Summary

This strain contains 20 protein-level mutations:

  • 10 mutations in Spike protein: LGV 141-143 deletion, LA 242-243 deletion, Y265C, E484K, N501Y, D614G, P681H, E1092K, H1101Y, V1176F
  • 1 mutation in N protein: 203-204 RG->KR
  • 1 mutation in NS9c protein: G50N
  • 2 mutations in NSP3 protein: D736G, S1807F
  • 2 mutations in NSP4 protein: D217N, L438P
  • 1 mutation in NSP7 protein: L71F
  • 1 mutation in NSP12 protein: P323L
  • 2 mutations in NSP13 protein: L280F, A368V

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

LGV 141-143 deletion

Reference  SLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTF
           |||||||||||||||||||||||||   |||||||||||||||||||||||||
Mutated    SLLIVNNATNVVIKVCEFQFCNDPF‑‑‑YYHKNNKSWMESEFRVYSSANNCTF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*02:01 VYYHKNNKSWMESEFRVYSS - 102 -
HLA-DPA1*03:01/DPB1*02:01 TNVVIKVCEFQFCNDPFLGV - 107 -
HLA-DPA1*03:01/DPB1*02:01 GVYYHKNNKSWMESEFRVYS - 115 -
HLA-DPA1*03:01/DPB1*04:01 TNVVIKVCEFQFCNDPFLGV - 116 -
HLA-DPA1*03:01/DPB1*01:01 TNVVIKVCEFQFCNDPFLGV - 135 -
HLA-DPA1*03:01/DPB1*02:01 NVVIKVCEFQFCNDPFLGV - 138 -
HLA-DPA1*03:01/DPB1*04:01 NVVIKVCEFQFCNDPFLGV - 139 -
HLA-DQA1*01:02/DQB1*05:01 TNVVIKVCEFQFCNDPFLGV - 140 -
HLA-DPA1*03:01/DPB1*04:01 VYYHKNNKSWMESEFRVYSS - 145 -
HLA-DPA1*03:01/DPB1*02:01 LGVYYHKNNKSWMESEFRVY - 147 -
HLA-DPA1*03:01/DPB1*02:01 VYYHKNNKSWMESEFRVYS - 160 -
HLA-DPA1*03:01/DPB1*01:01 VYYHKNNKSWMESEFRVYSS - 163 -
HLA-DPA1*03:01/DPB1*04:01 GVYYHKNNKSWMESEFRVYS - 164 -
HLA-DPA1*03:01/DPB1*01:01 NVVIKVCEFQFCNDPFLGV - 170 -
HLA-DQA1*01:02/DQB1*05:01 NVVIKVCEFQFCNDPFLGV - 174 -
HLA-DRB1*15:01 LGVYYHKNNKSWMESEFRVY - 177 -
HLA-DPA1*04:01/DPB1*02:01 VYYHKNNKSWMESEFRVYSS - 180 -
HLA-DQA1*01:02/DQB1*05:01 ATNVVIKVCEFQFCNDPFLG - 180 -
HLA-DPA1*03:01/DPB1*01:01 GVYYHKNNKSWMESEFRVYS - 181 -
HLA-DQA1*01:02/DQB1*05:01 NATNVVIKVCEFQFCNDPFL - 182 -
HLA-DPA1*04:01/DPB1*02:01 TNVVIKVCEFQFCNDPFLGV - 193 -
HLA-DPA1*01:03/DPB1*02:01 VYYHKNNKSWMESEFRVYSS - 194 -
HLA-DPA1*04:01/DPB1*01:01 VYYHKNNKSWMESEFRVYSS - 199 -
HLA-DQA1*01:02/DQB1*05:01 VYYHKNNKSWMESEFRVYSS - 203 -
HLA-DRB1*13:02 LGVYYHKNNKSWMESEFRVY - 206 -
HLA-DPA1*03:01/DPB1*04:01 VYYHKNNKSWMESEFRVYS - 207 -
HLA-DPA1*04:01/DPB1*01:01 TNVVIKVCEFQFCNDPFLGV - 207 -
HLA-DPA1*02:02/DPB1*01:01 VYYHKNNKSWMESEFRVYSS - 208 -
HLA-DPA1*03:01/DPB1*04:01 LGVYYHKNNKSWMESEFRVY - 208 -
HLA-DPA1*04:01/DPB1*02:01 GVYYHKNNKSWMESEFRVYS - 209 -
HLA-DPA1*04:01/DPB1*04:01 TNVVIKVCEFQFCNDPFLGV - 211 -
HLA-DPA1*03:01/DPB1*01:01 LGVYYHKNNKSWMESEFRVY - 212 -
HLA-DPA1*04:01/DPB1*04:01 VYYHKNNKSWMESEFRVYSS - 215 -
HLA-DQA1*01:02/DQB1*05:01 VVIKVCEFQFCNDPFL - 216 -
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFL - 218 -
HLA-DPA1*03:01/DPB1*02:01 NVVIKVCEFQFCNDPFL - 219 -
HLA-DPA1*03:01/DPB1*01:01 NATNVVIKVCEFQFCNDPFL - 220 -
HLA-DPA1*04:01/DPB1*01:01 GVYYHKNNKSWMESEFRVYS - 220 -
HLA-DRB1*11:02 LGVYYHKNNKSWMESEFRVY - 222 -
HLA-DRB1*13:01 LGVYYHKNNKSWMESEFRVY - 222 -
HLA-DPA1*02:02/DPB1*01:01 TNVVIKVCEFQFCNDPFLGV - 223 -
HLA-DQA1*01:02/DQB1*05:01 LGVYYHKNNKSWMESEFRVY - 223 -
HLA-DPA1*03:01/DPB1*02:01 NATNVVIKVCEFQFCNDPFL - 225 -
HLA-DPA1*03:01/DPB1*02:01 ATNVVIKVCEFQFCNDPFLG - 225 -
HLA-DPA1*03:01/DPB1*02:01 GVYYHKNNKSWMESEFRVY - 226 -
HLA-DQA1*01:02/DQB1*05:01 TNVVIKVCEFQFCNDPFLG - 228 -
HLA-DPA1*04:01/DPB1*02:01 NVVIKVCEFQFCNDPFLGV - 230 -
HLA-DQA1*01:02/DQB1*05:01 GVYYHKNNKSWMESEFRVYS - 232 -
HLA-DPA1*03:01/DPB1*01:01 ATNVVIKVCEFQFCNDPFLG - 233 -
HLA-DPA1*01:03/DPB1*02:01 GVYYHKNNKSWMESEFRVYS - 234 -
HLA-DQA1*01:02/DQB1*05:01 ATNVVIKVCEFQFCNDPFL - 235 -
HLA-DPA1*03:01/DPB1*01:01 VYYHKNNKSWMESEFRVYS - 238 -
HLA-DPA1*02:02/DPB1*01:01 GVYYHKNNKSWMESEFRVYS - 244 -
HLA-DPA1*03:01/DPB1*04:02 TNVVIKVCEFQFCNDPFLGV - 247 -
HLA-DPA1*03:01/DPB1*105:01 TNVVIKVCEFQFCNDPFLGV - 247 -
HLA-DPA1*04:01/DPB1*04:01 GVYYHKNNKSWMESEFRVYS - 247 -
HLA-DPA1*01:03/DPB1*04:01 TNVVIKVCEFQFCNDPFLGV - 250 -
HLA-DPA1*03:01/DPB1*02:01 ATNVVIKVCEFQFCNDPFL - 250 -
HLA-DPA1*03:01/DPB1*02:01 TNVVIKVCEFQFCNDPFLG - 250 -
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFLG - 256 -
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFLGV - 257 -
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFLGV - 257 -
HLA-DPA1*01:03/DPB1*01:01 TNVVIKVCEFQFCNDPFLGV - 258 -
HLA-DPA1*01:03/DPB1*02:01 TNVVIKVCEFQFCNDPFLGV - 258 -
HLA-DPA1*02:02/DPB1*01:01 NVVIKVCEFQFCNDPFLGV - 258 -
HLA-DPA1*04:01/DPB1*04:01 NVVIKVCEFQFCNDPFLGV - 258 -
HLA-DPA1*03:01/DPB1*01:01 VVIKVCEFQFCNDPFL - 261 -
HLA-DRB1*13:02 GVYYHKNNKSWMESEFRVYS - 270 -
HLA-DQA1*01:02/DQB1*05:01 VVIKVCEFQFCNDPFLGV - 272 -
HLA-DPA1*03:01/DPB1*01:01 ATNVVIKVCEFQFCNDPFL - 274 -
HLA-DPA1*03:01/DPB1*04:01 GVYYHKNNKSWMESEFRVY - 275 -
HLA-DPA1*04:01/DPB1*01:01 LGVYYHKNNKSWMESEFRVY - 275 -
HLA-DPA1*04:01/DPB1*02:01 LGVYYHKNNKSWMESEFRVY - 277 -
HLA-DPA1*01:03/DPB1*04:01 VYYHKNNKSWMESEFRVYSS - 284 -
HLA-DPA1*04:01/DPB1*01:01 NVVIKVCEFQFCNDPFLGV - 284 -
HLA-DPA1*03:01/DPB1*04:01 NATNVVIKVCEFQFCNDPFL - 288 -
HLA-DQA1*01:02/DQB1*05:01 NVVIKVCEFQFCNDPFL - 288 -
HLA-DPA1*03:01/DPB1*01:01 TNVVIKVCEFQFCNDPFLG - 290 -
HLA-DPA1*04:01/DPB1*02:01 VYYHKNNKSWMESEFRVYS - 290 -
HLA-DPA1*03:01/DPB1*05:01 TNVVIKVCEFQFCNDPFLGV - 291 -
HLA-DQA1*01:02/DQB1*05:01 VVIKVCEFQFCNDPFLG - 294 -
HLA-DPA1*03:01/DPB1*01:01 GVYYHKNNKSWMESEFRVY - 295 -
HLA-DPA1*04:01/DPB1*01:01 VYYHKNNKSWMESEFRVYS - 300 -
HLA-DPA1*01:03/DPB1*01:01 NVVIKVCEFQFCNDPFLGV - 301 -
HLA-DPA1*03:01/DPB1*01:01 VVIKVCEFQFCNDPFLGV - 301 -
HLA-DPA1*03:01/DPB1*01:01 NVVIKVCEFQFCNDPFL - 302 -
HLA-DPA1*03:01/DPB1*04:01 NVVIKVCEFQFCNDPFL - 305 -
HLA-DPA1*03:01/DPB1*04:01 ATNVVIKVCEFQFCNDPFLG - 306 -
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFL - 307 -
HLA-DPA1*01:03/DPB1*02:01 VYYHKNNKSWMESEFRVYS - 311 -
HLA-DPA1*03:01/DPB1*04:01 ATNVVIKVCEFQFCNDPFL - 312 -
HLA-DPA1*01:03/DPB1*01:01 VYYHKNNKSWMESEFRVYSS - 313 -
HLA-DPA1*02:02/DPB1*01:01 LGVYYHKNNKSWMESEFRVY - 315 -
HLA-DPA1*03:01/DPB1*04:02 NVVIKVCEFQFCNDPFLGV - 315 -
HLA-DPA1*03:01/DPB1*105:01 NVVIKVCEFQFCNDPFLGV - 315 -
HLA-DPA1*03:01/DPB1*05:01 VYYHKNNKSWMESEFRVYSS - 317 -
HLA-DPA1*01:03/DPB1*04:01 NVVIKVCEFQFCNDPFLGV - 320 -
HLA-DRB1*15:01 LGVYYHKNNKSWMESEFRV - 320 -
HLA-DRB1*01:01 LGVYYHKNNKSWMESEFRVY - 323 -
HLA-DPA1*04:01/DPB1*04:01 VYYHKNNKSWMESEFRVYS - 324 -
HLA-DPA1*02:01/DPB1*01:01 TNVVIKVCEFQFCNDPFLGV - 326 -
HLA-DPA1*03:01/DPB1*04:01 TNVVIKVCEFQFCNDPFLG - 330 -
HLA-DPA1*01:03/DPB1*02:01 LGVYYHKNNKSWMESEFRVY - 333 -
HLA-DPA1*03:01/DPB1*05:01 GVYYHKNNKSWMESEFRVYS - 336 -
HLA-DPA1*01:03/DPB1*04:01 GVYYHKNNKSWMESEFRVYS - 337 -
HLA-DPA1*02:02/DPB1*01:01 VYYHKNNKSWMESEFRVYS - 338 -
HLA-DPA1*03:01/DPB1*01:01 VVIKVCEFQFCNDPFLG - 338 -
HLA-DPA1*01:03/DPB1*01:01 GVYYHKNNKSWMESEFRVYS - 344 -
HLA-DPA1*02:01/DPB1*01:01 NVVIKVCEFQFCNDPFLGV - 348 -
HLA-DPA1*04:01/DPB1*04:01 LGVYYHKNNKSWMESEFRVY - 348 -
HLA-DRB1*11:02 GVYYHKNNKSWMESEFRVYS - 350 -
HLA-DRB1*13:01 GVYYHKNNKSWMESEFRVYS - 350 -
HLA-DPA1*01:03/DPB1*02:01 NVVIKVCEFQFCNDPFLGV - 356 -
HLA-DQA1*01:03/DQB1*05:01 LGVYYHKNNKSWMESEFRVY - 361 -
HLA-DPA1*02:01/DPB1*01:01 VYYHKNNKSWMESEFRVYSS - 362 -
HLA-DQA1*01:02/DQB1*05:01 NVVIKVCEFQFCNDPFLG - 368 -
HLA-DQA1*01:02/DQB1*05:01 TNVVIKVCEFQFCNDPFL - 370 -
HLA-DPA1*02:02/DPB1*02:01 VYYHKNNKSWMESEFRVYSS - 371 -
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFLG - 376 -
HLA-DPA1*02:02/DPB1*04:01 TNVVIKVCEFQFCNDPFLGV - 382 -
HLA-DPA1*04:01/DPB1*01:01 NATNVVIKVCEFQFCNDPFL - 382 -
HLA-DPA1*04:01/DPB1*01:01 GVYYHKNNKSWMESEFRVY - 383 -
HLA-DPA1*02:02/DPB1*02:01 TNVVIKVCEFQFCNDPFLGV - 386 -
HLA-DQA1*01:02/DQB1*05:01 GVYYHKNNKSWMESEFRVY - 387 -
HLA-DPA1*02:02/DPB1*01:01 VVIKVCEFQFCNDPFLGV - 389 -
HLA-DPA1*04:01/DPB1*01:01 ATNVVIKVCEFQFCNDPFLG - 390 -
HLA-DQA1*01:02/DQB1*05:01 VYYHKNNKSWMESEFRVYS - 392 -
HLA-DQA1*01:03/DQB1*05:01 TNVVIKVCEFQFCNDPFLGV - 392 -
HLA-DRB1*11:01 LGVYYHKNNKSWMESEFRVY - 392 -
HLA-DRB1*15:03 LGVYYHKNNKSWMESEFRVY - 393 -
