTAGAAACY 66 361
HLA-C*02:10 WTAGAAAYY WTAGAAACY 66 361
HLA-A*29:02 SSSGWTAGAAAYY SSSGWTAGAAACY 337 1807
HLA-A*24:02 YYVGYLQPRTFLL CYVGYLQPRTFLL 89 457
HLA-A*02:11 TAGAAAYYV TAGAAACYV 107 528
HLA-A*29:02 WTAGAAAYY WTAGAAACY 8 39
HLA-C*14:02 YYVGYLQPR CYVGYLQPR 492 2217
HLA-A*24:02 YYVGYLQPRTF CYVGYLQPRTF 30 130
HLA-A*23:01 YYVGYLQPRTFL CYVGYLQPRTFL 238 989
HLA-A*30:02 GWTAGAAAYY GWTAGAAACY 46 191
HLA-C*12:03 WTAGAAAYY WTAGAAACY 52 203
HLA-A*31:01 AYYVGYLQPR ACYVGYLQPR 19 74
HLA-A*26:01 WTAGAAAYY WTAGAAACY 9 35
HLA-C*12:03 GAAAYYVGY GAAACYVGY 258 995
HLA-A*02:06 TAGAAAYYV TAGAAACYV 186 714
HLA-A*23:01 YYVGYLQPRTF CYVGYLQPRTF 17 63
HLA-A*24:02 YYVGYLQPRTFL CYVGYLQPRTFL 474 1671
HLA-A*68:01 AAYYVGYLQPR AACYVGYLQPR 88 305
HLA-A*30:02 WTAGAAAYY WTAGAAACY 25 85
HLA-A*25:01 WTAGAAAYY WTAGAAACY 112 380
HLA-A*29:02 WTAGAAAYYVGY WTAGAAACYVGY 175 588
HLA-A*30:02 SGWTAGAAAYY SGWTAGAAACY 90 296
HLA-C*12:02 WTAGAAAYY WTAGAAACY 71 232
HLA-C*14:02 WTAGAAAYY WTAGAAACY 249 758
HLA-A*30:02 SSGWTAGAAAYY SSGWTAGAAACY 57 166
HLA-A*02:02 TAGAAAYYV TAGAAACYV 340 979
HLA-A*30:02 SSSGWTAGAAAYY SSSGWTAGAAACY 80 226
HLA-A*01:01 GWTAGAAAYY GWTAGAAACY 258 695
HLA-B*15:03 GAAAYYVGY GAAACYVGY 46 122
HLA-C*16:01 GAAAYYVGY GAAACYVGY 166 430
HLA-A*01:01 SSGWTAGAAAYY SSGWTAGAAACY 330 853
HLA-A*01:01 SSSGWTAGAAAYY SSSGWTAGAAACY 231 593
HLA-C*03:02 WTAGAAAYY WTAGAAACY 16 41
HLA-C*03:02 GAAAYYVGY GAAACYVGY 99 247
HLA-B*15:03 WTAGAAAYY WTAGAAACY 48 116
HLA-C*16:01 WTAGAAAYY WTAGAAACY 52 125
HLA-A*68:01 WTAGAAAYYVGY WTAGAAACYVGY 479 1146
HLA-C*12:02 GAAAYYVGY GAAACYVGY 356 837
HLA-C*03:03 AAAYYVGYL AAACYVGYL 49 106
HLA-C*03:04 AAAYYVGYL AAACYVGYL 49 106
HLA-A*01:01 WTAGAAAYYVGY WTAGAAACYVGY 174 374
HLA-C*12:03 AAAYYVGYL AAACYVGYL 29 62
HLA-C*16:01 AAAYYVGYL AAACYVGYL 30 63
HLA-C*03:02 AAAYYVGYL AAACYVGYL 117 241
HLA-A*01:01 WTAGAAAYY WTAGAAACY 18 37
HLA-A*30:02 WTAGAAAYYVGY WTAGAAACYVGY 313 634
HLA-A*02:11 WTAGAAAYYV WTAGAAACYV 79 160
HLA-B*35:01 GAAAYYVGY GAAACYVGY 487 985

E484K

Reference  SNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYR
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYR

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*40:02 VEGFNCYFPL VKGFNCYFPL 31 7011
HLA-B*40:01 VEGFNCYFPL VKGFNCYFPL 76 15210
HLA-A*11:01 GSTPCNGVE GSTPCNGVK 32767 444
HLA-A*68:02 EGFNCYFPL KGFNCYFPL 117 3877
HLA-A*30:01 EGFNCYFPL KGFNCYFPL 5413 164
HLA-A*32:01 EGFNCYFPL KGFNCYFPL 6548 210
HLA-A*30:02 EGFNCYFPLQSY KGFNCYFPLQSY 1806 72
HLA-B*15:01 GVEGFNCYF GVKGFNCYF 3125 132
HLA-A*31:01 EGFNCYFPL KGFNCYFPL 4227 226
HLA-B*15:03 EGFNCYFPL KGFNCYFPL 2980 212
HLA-A*02:11 EGFNCYFPL KGFNCYFPL 2508 259
HLA-B*15:03 GVEGFNCYF GVKGFNCYF 1657 199
HLA-A*02:06 EGFNCYFPL KGFNCYFPL 1266 169
HLA-B*35:01 TPCNGVEGF TPCNGVKGF 319 1754
HLA-B*15:03 VEGFNCYFPLQSY VKGFNCYFPLQSY 1081 208
HLA-B*35:01 NGVEGFNCY NGVKGFNCY 346 1439
HLA-C*16:01 EGFNCYFPL KGFNCYFPL 1861 498
HLA-B*15:03 VEGFNCYFPL VKGFNCYFPL 943 280