HLA-DRB1*15:01 GVYYHKNNKSWMESEFRVYS - 395 -
HLA-DRB1*13:02 VYYHKNNKSWMESEFRVYSS - 396 -
HLA-DQA1*01:03/DQB1*05:01 VYYHKNNKSWMESEFRVYSS - 397 -
HLA-DPA1*01:03/DPB1*01:01 LGVYYHKNNKSWMESEFRVY - 399 -
HLA-DRB1*13:02 LGVYYHKNNKSWMESEFRV - 400 -
HLA-DPA1*03:01/DPB1*05:01 LGVYYHKNNKSWMESEFRVY - 401 -
HLA-DRB1*10:01 LGVYYHKNNKSWMESEFRVY - 410 -
HLA-DPA1*02:02/DPB1*02:01 GVYYHKNNKSWMESEFRVYS - 412 -
HLA-DPA1*04:01/DPB1*02:01 GVYYHKNNKSWMESEFRVY - 419 -
HLA-DPA1*03:01/DPB1*04:02 VYYHKNNKSWMESEFRVYSS - 420 -
HLA-DPA1*03:01/DPB1*105:01 VYYHKNNKSWMESEFRVYSS - 420 -
HLA-DQA1*01:03/DQB1*05:01 GVYYHKNNKSWMESEFRVYS - 420 -
HLA-DRB1*01:01 GVYYHKNNKSWMESEFRVYS - 427 -
HLA-DPA1*02:01/DPB1*01:01 GVYYHKNNKSWMESEFRVYS - 430 -
HLA-DPA1*03:01/DPB1*02:01 VYYHKNNKSWMESEFRVY - 433 -
HLA-DPA1*04:01/DPB1*05:01 VYYHKNNKSWMESEFRVYSS - 433 -
HLA-DRB1*11:04 LGVYYHKNNKSWMESEFRVY - 433 -
HLA-DPA1*03:01/DPB1*05:01 NVVIKVCEFQFCNDPFLGV - 435 -
HLA-DPA1*04:01/DPB1*04:01 VVIKVCEFQFCNDPFLGV - 435 -
HLA-DPA1*01:03/DPB1*01:01 VYYHKNNKSWMESEFRVYS - 437 -
HLA-DQA1*01:02/DQB1*05:01 LGVYYHKNNKSWMESEFRV - 439 -
HLA-DPA1*02:02/DPB1*01:01 GVYYHKNNKSWMESEFRVY - 445 -
HLA-DRB1*11:02 LGVYYHKNNKSWMESEFRV - 448 -
HLA-DRB1*13:01 LGVYYHKNNKSWMESEFRV - 448 -
HLA-DPA1*04:01/DPB1*02:01 VVIKVCEFQFCNDPFLGV - 450 -
HLA-DPA1*01:03/DPB1*04:01 VYYHKNNKSWMESEFRVYS - 455 -
HLA-DPA1*02:02/DPB1*04:01 NVVIKVCEFQFCNDPFLGV - 457 -
HLA-DPA1*04:01/DPB1*05:01 GVYYHKNNKSWMESEFRVYS - 457 -
HLA-DRB1*13:02 GVYYHKNNKSWMESEFR - 458 -
HLA-DPA1*04:01/DPB1*04:01 GVYYHKNNKSWMESEFRVY - 459 -
HLA-DPA1*03:01/DPB1*05:01 NATNVVIKVCEFQFCNDPFL - 466 -
HLA-DPA1*01:03/DPB1*02:01 GVYYHKNNKSWMESEFRVY - 470 -
HLA-DRB1*15:02 LGVYYHKNNKSWMESEFRVY - 470 -
HLA-DQA1*01:03/DQB1*05:01 NATNVVIKVCEFQFCNDPFL - 471 -
HLA-DRB1*13:02 VYYHKNNKSWMESEFR - 471 -
HLA-DPA1*03:01/DPB1*02:01 TNVVIKVCEFQFCNDPFL - 473 -
HLA-DQA1*01:02/DQB1*06:09 TNVVIKVCEFQFCNDPFLGV - 478 -
HLA-DPA1*02:02/DPB1*04:01 VYYHKNNKSWMESEFRVYSS - 482 -
HLA-DRB1*10:01 GVYYHKNNKSWMESEFRVYS - 482 -
HLA-DRB1*04:02 LGVYYHKNNKSWMESEFRVY - 485 -
HLA-DQA1*01:03/DQB1*05:01 ATNVVIKVCEFQFCNDPFLG - 487 -
HLA-DPA1*01:03/DPB1*04:01 LGVYYHKNNKSWMESEFRVY - 489 -
HLA-DPA1*03:01/DPB1*05:01 ATNVVIKVCEFQFCNDPFLG - 489 -
HLA-DPA1*03:01/DPB1*01:01 TNVVIKVCEFQFCNDPFL - 491 -
HLA-DPA1*04:01/DPB1*01:01 VVIKVCEFQFCNDPFLGV - 491 -
HLA-DRB1*15:01 GVYYHKNNKSWMESEFR - 491 -
HLA-DPA1*02:02/DPB1*05:01 VYYHKNNKSWMESEFRVYSS - 493 -
HLA-DQA1*01:02/DQB1*06:09 VYYHKNNKSWMESEFRVYSS - 495 -
HLA-DPA1*04:01/DPB1*01:01 VVIKVCEFQFCNDPFL - 497 -
HLA-DQA1*01:03/DQB1*05:01 NVVIKVCEFQFCNDPFLGV - 497 -
HLA-DPA1*01:03/DPB1*02:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 42 1841
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 47 1562
HLA-DPA1*01:03/DPB1*02:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 42 1357
HLA-DPA1*01:03/DPB1*02:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 59 1723
HLA-DPA1*01:03/DPB1*02:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 46 1339
HLA-DPA1*01:03/DPB1*02:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 55 1589
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 67 1898
HLA-DPA1*01:03/DPB1*04:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 58 1614
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 81 2243
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 87 2353
HLA-DPA1*01:03/DPB1*04:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 63 1614
HLA-DPA1*01:03/DPB1*04:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 136 3297
HLA-DPA1*04:01/DPB1*02:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 45 1087
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 56 1351
HLA-DPA1*01:03/DPB1*02:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 68 1638
HLA-DPA1*01:03/DPB1*04:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 57 1351
HLA-DPA1*03:01/DPB1*02:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 35 825
HLA-DPA1*01:03/DPB1*04:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 89 2076
HLA-DPA1*01:03/DPB1*02:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 66 1501
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 266 6010
HLA-DPA1*03:01/DPB1*04:02 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 70 1579
HLA-DPA1*03:01/DPB1*105:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 70 1579
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 220 4940
HLA-DPA1*03:01/DPB1*04:02 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 73 1631
HLA-DPA1*03:01/DPB1*105:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 73 1631
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 104 2302
HLA-DPA1*01:03/DPB1*02:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 79 1727
HLA-DPA1*03:01/DPB1*04:02 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 100 2138
HLA-DPA1*03:01/DPB1*105:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 100 2138
HLA-DPA1*03:01/DPB1*04:02 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 148 3061
HLA-DPA1*03:01/DPB1*105:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 148 3061
HLA-DPA1*01:03/DPB1*04:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 57 1178
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 291 5956
HLA-DPA1*04:01/DPB1*04:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 56 1070
HLA-DPA1*03:01/DPB1*04:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 45 836
HLA-DPA1*04:01/DPB1*02:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 44 812
HLA-DPA1*04:01/DPB1*04:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 57 1048
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 92 1686
HLA-DPA1*03:01/DPB1*04:02 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 69 1249
HLA-DPA1*03:01/DPB1*105:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 69 1249
HLA-DRB1*01:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 1287 72
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 113 2018
HLA-DRB1*01:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 1267 71
HLA-DPA1*03:01/DPB1*02:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 34 598
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 80 1392
HLA-DPA1*04:01/DPB1*02:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 51 885
HLA-DPA1*03:01/DPB1*04:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 70 1205
HLA-DPA1*01:03/DPB1*04:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 82 1410
HLA-DPA1*03:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 51 873
HLA-DPA1*01:03/DPB1*04:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 191 3251
HLA-DPA1*04:01/DPB1*02:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 53 902
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 37 628
HLA-DPA1*01:03/DPB1*04:02 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 182 3089
HLA-DPA1*01:03/DPB1*105:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 182 3089
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 122 2058
HLA-DPA1*02:01/DPB1*01:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 131 2204
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 290 4855
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 290 4855
HLA-DPA1*01:03/DPB1*04:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 79 1317
HLA-DPA1*03:01/DPB1*04:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 107 1782
HLA-DPA1*03:01/DPB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 238 3958
HLA-DPA1*03:01/DPB1*105:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 238 3958
HLA-DPA1*04:01/DPB1*02:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 59 979
HLA-DPA1*02:01/DPB1*01:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 187 3101
HLA-DPA1*04:01/DPB1*04:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 80 1326
HLA-DPA1*01:03/DPB1*04:02 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 183 3025