N501Y

Reference  GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    GSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*29:02 QSYGFQPTN QSYGFQPTY 26152 24
HLA-A*29:02 YFPLQSYGFQPTN YFPLQSYGFQPTY 19514 25
HLA-B*15:01 LQSYGFQPTN LQSYGFQPTY 6135 8
HLA-B*35:01 FPLQSYGFQPTN FPLQSYGFQPTY 8715 15
HLA-C*03:02 QSYGFQPTN QSYGFQPTY 12903 23
HLA-B*15:03 LQSYGFQPTN LQSYGFQPTY 2045 4
HLA-B*15:03 QSYGFQPTN QSYGFQPTY 6543 13
HLA-C*16:01 QSYGFQPTN QSYGFQPTY 10868 27
HLA-B*35:01 QSYGFQPTN QSYGFQPTY 24615 71
HLA-C*12:03 QSYGFQPTN QSYGFQPTY 12696 38
HLA-B*15:03 PLQSYGFQPTN PLQSYGFQPTY 22802 80
HLA-C*14:02 TNGVGYQPY TYGVGYQPY 5468 21
HLA-A*29:02 LQSYGFQPTN LQSYGFQPTY 28458 133
HLA-C*03:02 FPLQSYGFQPTN FPLQSYGFQPTY 23840 113
HLA-C*03:02 LQSYGFQPTN LQSYGFQPTY 23421 125
HLA-A*30:02 LQSYGFQPTN LQSYGFQPTY 7508 42
HLA-A*30:02 QSYGFQPTN QSYGFQPTY 5297 30
HLA-B*15:03 FPLQSYGFQPTN FPLQSYGFQPTY 20159 137
HLA-C*03:02 YFPLQSYGFQPTN YFPLQSYGFQPTY 27639 198
HLA-A*29:02 CYFPLQSYGFQPTN CYFPLQSYGFQPTY 27182 196
HLA-C*14:02 SYGFQPTN SYGFQPTY 20230 162
HLA-A*29:02 FPLQSYGFQPTN FPLQSYGFQPTY 32767 264
HLA-B*15:01 QSYGFQPTN QSYGFQPTY 21529 195
HLA-C*14:02 YFPLQSYGFQPTN YFPLQSYGFQPTY 18230 169
HLA-B*15:03 YFPLQSYGFQPTN YFPLQSYGFQPTY 22168 206
HLA-A*11:01 QSYGFQPTN QSYGFQPTY 22068 241
HLA-C*16:01 LQSYGFQPTN LQSYGFQPTY 27149 326
HLA-C*12:02 QSYGFQPTN QSYGFQPTY 21029 267
HLA-B*15:01 PLQSYGFQPTN PLQSYGFQPTY 32767 449
HLA-B*35:01 YFPLQSYGFQPTN YFPLQSYGFQPTY 28375 395
HLA-C*12:03 FPLQSYGFQPTN FPLQSYGFQPTY 27893 431
HLA-C*16:01 FPLQSYGFQPTN FPLQSYGFQPTY 27733 434
HLA-C*02:02 QSYGFQPTN QSYGFQPTY 26598 425
HLA-C*02:10 QSYGFQPTN QSYGFQPTY 26598 425
HLA-A*30:02 YFPLQSYGFQPTN YFPLQSYGFQPTY 18743 310
HLA-B*15:03 LQSYGFQPTNG LQSYGFQPTYG 6387 109
HLA-B*53:01 FPLQSYGFQPTN FPLQSYGFQPTY 8451 151
HLA-C*12:03 LQSYGFQPTN LQSYGFQPTY 26641 480
HLA-A*32:01 QSYGFQPTN QSYGFQPTY 16619 311
HLA-A*30:02 FPLQSYGFQPTN FPLQSYGFQPTY 21475 466
HLA-C*03:02 NGVGYQPY YGVGYQPY 10463 451
HLA-B*57:01 QSYGFQPTN QSYGFQPTY 4070 215
HLA-B*58:01 QSYGFQPTN QSYGFQPTY 1532 83
HLA-A*02:11 NGVGYQPYRV YGVGYQPYRV 5989 327
HLA-B*57:01 LQSYGFQPTN LQSYGFQPTY 3839 244
HLA-B*58:01 LQSYGFQPTN LQSYGFQPTY 1885 155
HLA-B*15:03 NGVGYQPY YGVGYQPY 4677 467
HLA-A*31:01 TNGVGYQPYR TYGVGYQPYR 811 84
HLA-A*33:03 TNGVGYQPYR TYGVGYQPYR 573 62
HLA-A*29:02 TNGVGYQPY TYGVGYQPY 2031 237
HLA-A*29:02 PTNGVGYQPY PTYGVGYQPY 1211 177
HLA-A*02:11 YGFQPTNGV YGFQPTYGV 307 49
HLA-A*02:01 YGFQPTNGV YGFQPTYGV 2160 459
HLA-A*68:01 PTNGVGYQPYR PTYGVGYQPYR 1073 242
HLA-A*02:11 LQSYGFQPTNGV LQSYGFQPTYGV 1446 396
HLA-A*31:01 PTNGVGYQPYR PTYGVGYQPYR 1377 406
HLA-A*02:06 YGFQPTNGV YGFQPTYGV 174 52
HLA-A*33:03 PTNGVGYQPYR PTYGVGYQPYR 1345 407
HLA-A*02:02 YGFQPTNGV YGFQPTYGV 868 287
HLA-A*02:06 QSYGFQPTNGV QSYGFQPTYGV 1121 407
HLA-A*68:02 YGFQPTNGV YGFQPTYGV 73 28
HLA-A*68:02 QSYGFQPTNGV QSYGFQPTYGV 122 48
HLA-B*15:01 GFQPTNGVGY GFQPTYGVGY 774 311
HLA-A*29:02 YGFQPTNGVGY YGFQPTYGVGY 1158 486
HLA-A*31:01 NGVGYQPYR YGVGYQPYR 438 185
HLA-A*02:06 LQSYGFQPTNGV LQSYGFQPTYGV 249 111
HLA-A*30:02 PTNGVGYQPY PTYGVGYQPY 465 210
HLA-B*15:03 FQPTNGVGY FQPTYGVGY 63 29
HLA-A*02:02 LQSYGFQPTNGV LQSYGFQPTYGV 594 280
HLA-B*15:03 GFQPTNGVGY GFQPTYGVGY 769 363

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*05:01 YQDVNCTEV YQGVNCTEV 82 8597
HLA-C*08:02 YQDVNCTEV YQGVNCTEV 89 8066
HLA-A*02:11 DVNCTEVPV GVNCTEVPV 2140 72
HLA-A*02:02 DVNCTEVPV GVNCTEVPV 4099 213
HLA-A*68:02 DVNCTEVPV GVNCTEVPV 36 659
HLA-A*02:06 DVNCTEVPV GVNCTEVPV 3807 208
HLA-A*68:02 QVAVLYQDV QVAVLYQGV 183 13
HLA-A*68:02 NQVAVLYQDV NQVAVLYQGV 650 52
HLA-A*02:06 QVAVLYQDV QVAVLYQGV 1312 148
HLA-A*02:11 QVAVLYQDV QVAVLYQGV 2169 268
HLA-A*68:02 NTSNQVAVLYQDV NTSNQVAVLYQGV 1858 231
HLA-A*68:02 TSNQVAVLYQDV TSNQVAVLYQGV 3281 457
HLA-A*02:02 QVAVLYQDV QVAVLYQGV 1107 188
HLA-A*02:01 YQDVNCTEV YQGVNCTEV 75 315
HLA-A*02:06 YQDVNCTEV YQGVNCTEV 17 57
HLA-A*02:11 VLYQDVNCT VLYQGVNCT 224 74
HLA-A*02:11 YQDVNCTEV YQGVNCTEV 31 93
HLA-A*02:11 VLYQDVNCTEVP VLYQGVNCTEVP 1000 402
HLA-A*02:02 NQVAVLYQDV NQVAVLYQGV 269 116
HLA-A*02:11 AVLYQDVNCTEV AVLYQGVNCTEV 500 238
HLA-A*02:01 NQVAVLYQDV NQVAVLYQGV 558 267
HLA-A*02:06 NQVAVLYQDV NQVAVLYQGV 36 18

P681H

Reference  VNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVA
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    VNNSYECDIPIGAGICASYQTQTNSHRRARSVASQSIIAYTMSLGAENSVA