HLA-DPA1*01:03/DPB1*105:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 183 3025
HLA-DPA1*03:01/DPB1*04:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 48 789
HLA-DPA1*03:01/DPB1*04:02 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 67 1099
HLA-DPA1*03:01/DPB1*105:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 67 1099
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 145 2370
HLA-DPA1*03:01/DPB1*02:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 41 663
HLA-DPA1*01:03/DPB1*04:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 114 1830
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 334 5203
HLA-DPA1*04:01/DPB1*04:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 57 886
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 314 4855
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 314 4855
HLA-DPA1*01:03/DPB1*02:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 120 1855
HLA-DPA1*02:01/DPB1*01:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 96 1478
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 71 1093
HLA-DPA1*04:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 60 919
HLA-DPA1*02:01/DPB1*01:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 99 1514
HLA-DPA1*01:03/DPB1*04:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 75 1135
HLA-DPA1*01:03/DPB1*02:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 137 2063
HLA-DRB1*15:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 92 1382
HLA-DPA1*03:01/DPB1*04:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 44 659
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 87 1303
HLA-DPA1*01:03/DPB1*04:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 76 1138
HLA-DPA1*03:01/DPB1*04:02 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 133 1984
HLA-DPA1*03:01/DPB1*105:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 133 1984
HLA-DRB1*01:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1885 127
HLA-DPA1*03:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 174 2581
HLA-DPA1*01:03/DPB1*04:02 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 227 3358
HLA-DPA1*01:03/DPB1*105:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 227 3358
HLA-DPA1*01:03/DPB1*04:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 75 1106
HLA-DRB1*01:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 1268 88
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 326 4627
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 401 5691
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 91 1290
HLA-DPA1*04:01/DPB1*04:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 125 1771
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 223 3153
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 268 3779
HLA-DPA1*03:01/DPB1*04:02 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 101 1419
HLA-DPA1*03:01/DPB1*105:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 101 1419
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 315 4418
HLA-DPA1*03:01/DPB1*02:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 50 701
HLA-DPA1*01:03/DPB1*04:02 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 197 2761
HLA-DPA1*01:03/DPB1*105:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 197 2761
HLA-DPA1*04:01/DPB1*04:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 57 797
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 73 1019
HLA-DPA1*01:03/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 97 1352
HLA-DPA1*03:01/DPB1*04:02 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 226 3120
HLA-DPA1*03:01/DPB1*105:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 226 3120
HLA-DPA1*02:01/DPB1*02:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 190 2596
HLA-DPA1*02:02/DPB1*01:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 113 1542
HLA-DPA1*02:02/DPB1*01:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 85 1158
HLA-DPA1*02:01/DPB1*04:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 206 2777
HLA-DPA1*04:01/DPB1*02:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 66 876
HLA-DPA1*02:02/DPB1*01:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 69 900
HLA-DPA1*04:01/DPB1*04:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 70 912
HLA-DPA1*03:01/DPB1*04:02 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 100 1291
HLA-DPA1*03:01/DPB1*105:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 100 1291
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 178 2294
HLA-DPA1*03:01/DPB1*04:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 43 554
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 434 5576
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 237 3032
HLA-DPA1*01:03/DPB1*04:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 96 1226
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 40 509
HLA-DPA1*03:01/DPB1*04:02 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 346 4364
HLA-DPA1*03:01/DPB1*105:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 346 4364
HLA-DPA1*04:01/DPB1*02:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 70 879
HLA-DPA1*01:03/DPB1*04:02 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 338 4240
HLA-DPA1*01:03/DPB1*105:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 338 4240
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 160 1997
HLA-DRB1*04:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1819 146
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 355 4421
HLA-DPA1*04:01/DPB1*02:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 65 808
HLA-DPA1*01:03/DPB1*04:02 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 211 2616
HLA-DPA1*01:03/DPB1*105:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 211 2616
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 84 1037
HLA-DRB1*04:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 1167 95
HLA-DPA1*03:01/DPB1*02:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 54 662
HLA-DRB1*04:02 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 248 3025
HLA-DPA1*02:02/DPB1*01:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 71 858
HLA-DPA1*04:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 85 1026
HLA-DPA1*02:01/DPB1*05:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 292 3518
HLA-DPA1*02:01/DPB1*04:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 214 2576
HLA-DPA1*04:01/DPB1*04:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 69 827
HLA-DPA1*02:01/DPB1*01:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 98 1174
HLA-DPA1*04:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 200 2391
HLA-DPA1*04:01/DPB1*04:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 94 1122
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 490 5823
HLA-DPA1*01:03/DPB1*04:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 121 1436
HLA-DPA1*04:01/DPB1*04:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 158 1855
HLA-DPA1*03:01/DPB1*04:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 62 725
HLA-DPA1*02:01/DPB1*01:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 245 2862
HLA-DPA1*03:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 76 884
HLA-DPA1*02:01/DPB1*01:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 157 1821
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 98 1136
HLA-DPA1*02:02/DPB1*01:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 165 1909
HLA-DPA1*02:01/DPB1*02:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 183 2107
HLA-DPA1*02:01/DPB1*04:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 213 2432
HLA-DRB1*04:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 1095 96
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 89 1015