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*07:02 SPRRARSVA SHRRARSVA 4 4721
HLA-B*42:01 SPRRARSVA SHRRARSVA 8 6169
HLA-B*07:02 SPRRARSVASQSI SHRRARSVASQSI 17 11433
HLA-B*07:02 SPRRARSV SHRRARSV 24 12728
HLA-B*07:02 SPRRARSVAS SHRRARSVAS 37 14758
HLA-B*07:02 SPRRARSVASQSII SHRRARSVASQSII 55 17736
HLA-B*42:01 SPRRARSV SHRRARSV 38 11622
HLA-B*42:01 SPRRARSVASQSI SHRRARSVASQSI 48 14418
HLA-B*07:02 TNSPRRARSVA TNSHRRARSVA 125 20078
HLA-B*42:01 SPRRARSVAS SHRRARSVAS 158 17461
HLA-B*07:02 NSPRRARSVA NSHRRARSVA 69 7270
HLA-B*42:01 SPRRARSVASQSII SHRRARSVASQSII 321 21521
HLA-B*07:02 TQTNSPRRARSVA TQTNSHRRARSVA 270 17880
HLA-B*07:02 QTNSPRRARSVA QTNSHRRARSVA 249 13539
HLA-B*42:01 TNSPRRARSVA TNSHRRARSVA 437 21599
HLA-B*42:01 NSPRRARSVA NSHRRARSVA 217 8330
HLA-C*14:02 SYQTQTNSP SYQTQTNSH 3691 139
HLA-B*08:01 NSPRRARSV NSHRRARSV 881 69
HLA-B*08:01 SPRRARSVA SHRRARSVA 372 3831
HLA-B*08:01 SPRRARSV SHRRARSV 428 2448
HLA-C*16:01 NSPRRARSV NSHRRARSV 1247 314
HLA-C*12:03 NSPRRARSV NSHRRARSV 1110 365
HLA-A*11:01 ASYQTQTNSPR ASYQTQTNSHR 346 1041
HLA-A*68:01 CASYQTQTNSPR CASYQTQTNSHR 142 401
HLA-A*68:01 TQTNSPRRAR TQTNSHRRAR 254 710
HLA-A*31:01 YQTQTNSPR YQTQTNSHR 441 1214
HLA-A*68:01 YQTQTNSPRR YQTQTNSHRR 206 78
HLA-A*33:03 QTQTNSPRR QTQTNSHRR 445 176
HLA-A*33:03 YQTQTNSPRR YQTQTNSHRR 967 411
HLA-A*68:01 QTQTNSPRR QTQTNSHRR 119 51
HLA-A*68:01 QTNSPRRAR QTNSHRRAR 95 216
HLA-A*31:01 ASYQTQTNSPR ASYQTQTNSHR 139 311

E1092K

Reference  YVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    YVPAQEKNFTTAPAICHDGKAHFPRKGVFVSNGTYWFVTQRNFYEPQIITT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*30:02 EGVFVSNGTH KGVFVSNGTY 10999 20
HLA-B*15:01 EGVFVSNGTH KGVFVSNGTY 16651 79
HLA-B*15:03 EGVFVSNGTH KGVFVSNGTY 17087 92
HLA-B*44:02 REGVFVSNGTHW RKGVFVSNGTYW 77 13384
HLA-B*44:03 REGVFVSNGTHW RKGVFVSNGTYW 137 15881
HLA-B*15:03 REGVFVSNGTH RKGVFVSNGTY 3026 27
HLA-A*30:01 HDGKAHFPRE HDGKAHFPRK 6388 92
HLA-B*35:01 FPREGVFVSNGTH FPRKGVFVSNGTY 2599 42
HLA-A*30:02 REGVFVSNGTH RKGVFVSNGTY 3495 60
HLA-B*15:01 REGVFVSNGTH RKGVFVSNGTY 10166 217
HLA-A*30:02 PREGVFVSNGTH PRKGVFVSNGTY 10319 239
HLA-B*15:01 FPREGVFVSNGTH FPRKGVFVSNGTY 12794 378
HLA-A*30:02 FPREGVFVSNGTH FPRKGVFVSNGTY 13269 467
HLA-A*30:02 HFPREGVFVSNGTH HFPRKGVFVSNGTY 12489 498
HLA-B*58:01 EGVFVSNGTHW KGVFVSNGTYW 1949 79
HLA-B*57:01 EGVFVSNGTHW KGVFVSNGTYW 2892 221
HLA-A*68:02 EGVFVSNGTHWFV KGVFVSNGTYWFV 355 4131
HLA-B*07:02 FPREGVFV FPRKGVFV 749 262
HLA-B*42:01 FPREGVFV FPRKGVFV 163 63
HLA-B*35:01 FPREGVFVS FPRKGVFVS 119 302
HLA-B*07:02 FPREGVFVS FPRKGVFVS 424 176

H1101Y

Reference  TTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNC
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TTAPAICHDGKAHFPRKGVFVSNGTYWFVTQRNFYEPQIITTDNTFVSGNC

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*30:02 EGVFVSNGTH KGVFVSNGTY 10999 20
HLA-B*15:01 EGVFVSNGTH KGVFVSNGTY 16651 79
HLA-B*15:03 EGVFVSNGTH KGVFVSNGTY 17087 92
HLA-B*44:02 REGVFVSNGTHW RKGVFVSNGTYW 77 13384
HLA-B*44:03 REGVFVSNGTHW RKGVFVSNGTYW 137 15881
HLA-B*15:03 REGVFVSNGTH RKGVFVSNGTY 3026 27
HLA-A*29:02 GVFVSNGTH GVFVSNGTY 14554 136
HLA-B*15:01 GVFVSNGTH GVFVSNGTY 4414 70
HLA-B*35:01 FPREGVFVSNGTH FPRKGVFVSNGTY 2599 42
HLA-A*30:02 GVFVSNGTH GVFVSNGTY 2307 38
HLA-A*30:02 REGVFVSNGTH RKGVFVSNGTY 3495 60
HLA-B*15:03 GVFVSNGTH GVFVSNGTY 2176 46
HLA-B*15:01 REGVFVSNGTH RKGVFVSNGTY 10166 217
HLA-A*30:02 PREGVFVSNGTH PRKGVFVSNGTY 10319 239
HLA-B*15:01 FPREGVFVSNGTH FPRKGVFVSNGTY 12794 378
HLA-A*30:02 FPREGVFVSNGTH FPRKGVFVSNGTY 13269 467
HLA-C*14:02 VFVSNGTH VFVSNGTY 4648 168
HLA-A*30:02 HFPREGVFVSNGTH HFPRKGVFVSNGTY 12489 498
HLA-B*58:01 EGVFVSNGTHW KGVFVSNGTYW 1949 79
HLA-A*24:02 THWFVTQRNF TYWFVTQRNF 484 21
HLA-C*03:02 GVFVSNGTH GVFVSNGTY 8424 382
HLA-A*23:01 THWFVTQRNF TYWFVTQRNF 169 9
HLA-B*57:01 EGVFVSNGTHW KGVFVSNGTYW 2892 221
HLA-A*68:02 EGVFVSNGTHWFV KGVFVSNGTYWFV 355 4131
HLA-C*14:02 THWFVTQRNF TYWFVTQRNF 1544 137
HLA-A*31:01 THWFVTQR TYWFVTQR 1253 133
HLA-A*33:03 THWFVTQR TYWFVTQR 891 103
HLA-A*29:02 THWFVTQRNF TYWFVTQRNF 1545 189
HLA-A*11:01 NGTHWFVTQR NGTYWFVTQR 1084 160
HLA-A*23:01 GTHWFVTQRNF GTYWFVTQRNF 2154 318
HLA-A*24:02 HWFVTQRNF YWFVTQRNF 296 44
HLA-A*03:01 GTHWFVTQR GTYWFVTQR 511 76
HLA-A*23:01 HWFVTQRNF YWFVTQRNF 121 19
HLA-B*15:03 THWFVTQRNF TYWFVTQRNF 274 1741
HLA-A*29:02 HWFVTQRNF YWFVTQRNF 642 106
HLA-A*29:02 THWFVTQRNFY TYWFVTQRNFY 264 46
HLA-C*14:02 HWFVTQRNFY YWFVTQRNFY 551 97
HLA-A*03:02 NGTHWFVTQR NGTYWFVTQR 2297 451
HLA-A*11:01 SNGTHWFVTQR SNGTYWFVTQR 580 115
HLA-A*29:02 HWFVTQRNFY YWFVTQRNFY 42 9
HLA-C*07:02 HWFVTQRNF YWFVTQRNF 1677 394
HLA-A*03:02 GTHWFVTQR GTYWFVTQR 146 36
HLA-C*14:02 HWFVTQRNF YWFVTQRNF 68 19
HLA-A*29:02 GTHWFVTQRNFY GTYWFVTQRNFY 628 183
HLA-A*74:01 GTHWFVTQR GTYWFVTQR 175 51
HLA-A*11:01 GTHWFVTQR GTYWFVTQR 34 11
HLA-A*02:06 VSNGTHWFV VSNGTYWFV 106 35
HLA-A*29:02 VFVSNGTHWF VFVSNGTYWF 746 277
HLA-A*68:01 NGTHWFVTQRN NGTYWFVTQRN 1153 429
HLA-A*02:01 VSNGTHWFV VSNGTYWFV 617 235
HLA-A*29:02 FVSNGTHWF FVSNGTYWF 439 171
HLA-A*68:01 THWFVTQR TYWFVTQR 1103 440
HLA-A*23:01 VFVSNGTHWF VFVSNGTYWF 62 27
HLA-B*15:03 HWFVTQRNF YWFVTQRNF 539 236
HLA-A*02:02 VSNGTHWFV VSNGTYWFV 351 156
HLA-C*03:03 FVSNGTHWF FVSNGTYWF 137 308
HLA-C*03:04 FVSNGTHWF FVSNGTYWF 137 308
HLA-A*68:02 VSNGTHWFV VSNGTYWFV 95 43
HLA-A*02:11 FVSNGTHWF FVSNGTYWF 1048 482
HLA-A*68:01 VFVSNGTHWFVTQR VFVSNGTYWFVTQR 723 359
HLA-A*02:11 VSNGTHWFV VSNGTYWFV 42 21
HLA-A*30:02 GTHWFVTQRNFY GTYWFVTQRNFY 278 139