HLA-DPA1*03:01/DPB1*04:02 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 85 967
HLA-DPA1*03:01/DPB1*105:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 85 967
HLA-DPA1*02:01/DPB1*02:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 206 2332
HLA-DPA1*03:01/DPB1*04:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 59 667
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 252 2843
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 206 2321
HLA-DPA1*03:01/DPB1*04:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 148 1655
HLA-DRB1*01:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1330 119
HLA-DPA1*02:01/DPB1*04:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 291 3245
HLA-DPA1*04:01/DPB1*04:02 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 166 1847
HLA-DPA1*04:01/DPB1*105:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 166 1847
HLA-DPA1*01:03/DPB1*04:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 96 1064
HLA-DPA1*03:01/DPB1*04:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 88 973
HLA-DPA1*02:01/DPB1*05:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 281 3103
HLA-DPA1*02:02/DPB1*02:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 136 1495
HLA-DPA1*04:01/DPB1*04:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 66 722
HLA-DPA1*04:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 74 807
HLA-DPA1*03:01/DPB1*02:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 57 621
HLA-DPA1*01:03/DPB1*01:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 196 2135
HLA-DPA1*03:01/DPB1*04:02 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 97 1038
HLA-DPA1*03:01/DPB1*105:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 97 1038
HLA-DPA1*02:01/DPB1*05:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 322 3410
HLA-DPA1*02:01/DPB1*02:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 213 2243
HLA-DPA1*04:01/DPB1*04:02 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 160 1657
HLA-DPA1*04:01/DPB1*105:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 160 1657
HLA-DPA1*02:02/DPB1*01:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 151 1562
HLA-DPA1*04:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 93 959
HLA-DPA1*01:03/DPB1*05:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 266 2741
HLA-DRB1*15:01 FLGVYYHKNNKSWMESEFR FYYHKNNKSWMESEFR 152 1566
HLA-DPA1*01:03/DPB1*01:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 272 2800
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 277 2842
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 228 2335
HLA-DPA1*01:03/DPB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 498 5097
HLA-DPA1*01:03/DPB1*105:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 498 5097
HLA-DPA1*01:03/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 334 3403
HLA-DPA1*02:02/DPB1*01:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 74 753
HLA-DPA1*02:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 268 2724
HLA-DPA1*02:01/DPB1*01:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 119 1204
HLA-DPA1*03:01/DPB1*05:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 222 2245
HLA-DPA1*02:02/DPB1*13:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 386 3880
HLA-DPA1*01:03/DPB1*01:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 146 1465
HLA-DPA1*02:01/DPB1*05:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 404 4044
HLA-DPA1*02:01/DPB1*04:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 421 4204
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 112 1118
HLA-DPA1*03:01/DPB1*04:02 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 85 846
HLA-DPA1*03:01/DPB1*105:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 85 846
HLA-DPA1*02:01/DPB1*04:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 216 2144
HLA-DPA1*04:01/DPB1*04:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 74 734
HLA-DPA1*01:03/DPB1*05:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 365 3615
HLA-DRB1*04:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 3278 332
HLA-DPA1*04:01/DPB1*04:02 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 194 1914
HLA-DPA1*04:01/DPB1*105:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 194 1914
HLA-DPA1*03:01/DPB1*05:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 144 1415
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 193 1892
HLA-DPA1*01:03/DPB1*02:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 131 1283
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 224 2186
HLA-DPA1*02:01/DPB1*01:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 98 953
HLA-DPA1*04:01/DPB1*02:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 122 1183
HLA-DPA1*03:01/DPB1*04:02 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 102 986
HLA-DPA1*03:01/DPB1*105:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 102 986
HLA-DPA1*01:03/DPB1*05:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 256 2473
HLA-DPA1*01:03/DPB1*01:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 113 1083
HLA-DPA1*03:01/DPB1*05:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 140 1341
HLA-DPA1*01:03/DPB1*04:02 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 344 3289
HLA-DPA1*01:03/DPB1*105:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 344 3289
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 430 4104
HLA-DPA1*03:01/DPB1*04:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 56 534
HLA-DPA1*01:03/DPB1*04:02 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 295 2801
HLA-DPA1*01:03/DPB1*105:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 295 2801
HLA-DRB1*04:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 1080 114
HLA-DPA1*01:03/DPB1*05:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 296 2794
HLA-DPA1*03:01/DPB1*05:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 173 1632
HLA-DPA1*03:01/DPB1*04:02 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 372 3493
HLA-DPA1*03:01/DPB1*105:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 372 3493
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 489 4590
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 489 4590
HLA-DPA1*01:03/DPB1*01:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 114 1070
HLA-DPA1*04:01/DPB1*04:02 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 266 2494
HLA-DPA1*04:01/DPB1*105:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 266 2494
HLA-DPA1*02:02/DPB1*01:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 109 1017
HLA-DPA1*01:03/DPB1*04:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 331 3083
HLA-DRB1*07:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 1613 174
HLA-DPA1*03:01/DPB1*02:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 103 952
HLA-DPA1*02:02/DPB1*04:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 160 1477
HLA-DRB1*07:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 1731 188
HLA-DPA1*02:01/DPB1*05:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 329 3028
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 111 1021
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 411 3770
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 210 1926
HLA-DPA1*01:03/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 344 3149
HLA-DPA1*02:01/DPB1*02:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 222 2021
HLA-DPA1*04:01/DPB1*04:02 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 176 1602
HLA-DPA1*04:01/DPB1*105:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 176 1602
HLA-DPA1*03:01/DPB1*05:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 287 2605
HLA-DPA1*03:01/DPB1*01:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 167 1515
HLA-DPA1*03:01/DPB1*04:02 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 112 1016