V1176F

Reference  ELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ELDKYFKNHTSPDVDLGDISGINASFVNIQKEIDRLNEVAKNLNESLIDLQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:02 DISGINASV DISGINASF 10 1289
HLA-A*02:11 GDISGINASV GDISGINASF 238 15161
HLA-C*14:02 SVVNIQKEI SFVNIQKEI 6508 124
HLA-A*02:02 GDISGINASV GDISGINASF 71 3625
HLA-A*02:11 LGDISGINASV LGDISGINASF 446 19525
HLA-A*68:02 DLGDISGINASV DLGDISGINASF 362 15753
HLA-B*15:01 GDISGINASV GDISGINASF 15806 370
HLA-A*02:02 LGDISGINASV LGDISGINASF 208 8728
HLA-B*35:01 DISGINASV DISGINASF 16065 447
HLA-A*68:02 GDISGINASV GDISGINASF 453 15954
HLA-A*02:02 VDLGDISGINASV VDLGDISGINASF 413 11912
HLA-A*68:01 SVVNIQKEIDR SFVNIQKEIDR 288 5363
HLA-A*02:02 VVNIQKEIDRLNEV FVNIQKEIDRLNEV 2908 166
HLA-A*25:01 DISGINASV DISGINASF 3057 204
HLA-A*02:06 VVNIQKEIDRLNEV FVNIQKEIDRLNEV 871 59
HLA-A*26:01 DISGINASV DISGINASF 1865 129
HLA-A*02:11 VVNIQKEIDRLNEV FVNIQKEIDRLNEV 2044 152
HLA-A*68:01 VVNIQKEIDR FVNIQKEIDR 1917 242
HLA-A*02:06 GINASVVNI GINASFVNI 1251 237
HLA-A*68:01 SGINASVVNIQK SGINASFVNIQK 913 194
HLA-A*68:01 NASVVNIQKEIDR NASFVNIQKEIDR 127 30
HLA-A*68:01 INASVVNIQK INASFVNIQK 249 62
HLA-A*11:01 ASVVNIQK ASFVNIQK 1597 479
HLA-A*68:02 DISGINASVV DISGINASFV 59 19
HLA-A*03:02 NASVVNIQK NASFVNIQK 949 325
HLA-A*11:01 NASVVNIQK NASFVNIQK 235 83
HLA-A*11:01 SGINASVVNIQK SGINASFVNIQK 411 150
HLA-A*11:01 INASVVNIQK INASFVNIQK 270 101
HLA-A*03:02 INASVVNIQK INASFVNIQK 840 335
HLA-A*11:01 ISGINASVVNIQK ISGINASFVNIQK 1056 450
HLA-A*68:01 NASVVNIQK NASFVNIQK 13 6
HLA-C*16:01 ISGINASVV ISGINASFV 368 787

N protein

N

203-204 RG->KR

Reference  GGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQ
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    GGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNGGDAALALLLLDRLNQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:01 NSTPGSSRG NSTPGSSKR 32767 34
HLA-A*33:03 NSTPGSSRG NSTPGSSKR 32767 300
HLA-B*15:03 SRGTSPARM SKRTSPARM 2669 106
HLA-A*31:01 RNSTPGSSRG RNSTPGSSKR 7013 340
HLA-A*30:01 SSRNSTPGSSR SSRNSTPGSSK 356 20
HLA-A*30:01 GTSPARMAG RTSPARMAG 493 30
HLA-A*31:01 SSRNSTPGSSRG SSRNSTPGSSKR 3757 231
HLA-A*30:01 GTSPARMAGNGG RTSPARMAGNGG 6051 411
HLA-A*31:01 SSRNSTPGSSR SSRNSTPGSSK 127 1853
HLA-A*30:01 NSSRNSTPGSSR NSSRNSTPGSSK 4255 353
HLA-A*30:01 RNSTPGSSR RNSTPGSSK 2120 188
HLA-A*31:01 RNSTPGSSR RNSTPGSSK 123 1335
HLA-A*03:01 SSRNSTPGSSR SSRNSTPGSSK 4753 442
HLA-A*11:01 SSRNSTPGSSR SSRNSTPGSSK 2231 263
HLA-A*68:01 NSSRNSTPGSSR NSSRNSTPGSSK 270 1385
HLA-A*30:01 GSSRGTSPA GSSKRTSPA 555 145
HLA-A*30:01 SSRNSTPGSSRG SSRNSTPGSSKR 1625 469
HLA-A*30:01 SSRGTSPARMAG SSKRTSPARMAG 449 1031