HLA-DPA1*03:01/DPB1*105:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 112 1016
HLA-DPA1*04:01/DPB1*02:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 82 742
HLA-DPA1*01:03/DPB1*04:02 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 299 2697
HLA-DPA1*01:03/DPB1*105:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 299 2697
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 258 2320
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 356 3198
HLA-DPA1*02:02/DPB1*02:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 123 1102
HLA-DPA1*01:03/DPB1*04:02 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 361 3230
HLA-DPA1*01:03/DPB1*105:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 361 3230
HLA-DPA1*01:03/DPB1*04:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 140 1245
HLA-DPA1*01:03/DPB1*02:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 110 975
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 135 1196
HLA-DPA1*01:03/DPB1*01:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 246 2177
HLA-DPA1*02:01/DPB1*01:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 122 1079
HLA-DPA1*01:03/DPB1*05:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 470 4155
HLA-DPA1*02:01/DPB1*02:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 273 2402
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 101 887
HLA-DPA1*04:01/DPB1*04:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 86 755
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 58 509
HLA-DRB1*16:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 1209 138
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 466 4077
HLA-DRB1*11:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 1318 151
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 106 925
HLA-DPA1*02:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 383 3334
HLA-DPA1*02:02/DPB1*05:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 217 1886
HLA-DPA1*02:02/DPB1*01:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 77 669
HLA-DPA1*03:01/DPB1*04:02 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 112 971
HLA-DPA1*03:01/DPB1*105:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 112 971
HLA-DPA1*04:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 104 899
HLA-DPA1*03:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 227 1962
HLA-DPA1*02:02/DPB1*11:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 409 3525
HLA-DPA1*02:02/DPB1*06:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 455 3908
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 141 1206
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 337 2877
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 146 1242
HLA-DPA1*04:01/DPB1*02:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 144 1221
HLA-DPA1*02:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 303 2562
HLA-DPA1*01:03/DPB1*04:02 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 319 2695
HLA-DPA1*01:03/DPB1*105:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 319 2695
HLA-DPA1*02:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 254 2139
HLA-DPA1*02:02/DPB1*04:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 157 1319
HLA-DPA1*02:02/DPB1*02:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 154 1292
HLA-DPA1*03:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 252 2110
HLA-DPA1*03:01/DPB1*06:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 362 3027
HLA-DRB1*11:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 1410 169
HLA-DPA1*01:03/DPB1*05:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 286 2378
HLA-DPA1*02:02/DPB1*02:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 143 1188
HLA-DPA1*01:03/DPB1*04:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 211 1741
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 361 2975
HLA-DPA1*03:01/DPB1*04:02 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 492 4048
HLA-DPA1*03:01/DPB1*105:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 492 4048
HLA-DRB1*16:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 1159 141
HLA-DRB1*15:03 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 208 1693
HLA-DPA1*01:03/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 127 1031
HLA-DPA1*02:01/DPB1*04:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 291 2362
HLA-DPA1*03:01/DPB1*01:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 125 1013
HLA-DRB1*07:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 2136 264
HLA-DPA1*02:02/DPB1*01:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 219 1771
HLA-DPA1*04:01/DPB1*04:02 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 189 1528
HLA-DPA1*04:01/DPB1*105:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 189 1528
HLA-DPA1*02:02/DPB1*04:02 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 362 2914
HLA-DPA1*02:02/DPB1*105:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 362 2914
HLA-DPA1*01:03/DPB1*01:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 113 907
HLA-DPA1*03:01/DPB1*05:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 146 1171
HLA-DPA1*02:02/DPB1*01:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 91 729
HLA-DPA1*01:03/DPB1*04:02 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 311 2488
HLA-DPA1*01:03/DPB1*105:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 311 2488
HLA-DRB1*07:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 1786 224
HLA-DPA1*02:02/DPB1*13:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 415 3301
HLA-DPA1*03:01/DPB1*04:02 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 413 3284
HLA-DPA1*03:01/DPB1*105:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 413 3284
HLA-DPA1*03:01/DPB1*05:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 371 2943
HLA-DPA1*02:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 495 3924
HLA-DPA1*03:01/DPB1*04:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 57 451
HLA-DPA1*02:02/DPB1*04:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 202 1585
HLA-DPA1*02:01/DPB1*01:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 266 2086
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 275 2154
HLA-DPA1*03:01/DPB1*01:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 97 757
HLA-DPA1*02:01/DPB1*01:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 396 3087
HLA-DPA1*03:01/DPB1*04:02 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 130 1013
HLA-DPA1*03:01/DPB1*105:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 130 1013
HLA-DPA1*03:01/DPB1*02:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 139 1081
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 120 933
HLA-DRB1*01:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 2883 372
HLA-DRB1*15:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 77 596
HLA-DPA1*04:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 270 2089
HLA-DPA1*04:01/DPB1*04:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 86 662
HLA-DPA1*03:01/DPB1*04:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 149 1142
HLA-DPA1*03:01/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 298 2279
HLA-DPA1*02:01/DPB1*04:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 292 2232
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 141 1069
HLA-DPA1*01:03/DPB1*01:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 359 2720
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 343 2596
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 325 2457
HLA-DPA1*02:01/DPB1*05:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 360 2716
HLA-DPA1*02:01/DPB1*04:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 263 1981
HLA-DRB1*11:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 1171 156