NS9c protein

NS9c

G50N

Reference  AAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           ||||||||||||||||||||||||| |||||||||||||||||||||||
Mutated    AAVKPLLVPHHVVATVQEIQLQAAVNELLLLEWLAMAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*18:01 GELLLLEWLAM NELLLLEWLAM 4979 247
HLA-B*18:01 GELLLLEW NELLLLEW 3915 401
HLA-B*40:01 GELLLLEWL NELLLLEWL 28 140
HLA-A*02:11 QLQAAVGEL QLQAAVNEL 120 27
HLA-A*02:11 IQLQAAVGEL IQLQAAVNEL 338 81
HLA-B*40:02 GELLLLEWL NELLLLEWL 52 204
HLA-B*40:02 GELLLLEWLAM NELLLLEWLAM 201 772
HLA-A*02:01 QLQAAVGEL QLQAAVNEL 1290 358
HLA-A*02:02 QLQAAVGEL QLQAAVNEL 92 28
HLA-B*58:01 VGELLLLEW VNELLLLEW 330 1071
HLA-A*02:02 IQLQAAVGEL IQLQAAVNEL 170 58
HLA-A*02:01 LQAAVGELL LQAAVNELL 938 352
HLA-A*02:02 LQAAVGELL LQAAVNELL 44 17
HLA-B*40:06 GELLLLEWLA NELLLLEWLA 268 677
HLA-B*40:02 GELLLLEWLA NELLLLEWLA 475 1195
HLA-A*02:11 LQAAVGELL LQAAVNELL 386 154
HLA-A*02:01 IQLQAAVGEL IQLQAAVNEL 1138 475
HLA-A*02:01 QLQAAVGELL QLQAAVNELL 961 403
HLA-A*02:01 GELLLLEWLAMA NELLLLEWLAMA 109 258
HLA-A*02:02 QLQAAVGELL QLQAAVNELL 35 15
HLA-A*02:02 IQLQAAVGELL IQLQAAVNELL 724 313
HLA-A*02:11 QLQAAVGELL QLQAAVNELL 303 131
HLA-B*58:01 AVGELLLLEW AVNELLLLEW 196 87
HLA-A*02:11 GELLLLEWLAMA NELLLLEWLAMA 29 61
HLA-B*57:01 AVGELLLLEW AVNELLLLEW 432 206
HLA-A*68:02 EIQLQAAVGELL EIQLQAAVNELL 697 346

NSP3 protein

NSP3

D736G

Reference  KRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINL
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    KRGDKSVYYTSNPTTFHLDGEVITFGNLKTLLSLREVRTIKVFTTVDNINL

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*04:01 TFDNLKTLL TFGNLKTLL 226 13025
HLA-B*08:01 FDNLKTLL FGNLKTLL 5539 456
HLA-B*08:01 FDNLKTLLSL FGNLKTLLSL 2672 260
HLA-A*31:01 DNLKTLLSLR GNLKTLLSLR 941 173
HLA-A*03:01 GEVITFDNLK GEVITFGNLK 1301 243
HLA-A*33:03 DNLKTLLSLR GNLKTLLSLR 131 446
HLA-A*02:11 ITFDNLKTL ITFGNLKTL 135 367
HLA-A*11:01 GEVITFDNLK GEVITFGNLK 103 39
HLA-A*11:01 EVITFDNLK EVITFGNLK 352 139
HLA-A*11:01 HLDGEVITFDNLK HLDGEVITFGNLK 1099 478
HLA-A*03:02 GEVITFDNLK GEVITFGNLK 407 193

S1807F

Reference  STFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    STFNVPMEKLKTLVATAEAELAKNVFLDNVLSTFISAARQGFVDSDVETKD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*58:01 VSLDNVLSTF VFLDNVLSTF 27 5289
HLA-B*57:01 VSLDNVLSTF VFLDNVLSTF 71 9670
HLA-B*44:02 AEAELAKNVS AEAELAKNVF 1684 13
HLA-B*44:03 AEAELAKNVS AEAELAKNVF 2231 18
HLA-B*40:01 AEAELAKNVS AEAELAKNVF 8476 112
HLA-A*23:01 VSLDNVLSTF VFLDNVLSTF 883 12
HLA-C*14:02 VSLDNVLSTF VFLDNVLSTF 3791 57
HLA-A*24:02 VSLDNVLSTF VFLDNVLSTF 2274 37
HLA-B*15:03 AEAELAKNVS AEAELAKNVF 23319 437
HLA-B*40:02 AEAELAKNVS AEAELAKNVF 2792 114
HLA-A*23:01 NVSLDNVLSTF NVFLDNVLSTF 10817 444
HLA-A*29:02 VSLDNVLSTF VFLDNVLSTF 6418 423
HLA-A*02:01 SLDNVLSTF FLDNVLSTF 1891 131
HLA-C*03:03 SLDNVLSTF FLDNVLSTF 4723 329
HLA-C*03:04 SLDNVLSTF FLDNVLSTF 4723 329
HLA-A*02:11 SLDNVLST FLDNVLST 3788 264
HLA-A*02:06 SLDNVLSTFI FLDNVLSTFI 307 22
HLA-B*35:01 SLDNVLSTF FLDNVLSTF 3897 287
HLA-C*03:02 SLDNVLSTF FLDNVLSTF 920 69
HLA-C*16:01 VSLDNVLSTF VFLDNVLSTF 381 4609
HLA-A*02:06 SLDNVLSTF FLDNVLSTF 1267 112
HLA-A*02:02 SLDNVLSTF FLDNVLSTF 952 85
HLA-C*08:01 SLDNVLSTF FLDNVLSTF 4593 414
HLA-A*02:02 VSLDNVLSTFI VFLDNVLSTFI 1936 188
HLA-A*02:01 VSLDNVLSTFI VFLDNVLSTFI 2854 278
HLA-A*02:01 SLDNVLSTFI FLDNVLSTFI 78 8
HLA-A*02:11 SLDNVLSTFIS FLDNVLSTFIS 1152 121
HLA-C*03:02 VSLDNVLSTF VFLDNVLSTF 201 1898
HLA-A*02:11 VSLDNVLSTFI VFLDNVLSTFI 593 63
HLA-A*02:11 SLDNVLSTF FLDNVLSTF 353 38
HLA-A*02:01 SLDNVLSTFIS FLDNVLSTFIS 3723 409
HLA-C*05:01 SLDNVLSTFI FLDNVLSTFI 515 57
HLA-A*02:11 NVSLDNVLSTFI NVFLDNVLSTFI 1761 201
HLA-A*02:11 SLDNVLSTFISAA FLDNVLSTFISAA 408 49
HLA-A*02:02 SLDNVLSTFIS FLDNVLSTFIS 3121 380
HLA-A*02:01 SLDNVLSTFISAA FLDNVLSTFISAA 1298 159
HLA-C*12:02 SLDNVLSTF FLDNVLSTF 3581 446
HLA-C*17:01 SLDNVLSTFI FLDNVLSTFI 3839 492
HLA-A*02:02 SLDNVLSTFI FLDNVLSTFI 35 5
HLA-A*02:02 SLDNVLSTFISAA FLDNVLSTFISAA 307 47
HLA-C*17:01 SLDNVLSTF FLDNVLSTF 812 133
HLA-A*02:02 SLDNVLSTFISA FLDNVLSTFISA 526 90
HLA-A*02:06 SLDNVLSTFISAA FLDNVLSTFISAA 2529 465
HLA-A*02:02 NVSLDNVLSTFI NVFLDNVLSTFI 2076 405
HLA-B*45:01 AEAELAKNVS AEAELAKNVF 173 848
HLA-C*08:02 SLDNVLSTF FLDNVLSTF 157 34
HLA-B*15:01 VSLDNVLSTF VFLDNVLSTF 279 1226
HLA-A*02:11 SLDNVLSTFISA FLDNVLSTFISA 100 23
HLA-A*02:11 SLDNVLSTFI FLDNVLSTFI 13 3
HLA-A*02:01 SLDNVLSTFISA FLDNVLSTFISA 203 49
HLA-A*68:02 NVSLDNVLSTFI NVFLDNVLSTFI 1180 286
HLA-C*05:01 SLDNVLSTF FLDNVLSTF 73 19
HLA-B*15:03 VSLDNVLSTF VFLDNVLSTF 157 493
HLA-C*14:02 SLDNVLSTF FLDNVLSTF 1131 400
HLA-A*02:06 SLDNVLSTFISA FLDNVLSTFISA 289 108
HLA-C*05:01 VSLDNVLSTF VFLDNVLSTF 256 656
HLA-B*40:02 AEAELAKNVSL AEAELAKNVFL 87 210
HLA-B*40:01 AEAELAKNVSL AEAELAKNVFL 33 72
HLA-B*15:03 SLDNVLSTF FLDNVLSTF 176 81
HLA-B*40:02 AELAKNVSL AELAKNVFL 21 43