HLA-DPA1*04:01/DPB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 388 2905
HLA-DPA1*04:01/DPB1*105:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 388 2905
HLA-DPA1*02:02/DPB1*05:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 198 1482
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 166 1239
HLA-DPA1*04:01/DPB1*04:02 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 216 1603
HLA-DPA1*04:01/DPB1*105:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 216 1603
HLA-DRB1*04:04 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 308 2285
HLA-DPA1*02:02/DPB1*04:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 173 1280
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 254 1879
HLA-DPA1*04:01/DPB1*04:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 125 924
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 162 1197
HLA-DPA1*02:01/DPB1*02:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 304 2236
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 274 2010
HLA-DPA1*03:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 55 403
HLA-DPA1*02:02/DPB1*11:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 451 3302
HLA-DPA1*02:02/DPB1*13:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 362 2650
HLA-DPA1*03:01/DPB1*04:02 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 265 1930
HLA-DPA1*03:01/DPB1*105:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 265 1930
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 392 2854
HLA-DPA1*01:03/DPB1*02:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 173 1259
HLA-DRB1*16:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1588 219
HLA-DPA1*01:03/DPB1*04:02 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 342 2477
HLA-DPA1*01:03/DPB1*105:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 342 2477
HLA-DPA1*01:03/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 460 3320
HLA-DPA1*02:02/DPB1*05:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 222 1602
HLA-DPA1*04:01/DPB1*05:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 277 1991
HLA-DPA1*03:01/DPB1*11:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 462 3318
HLA-DPA1*02:02/DPB1*11:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 383 2748
HLA-DPA1*04:01/DPB1*13:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 478 3429
HLA-DPA1*02:02/DPB1*01:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 93 667
HLA-DPA1*02:02/DPB1*04:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 282 2022
HLA-DPA1*01:03/DPB1*04:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 244 1738
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 293 2085
HLA-DPA1*04:01/DPB1*04:02 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 451 3206
HLA-DPA1*04:01/DPB1*105:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 451 3206
HLA-DPA1*02:02/DPB1*02:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 166 1180
HLA-DPA1*02:01/DPB1*04:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 394 2794
HLA-DPA1*02:02/DPB1*02:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 193 1368
HLA-DPA1*02:01/DPB1*02:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 316 2239
HLA-DPA1*02:02/DPB1*13:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 398 2814
HLA-DPA1*01:03/DPB1*01:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 172 1214
HLA-DPA1*02:02/DPB1*04:02 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 344 2423
HLA-DPA1*02:02/DPB1*105:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 344 2423
HLA-DRB1*04:02 FLGVYYHKNNKSWMESEFR FYYHKNNKSWMESEFR 388 2724
HLA-DPA1*01:03/DPB1*04:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 180 1263
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 130 912
HLA-DRB1*11:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 2179 311
HLA-DPA1*02:01/DPB1*01:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 123 861
HLA-DPA1*03:01/DPB1*05:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 388 2716
HLA-DPA1*01:03/DPB1*05:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 295 2056
HLA-DPA1*01:03/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 348 2420
HLA-DPA1*03:01/DPB1*04:02 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 139 965
HLA-DPA1*03:01/DPB1*105:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 139 965
HLA-DPA1*04:01/DPB1*02:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 98 679
HLA-DPA1*04:01/DPB1*04:02 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 400 2766
HLA-DPA1*04:01/DPB1*105:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 400 2766
HLA-DPA1*04:01/DPB1*04:02 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 262 1807
HLA-DPA1*04:01/DPB1*105:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 262 1807
HLA-DPA1*04:01/DPB1*01:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 169 1165
HLA-DPA1*02:02/DPB1*11:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 439 3023
HLA-DPA1*03:01/DPB1*06:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 319 2196
HLA-DPA1*01:03/DPB1*01:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 109 749
HLA-DPA1*02:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 372 2555
HLA-DPA1*02:01/DPB1*04:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 287 1971
HLA-DPA1*02:02/DPB1*05:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 259 1778
HLA-DPA1*04:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 220 1508
HLA-DPA1*02:02/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 394 2698
HLA-DPA1*04:01/DPB1*04:02 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 261 1786
HLA-DPA1*04:01/DPB1*105:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 261 1786
HLA-DPA1*04:01/DPB1*05:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 335 2289
HLA-DPA1*03:01/DPB1*06:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 382 2610
HLA-DPA1*02:02/DPB1*02:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 188 1284
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 168 1147
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 373 2545
HLA-DPA1*02:02/DPB1*04:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 175 1194
HLA-DPA1*02:02/DPB1*01:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 249 1698
HLA-DPA1*04:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 97 654
HLA-DPA1*01:03/DPB1*04:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 171 1150
HLA-DPA1*03:01/DPB1*01:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 100 672
HLA-DPA1*02:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 429 2878
HLA-DPA1*01:03/DPB1*04:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 165 1105
HLA-DPA1*03:01/DPB1*04:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 66 441
HLA-DPA1*04:01/DPB1*01:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 112 746
HLA-DRB1*16:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 1189 179
HLA-DRB1*04:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1122 169
HLA-DPA1*02:02/DPB1*01:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 180 1195
HLA-DPA1*04:01/DPB1*06:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 426 2828
HLA-DPA1*01:03/DPB1*01:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 140 928
HLA-DPA1*04:01/DPB1*04:02 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 484 3205
HLA-DPA1*04:01/DPB1*105:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 484 3205
HLA-DPA1*02:02/DPB1*05:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 248 1642
HLA-DRB1*11:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1187 180
HLA-DPA1*04:01/DPB1*04:02 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 235 1548
HLA-DPA1*04:01/DPB1*105:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 235 1548
HLA-DPA1*02:02/DPB1*04:02 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 414 2716
HLA-DPA1*02:02/DPB1*105:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 414 2716
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 335 2197
HLA-DPA1*04:01/DPB1*05:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 373 2446
HLA-DPA1*03:01/DPB1*04:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 260 1701
HLA-DPA1*02:02/DPB1*06:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 406 2654
HLA-DPA1*02:01/DPB1*04:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 317 2069
HLA-DPA1*03:01/DPB1*06:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 367 2395
HLA-DPA1*03:01/DPB1*04:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 71 463
HLA-DPA1*01:03/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 487 3173
HLA-DPA1*02:02/DPB1*13:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 439 2851
HLA-DPA1*03:01/DPB1*01:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 233 1513
HLA-DPA1*03:01/DPB1*05:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 150 974
HLA-DPA1*04:01/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 257 1668
HLA-DPA1*03:01/DPB1*06:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 465 3008
HLA-DRB1*07:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1925 298
HLA-DPA1*02:02/DPB1*05:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 331 2137
HLA-DPA1*03:01/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 303 1948
HLA-DPA1*04:01/DPB1*05:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 238 1530
HLA-DRB1*15:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 71 454
HLA-DPA1*02:02/DPB1*13:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 465 2950
HLA-DPA1*03:01/DPB1*05:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 387 2452
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 176 1113
HLA-DPA1*02:02/DPB1*04:02 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 411 2597
HLA-DPA1*02:02/DPB1*105:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 411 2597
HLA-DPA1*03:01/DPB1*11:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 497 3133
HLA-DRB1*07:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 2698 428
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 179 1126
HLA-DPA1*01:03/DPB1*04:02 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 497 3122
HLA-DPA1*01:03/DPB1*105:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 497 3122
HLA-DPA1*04:01/DPB1*04:02 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 231 1451
HLA-DPA1*04:01/DPB1*105:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 231 1451
HLA-DPA1*01:03/DPB1*02:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 181 1135
HLA-DPA1*04:01/DPB1*04:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 185 1158
HLA-DPA1*01:03/DPB1*04:02 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 453 2834
HLA-DPA1*01:03/DPB1*105:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 453 2834
HLA-DRB1*04:04 FLGVYYHKNNKSWMESEFR FYYHKNNKSWMESEFR 396 2477
HLA-DPA1*04:01/DPB1*05:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 379 2368
HLA-DPA1*03:01/DPB1*01:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 91 565
HLA-DPA1*04:01/DPB1*13:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 479 2973
HLA-DRB1*04:02 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 222 1376
HLA-DPA1*04:01/DPB1*05:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 215 1332
HLA-DPA1*02:02/DPB1*02:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 215 1327
HLA-DPA1*04:01/DPB1*01:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 131 808
HLA-DPA1*04:01/DPB1*05:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 234 1443
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 63 388
HLA-DPA1*02:02/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 254 1561
HLA-DPA1*03:01/DPB1*02:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 99 607
HLA-DPA1*04:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 110 674
HLA-DPA1*04:01/DPB1*01:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 107 652
HLA-DPA1*01:03/DPB1*01:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 140 853
HLA-DPA1*02:02/DPB1*05:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 404 2459
HLA-DPA1*02:02/DPB1*04:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 214 1300
HLA-DPA1*04:01/DPB1*02:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 128 776
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 158 957
HLA-DRB1*10:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 841 140
HLA-DPA1*02:01/DPB1*02:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 311 1867
HLA-DPA1*03:01/DPB1*04:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 108 646
HLA-DPA1*04:01/DPB1*11:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 456 2713
HLA-DPA1*03:01/DPB1*05:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 231 1373
HLA-DPA1*02:02/DPB1*01:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 97 576
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 357 2117
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 445 2632
HLA-DRB1*08:04 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 374 2209
HLA-DPA1*02:01/DPB1*04:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 400 2362
HLA-DPA1*03:01/DPB1*05:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 395 2329
HLA-DPA1*03:01/DPB1*11:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 459 2704
HLA-DPA1*02:02/DPB1*04:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 374 2200
HLA-DPA1*03:01/DPB1*11:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 429 2522
HLA-DPA1*02:02/DPB1*04:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 261 1533
HLA-DPA1*03:01/DPB1*06:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 401 2354
HLA-DPA1*04:01/DPB1*04:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 180 1051
HLA-DPA1*01:03/DPB1*04:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 209 1215
HLA-DPA1*02:02/DPB1*05:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 428 2475
HLA-DPA1*04:01/DPB1*01:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 107 617
HLA-DRB1*10:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 806 140
HLA-DPA1*03:01/DPB1*04:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 116 667
HLA-DPA1*04:01/DPB1*04:02 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 243 1391
HLA-DPA1*04:01/DPB1*105:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 243 1391
HLA-DPA1*02:02/DPB1*01:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 359 2050
HLA-DPA1*02:02/DPB1*02:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 205 1169
HLA-DPA1*04:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 147 838
HLA-DPA1*04:01/DPB1*04:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 303 1725
HLA-DPA1*02:01/DPB1*04:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 326 1855
HLA-DPA1*03:01/DPB1*01:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 165 935
HLA-DPA1*03:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 315 1784
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 196 1109
HLA-DPA1*04:01/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 261 1476
HLA-DPA1*01:03/DPB1*02:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 165 933
HLA-DRB1*10:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 859 152
HLA-DPA1*02:02/DPB1*05:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 262 1480
HLA-DPA1*03:01/DPB1*05:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 278 1565
HLA-DPA1*02:02/DPB1*06:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 430 2412
HLA-DPA1*02:02/DPB1*04:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 197 1104
HLA-DPA1*03:01/DPB1*04:02 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 178 997
HLA-DPA1*03:01/DPB1*105:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 178 997