NSP4 protein

NSP4

D217N

Reference  VLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    VLMDGSIIQFPNTYLEGSVRVVTTFNSEYCRHGTCERSEAGVCVSTSGRWV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*30:01 SVRVVTTFD SVRVVTTFN 276 44
HLA-C*16:01 VVTTFDSEY VVTTFNSEY 381 152
HLA-A*31:01 TTFDSEYCR TTFNSEYCR 52 21
HLA-A*31:01 VTTFDSEYCR VTTFNSEYCR 192 82
HLA-C*12:03 VVTTFDSEY VVTTFNSEY 881 380
HLA-A*31:01 VVTTFDSEYCR VVTTFNSEYCR 398 174

L438P

Reference  EEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSY
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    EEAALCTFLLNKEMYLKLRSDVLLPPTQYNRYLALYNKYKYFSGAMDTTSY

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 KLRSDVLLPL KLRSDVLLPP 5 1146
HLA-C*06:02 LRSDVLLPL LRSDVLLPP 103 17926
HLA-A*02:11 YLKLRSDVLLPL YLKLRSDVLLPP 5 788
HLA-A*02:11 LKLRSDVLLPL LKLRSDVLLPP 93 14621
HLA-C*07:02 LRSDVLLPL LRSDVLLPP 104 15467
HLA-C*07:01 LRSDVLLPL LRSDVLLPP 104 15210
HLA-A*02:01 KLRSDVLLPL KLRSDVLLPP 10 1434
HLA-A*02:02 KLRSDVLLPL KLRSDVLLPP 6 686
HLA-A*02:11 MYLKLRSDVLLPL MYLKLRSDVLLPP 82 9276
HLA-A*02:02 LKLRSDVLLPL LKLRSDVLLPP 120 12620
HLA-A*02:01 LKLRSDVLLPL LKLRSDVLLPP 161 15657
HLA-A*02:02 MYLKLRSDVLLPL MYLKLRSDVLLPP 49 4677
HLA-A*02:02 LPLTQYNRYL LPPTQYNRYL 241 20700
HLA-B*08:01 YLKLRSDVLLPL YLKLRSDVLLPP 13 1103
HLA-A*02:01 YLKLRSDVLLPL YLKLRSDVLLPP 11 889
HLA-A*02:02 YLKLRSDVLLPL YLKLRSDVLLPP 6 417
HLA-A*02:06 KLRSDVLLPL KLRSDVLLPP 29 1825
HLA-A*02:01 MYLKLRSDVLLPL MYLKLRSDVLLPP 161 9143
HLA-C*14:02 MYLKLRSDVLLPL MYLKLRSDVLLPP 313 17335
HLA-C*08:02 RSDVLLPL RSDVLLPP 400 21753
HLA-B*27:05 LRSDVLLPL LRSDVLLPP 81 4120
HLA-B*15:03 LRSDVLLPL LRSDVLLPP 149 6800
HLA-B*27:05 KLRSDVLLPL KLRSDVLLPP 94 4082
HLA-A*02:06 YLKLRSDVLLPL YLKLRSDVLLPP 35 1507
HLA-A*02:01 KLRSDVLLPLT KLRSDVLLPPT 144 5473
HLA-A*02:02 KLRSDVLLPLT KLRSDVLLPPT 183 6897
HLA-B*08:01 EMYLKLRSDVLLPL EMYLKLRSDVLLPP 231 8566
HLA-B*38:01 LRSDVLLPL LRSDVLLPP 499 18496
HLA-A*02:11 EMYLKLRSDVLLPL EMYLKLRSDVLLPP 400 14119
HLA-B*08:01 MYLKLRSDVLLPL MYLKLRSDVLLPP 151 5303
HLA-B*27:05 YLKLRSDVLLPL YLKLRSDVLLPP 270 9416
HLA-A*32:01 KLRSDVLLPL KLRSDVLLPP 418 14267
HLA-A*68:02 LTQYNRYLA PTQYNRYLA 349 11388
HLA-A*02:02 YLKLRSDVLLPLT YLKLRSDVLLPPT 82 2621
HLA-A*02:02 EMYLKLRSDVLLPL EMYLKLRSDVLLPP 322 9290
HLA-C*16:01 LTQYNRYLAL PTQYNRYLAL 285 8211
HLA-B*27:05 MYLKLRSDVLLPL MYLKLRSDVLLPP 378 10377
HLA-A*02:11 KLRSDVLLPLT KLRSDVLLPPT 114 2763
HLA-A*23:01 MYLKLRSDVLLPL MYLKLRSDVLLPP 466 10083
HLA-B*15:01 LTQYNRYLAL PTQYNRYLAL 125 2585
HLA-B*15:01 KLRSDVLLPL KLRSDVLLPP 335 6450
HLA-A*30:01 LTQYNRYLA PTQYNRYLA 171 3143
HLA-A*02:01 YLKLRSDVLLPLT YLKLRSDVLLPPT 177 2183
HLA-B*15:03 LTQYNRYLAL PTQYNRYLAL 15 177
HLA-B*53:01 LPLTQYNRY LPPTQYNRY 497 4773
HLA-A*02:06 LTQYNRYLAL PTQYNRYLAL 483 4423
HLA-A*11:01 LTQYNRYLALYNK PTQYNRYLALYNK 388 3496
HLA-A*02:11 YLKLRSDVLLPLT YLKLRSDVLLPPT 115 1005
HLA-B*35:01 LPLTQYNRY LPPTQYNRY 66 540
HLA-B*08:01 YLKLRSDVLLPLT YLKLRSDVLLPPT 258 1470
HLA-B*08:01 LTQYNRYLAL PTQYNRYLAL 126 711
HLA-A*01:01 LTQYNRYLALY PTQYNRYLALY 400 1559
HLA-A*02:11 LLPLTQYNRYL LLPPTQYNRYL 389 105
HLA-A*30:01 KLRSDVLLPL KLRSDVLLPP 108 390
HLA-A*29:02 LTQYNRYLALY PTQYNRYLALY 212 592
HLA-A*02:02 LLPLTQYNRYL LLPPTQYNRYL 400 145
HLA-A*02:01 VLLPLTQYNRYLAL VLLPPTQYNRYLAL 343 922
HLA-A*02:01 VLLPLTQYNRYL VLLPPTQYNRYL 170 445
HLA-A*30:02 LTQYNRYLALY PTQYNRYLALY 92 211
HLA-A*02:02 VLLPLTQYNRYL VLLPPTQYNRYL 147 335
HLA-B*42:01 LPLTQYNRYL LPPTQYNRYL 72 154
HLA-A*02:02 VLLPLTQYNRYLAL VLLPPTQYNRYLAL 381 810
HLA-A*29:02 VLLPLTQYNRY VLLPPTQYNRY 143 302

NSP7 protein

NSP7

L71F

Reference  TEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ
           ||||||||||||||||||||||||| ||||||||||||
Mutated    TEAFEKMVSLLSVLLSMQGAVDINKFCEEMLDNRATLQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:02 SMQGAVDINKL SMQGAVDINKF 382 10562
HLA-B*15:03 MQGAVDINKL MQGAVDINKF 1284 60
HLA-A*02:02 MQGAVDINKL MQGAVDINKF 359 7270
HLA-B*15:01 MQGAVDINKL MQGAVDINKF 1395 73
HLA-A*02:11 LCEEMLDNRATL FCEEMLDNRATL 709 64
HLA-B*58:01 LSMQGAVDINKL LSMQGAVDINKF 2789 298
HLA-A*02:02 LCEEMLDNRATL FCEEMLDNRATL 1191 137
HLA-A*02:01 LCEEMLDNRATL FCEEMLDNRATL 2490 324
HLA-A*02:02 KLCEEMLDNRATL KFCEEMLDNRATL 278 1870
HLA-A*02:11 KLCEEMLDNRATL KFCEEMLDNRATL 188 723
HLA-A*31:01 KLCEEMLDNR KFCEEMLDNR 673 240

NSP12 protein

NSP12

P323L

Reference  CVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    CVNCLDDRCILHCANFNVLFSTVFPLTSFGPLVRKIFVDGVPFVVSTGYHF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:01 FPPTSFGPLV FPLTSFGPLV 8999 21
HLA-A*02:02 FPPTSFGPLV FPLTSFGPLV 7237 18
HLA-A*02:11 FPPTSFGPLV FPLTSFGPLV 3405 9
HLA-A*32:01 VLFSTVFPP VLFSTVFPL 5415 27
HLA-A*02:11 LFSTVFPP LFSTVFPL 6706 35
HLA-A*02:11 ANFNVLFSTVFPP ANFNVLFSTVFPL 1827 12
HLA-A*02:11 NFNVLFSTVFPP NFNVLFSTVFPL 1779 13
HLA-A*02:11 NVLFSTVFPP NVLFSTVFPL 739 6
HLA-C*03:03 VLFSTVFPP VLFSTVFPL 28468 265
HLA-C*03:04 VLFSTVFPP VLFSTVFPL 28468 265
HLA-A*02:11 FNVLFSTVFPP FNVLFSTVFPL 413 4
HLA-C*14:02 VLFSTVFPP VLFSTVFPL 21407 220
HLA-A*02:11 FNVLFSTVFPPT FNVLFSTVFPLT 2618 27
HLA-A*02:01 LFSTVFPP LFSTVFPL 7475 81
HLA-C*14:02 LFSTVFPP LFSTVFPL 11979 138
HLA-B*15:03 VLFSTVFPP VLFSTVFPL 3115 36
HLA-A*02:11 VLFSTVFPP VLFSTVFPL 78 1
HLA-C*03:02 VLFSTVFPP VLFSTVFPL 20533 273
HLA-A*02:01 FNVLFSTVFPP FNVLFSTVFPL 656 9
HLA-A*02:01 ANFNVLFSTVFPP ANFNVLFSTVFPL 2569 37
HLA-A*02:11 FNVLFSTVFPPTS FNVLFSTVFPLTS 9448 142
HLA-A*02:02 NVLFSTVFPP NVLFSTVFPL 1088 17
HLA-A*02:11 CANFNVLFSTVFPP CANFNVLFSTVFPL 6143 96
HLA-A*02:02 FNVLFSTVFPP FNVLFSTVFPL 1014 16
HLA-A*68:02 NVLFSTVFPP NVLFSTVFPL 2213 37
HLA-A*02:02 ANFNVLFSTVFPP ANFNVLFSTVFPL 3126 53
HLA-A*02:11 PPTSFGPLV PLTSFGPLV 28329 483
HLA-C*16:01 VLFSTVFPP VLFSTVFPL 24733 432
HLA-C*17:01 VLFSTVFPP VLFSTVFPL 25087 439
HLA-A*02:01 FNVLFSTVFPPT FNVLFSTVFPLT 3765 66
HLA-A*02:02 LFSTVFPP LFSTVFPL 9311 167
HLA-A*02:01 NVLFSTVFPP NVLFSTVFPL 928 17
HLA-A*02:02 NFNVLFSTVFPP NFNVLFSTVFPL 2542 47
HLA-A*02:02 VLFSTVFPP VLFSTVFPL 269 5
HLA-A*02:01 NFNVLFSTVFPP NFNVLFSTVFPL 2286 44
HLA-A*02:06 FPPTSFGPLV FPLTSFGPLV 3379 73
HLA-A*02:01 VLFSTVFPP VLFSTVFPL 179 4
HLA-A*02:06 FNVLFSTVFPP FNVLFSTVFPL 1609 37
HLA-A*02:02 FNVLFSTVFPPT FNVLFSTVFPLT 4116 110
HLA-A*02:11 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 6695 180
HLA-A*02:01 FNVLFSTVFPPTS FNVLFSTVFPLTS 11451 311
HLA-A*02:06 VLFSTVFPP VLFSTVFPL 368 10
HLA-A*02:11 ANFNVLFSTVFPPT ANFNVLFSTVFPLT 14639 409
HLA-A*02:01 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 12596 425
HLA-A*68:01 PTSFGPLVR LTSFGPLVR 908 36
HLA-A*02:06 NVLFSTVFPP NVLFSTVFPL 1611 66
HLA-B*15:01 VLFSTVFPP VLFSTVFPL 5731 243
HLA-B*35:01 FPPTSFGPL FPLTSFGPL 304 13
HLA-B*53:01 FPPTSFGPL FPLTSFGPL 3581 154
HLA-C*01:02 FPPTSFGPL FPLTSFGPL 217 4855
HLA-A*02:01 CANFNVLFSTVFPP CANFNVLFSTVFPL 8519 384
HLA-A*02:02 FNVLFSTVFPPTS FNVLFSTVFPLTS 10920 497
HLA-A*02:02 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 6958 322
HLA-A*02:11 VFPPTSFGPLV VFPLTSFGPLV 4242 199
HLA-A*02:02 CANFNVLFSTVFPP CANFNVLFSTVFPL 8183 391
HLA-A*02:11 NFNVLFSTVFPPT NFNVLFSTVFPLT 9111 472
HLA-A*02:06 ANFNVLFSTVFPP ANFNVLFSTVFPL 5191 304
HLA-A*02:06 NFNVLFSTVFPP NFNVLFSTVFPL 4220 274
HLA-A*02:06 FNVLFSTVFPPT FNVLFSTVFPLT 4868 388
HLA-B*35:03 FPPTSFGPL FPLTSFGPL 286 24
HLA-A*03:01 PTSFGPLVRK LTSFGPLVRK 554 47
HLA-A*31:01 PTSFGPLVR LTSFGPLVR 4402 390
HLA-A*11:01 PTSFGPLVR LTSFGPLVR 4068 379
HLA-A*03:02 PTSFGPLVRK LTSFGPLVRK 868 88
HLA-B*07:02 STVFPPTSFGPL STVFPLTSFGPL 777 79
HLA-A*68:01 PTSFGPLVRK LTSFGPLVRK 308 34
HLA-B*07:02 TVFPPTSFGPL TVFPLTSFGPL 1498 171
HLA-A*02:11 STVFPPTSFGPLV STVFPLTSFGPLV 2427 285
HLA-A*02:11 NVLFSTVFPPT NVLFSTVFPLT 1183 139
HLA-A*33:03 PTSFGPLVR LTSFGPLVR 3228 381
HLA-A*26:01 STVFPPTSF STVFPLTSF 786 95
HLA-B*07:02 VFPPTSFGPL VFPLTSFGPL 339 43
HLA-A*02:01 NVLFSTVFPPT NVLFSTVFPLT 2111 290
HLA-B*42:01 FSTVFPPTSFGPL FSTVFPLTSFGPL 1320 185
HLA-B*42:01 STVFPPTSFGPL STVFPLTSFGPL 738 111
HLA-A*02:01 VLFSTVFPPTSF VLFSTVFPLTSF 2225 342
HLA-B*08:01 FPPTSFGPL FPLTSFGPL 973 153
HLA-B*42:01 TVFPPTSFGPL TVFPLTSFGPL 843 142
HLA-A*11:01 PTSFGPLVRK LTSFGPLVRK 123 21
HLA-B*42:01 VFPPTSFGPL VFPLTSFGPL 274 47
HLA-A*02:01 VLFSTVFPPTS VLFSTVFPLTS 708 124
HLA-B*07:02 FSTVFPPTSFGPL FSTVFPLTSFGPL 2537 466
HLA-B*07:02 FPPTSFGPL FPLTSFGPL 42 8
HLA-A*02:11 VLFSTVFPPTSF VLFSTVFPLTSF 1019 195
HLA-A*25:01 STVFPPTSF STVFPLTSF 1533 296
HLA-B*07:02 FPPTSFGPLV FPLTSFGPLV 1131 236
HLA-B*42:01 FPPTSFGPL FPLTSFGPL 21 5
HLA-A*26:01 FSTVFPPTSF FSTVFPLTSF 1667 398
HLA-B*51:01 FPPTSFGPL FPLTSFGPL 1809 433
HLA-A*02:11 VLFSTVFPPTS VLFSTVFPLTS 309 74
HLA-B*42:01 FPPTSFGPLV FPLTSFGPLV 368 89
HLA-A*02:02 VLFSTVFPPTS VLFSTVFPLTS 1210 377
HLA-C*03:02 FPPTSFGPL FPLTSFGPL 960 313
HLA-A*32:01 STVFPPTSF STVFPLTSF 230 86
HLA-B*58:01 FSTVFPPTSF FSTVFPLTSF 88 33
HLA-B*15:01 STVFPPTSF STVFPLTSF 130 49
HLA-A*02:01 VLFSTVFPPT VLFSTVFPLT 61 23
HLA-C*03:03 FPPTSFGPL FPLTSFGPL 375 145
HLA-C*03:04 FPPTSFGPL FPLTSFGPL 375 145
HLA-A*02:02 VLFSTVFPPT VLFSTVFPLT 113 44
HLA-C*16:01 FSTVFPPTS FSTVFPLTS 1127 460
HLA-C*14:02 LFSTVFPPTSF LFSTVFPLTSF 396 950
HLA-C*01:02 VFPPTSFGPL VFPLTSFGPL 429 997
HLA-A*02:02 TVFPPTSFGPLV TVFPLTSFGPLV 789 343
HLA-A*68:02 STVFPPTSFGPLV STVFPLTSFGPLV 169 74
HLA-A*02:11 VLFSTVFPPT VLFSTVFPLT 25 11
HLA-A*03:01 TVFPPTSFGPLVRK TVFPLTSFGPLVRK 92 198
HLA-C*14:02 VFPPTSFGPL VFPLTSFGPL 47 99
HLA-A*23:01 LFSTVFPPTSF LFSTVFPLTSF 370 179

NSP13 protein

NSP13

L280F

Reference  TLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TLNISDEFSSNVANYQKVGMQKYSTFQGPPGTGKSHFAIGLALYYPSARIV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*15:03 VGMQKYSTL VGMQKYSTF 927 41
HLA-B*15:01 KVGMQKYSTL KVGMQKYSTF 3133 163
HLA-A*03:01 TLQGPPGTGK TFQGPPGTGK 119 2170
HLA-B*15:03 KVGMQKYSTL KVGMQKYSTF 3689 214
HLA-B*15:03 YQKVGMQKYSTL YQKVGMQKYSTF 253 16
HLA-B*15:01 YQKVGMQKYSTL YQKVGMQKYSTF 512 33
HLA-A*23:01 VGMQKYSTL VGMQKYSTF 4632 379
HLA-A*03:02 TLQGPPGTGK TFQGPPGTGK 147 1741
HLA-B*15:03 QKVGMQKYSTL QKVGMQKYSTF 3733 322
HLA-B*15:03 GMQKYSTL GMQKYSTF 5092 464
HLA-B*15:03 NYQKVGMQKYSTL NYQKVGMQKYSTF 4567 446
HLA-A*68:01 STLQGPPGTGK STFQGPPGTGK 1382 141
HLA-A*24:02 NYQKVGMQKYSTL NYQKVGMQKYSTF 1328 141
HLA-A*23:01 NYQKVGMQKYSTL NYQKVGMQKYSTF 1415 152
HLA-B*08:01 YQKVGMQKYSTL YQKVGMQKYSTF 121 733
HLA-B*08:01 VGMQKYSTL VGMQKYSTF 57 342
HLA-C*03:02 VGMQKYSTL VGMQKYSTF 970 208
HLA-A*32:01 KVGMQKYSTL KVGMQKYSTF 809 194
HLA-A*11:01 TLQGPPGTGK TFQGPPGTGK 326 1321
HLA-C*03:03 VGMQKYSTL VGMQKYSTF 330 1283
HLA-C*03:04 VGMQKYSTL VGMQKYSTF 330 1283
HLA-B*08:01 KVGMQKYSTL KVGMQKYSTF 458 1769
HLA-A*03:01 STLQGPPGTGK STFQGPPGTGK 284 82
HLA-A*30:01 STLQGPPGTGK STFQGPPGTGK 1558 466
HLA-A*68:01 YSTLQGPPGTGK YSTFQGPPGTGK 1177 494
HLA-A*03:02 STLQGPPGTGK STFQGPPGTGK 428 199
HLA-B*15:01 MQKYSTLQG MQKYSTFQG 306 617
HLA-A*11:01 YSTLQGPPGTGK YSTFQGPPGTGK 557 277

A368V

Reference  FDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRA
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    FDKFKVNSTLEQYVFCTVNALPETTVDIVVFDEISMATNYDLSVVNARLRA

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 YVFCTVNALPETTA YVFCTVNALPETTV 2317 156
HLA-A*68:02 TVNALPETTA TVNALPETTV 2375 204
HLA-A*68:02 YVFCTVNALPETTA YVFCTVNALPETTV 2743 468
HLA-A*02:06 YVFCTVNALPETTA YVFCTVNALPETTV 1022 197
HLA-A*68:02 TADIVVFDEI TVDIVVFDEI 801 158
HLA-A*02:06 CTVNALPETTA CTVNALPETTV 1733 348
HLA-A*02:02 YVFCTVNALPETTA YVFCTVNALPETTV 2115 432
HLA-A*26:01 ETTADIVVF ETTVDIVVF 179 618
HLA-A*68:02 TTADIVVFDEISM TTVDIVVFDEISM 140 467
HLA-A*68:02 TTADIVVFDEI TTVDIVVFDEI 26 81
HLA-A*25:01 ETTADIVVF ETTVDIVVF 388 1063
HLA-A*68:02 TTADIVVFDEISMA TTVDIVVFDEISMA 89 220
HLA-A*68:02 TTADIVVFDEIS TTVDIVVFDEIS 432 998