HLA-DPA1*02:02/DPB1*04:02 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 443 2477
HLA-DPA1*02:02/DPB1*105:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 443 2477
HLA-DPA1*04:01/DPB1*02:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 121 676
HLA-DPA1*04:01/DPB1*04:02 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 248 1383
HLA-DPA1*04:01/DPB1*105:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 248 1383
HLA-DPA1*02:02/DPB1*11:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 482 2671
HLA-DPA1*02:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 299 1655
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 332 1828
HLA-DPA1*02:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 338 1859
HLA-DPA1*04:01/DPB1*06:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 468 2570
HLA-DPA1*02:02/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 231 1262
HLA-DPA1*04:01/DPB1*05:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 399 2179
HLA-DPA1*03:01/DPB1*05:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 231 1259
HLA-DPA1*04:01/DPB1*13:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 491 2675
HLA-DPA1*02:02/DPB1*04:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 226 1231
HLA-DPA1*04:01/DPB1*06:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 381 2075
HLA-DPA1*01:03/DPB1*05:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 476 2589
HLA-DPA1*02:01/DPB1*01:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 144 783
HLA-DPA1*02:01/DPB1*02:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 310 1675
HLA-DPA1*03:01/DPB1*01:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 82 443
HLA-DPA1*04:01/DPB1*13:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 432 2333
HLA-DPA1*02:02/DPB1*04:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 204 1100
HLA-DPA1*03:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 74 399
HLA-DPA1*04:01/DPB1*02:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 128 690
HLA-DRB1*15:02 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 315 1696
HLA-DPA1*02:02/DPB1*02:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 268 1434
HLA-DPA1*03:01/DPB1*04:02 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 229 1225
HLA-DPA1*03:01/DPB1*105:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 229 1225
HLA-DPA1*02:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 141 754
HLA-DPA1*01:03/DPB1*01:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 414 2196
HLA-DPA1*04:01/DPB1*01:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 220 1166
HLA-DPA1*04:01/DPB1*06:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 450 2377
HLA-DPA1*03:01/DPB1*11:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 443 2340
HLA-DRB1*15:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 68 358
HLA-DPA1*01:03/DPB1*04:02 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 466 2440
HLA-DPA1*01:03/DPB1*105:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 466 2440
HLA-DPA1*02:01/DPB1*01:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 231 1209
HLA-DPA1*03:01/DPB1*02:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 112 586
HLA-DPA1*03:01/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 411 2146
HLA-DPA1*03:01/DPB1*01:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 129 673
HLA-DPA1*01:03/DPB1*01:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 134 699
HLA-DPA1*02:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 169 880
HLA-DPA1*04:01/DPB1*06:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 406 2114
HLA-DRB1*16:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1278 246
HLA-DPA1*04:01/DPB1*06:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 476 2469
HLA-DRB1*04:02 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 210 1089
HLA-DPA1*02:02/DPB1*02:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 220 1138
HLA-DRB1*10:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 313 1613
HLA-DPA1*04:01/DPB1*04:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 134 687
HLA-DPA1*03:01/DPB1*05:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 500 2561
HLA-DPA1*01:03/DPB1*01:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 391 2001
HLA-DPA1*04:01/DPB1*04:02 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 328 1678
HLA-DPA1*04:01/DPB1*105:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 328 1678
HLA-DPA1*04:01/DPB1*01:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 104 532
HLA-DRB1*13:02 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 744 146
HLA-DPA1*03:01/DPB1*01:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 124 628
HLA-DPA1*04:01/DPB1*04:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 450 2279
HLA-DRB1*01:01 FLGVYYHKNNKSWMESEF FYYHKNNKSWMESEF 1438 284
HLA-DPA1*02:02/DPB1*01:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 332 1679
HLA-DPA1*03:01/DPB1*04:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 465 2351
HLA-DPA1*04:01/DPB1*04:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 139 702
HLA-DPA1*04:01/DPB1*04:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 161 813
HLA-DPA1*04:01/DPB1*11:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 461 2326
HLA-DPA1*02:02/DPB1*04:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 218 1098
HLA-DPA1*02:02/DPB1*04:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 273 1372
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 68 341
HLA-DPA1*03:01/DPB1*04:02 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 231 1157
HLA-DPA1*03:01/DPB1*105:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 231 1157
HLA-DPA1*01:03/DPB1*05:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 498 2484
HLA-DRB1*13:02 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 703 141
HLA-DPA1*03:01/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 287 1425
HLA-DPA1*02:02/DPB1*05:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 475 2356
HLA-DPA1*02:02/DPB1*04:02 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 489 2417
HLA-DPA1*02:02/DPB1*105:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 489 2417
HLA-DPA1*04:01/DPB1*05:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 252 1245
HLA-DPA1*02:02/DPB1*06:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 462 2281
HLA-DRB1*15:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 244 1204
HLA-DRB1*15:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 67 330
HLA-DPA1*04:01/DPB1*04:02 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 302 1471
HLA-DPA1*04:01/DPB1*105:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 302 1471
HLA-DPA1*02:01/DPB1*01:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 234 1138
HLA-DPA1*04:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 131 636
HLA-DPA1*02:01/DPB1*01:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 158 766
HLA-DPA1*02:02/DPB1*04:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 236 1141
HLA-DRB1*11:02 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 157 758
HLA-DRB1*13:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 157 758
HLA-DPA1*04:01/DPB1*02:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 131 632
HLA-DPA1*02:02/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 358 1727
HLA-DRB1*15:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 68 328
HLA-DQA1*01:02/DQB1*05:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 266 1282
HLA-DPA1*04:01/DPB1*11:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 409 1968
HLA-DRB1*10:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 913 190
HLA-DPA1*04:01/DPB1*13:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 482 2305
HLA-DPA1*03:01/DPB1*05:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 217 1036
HLA-DPA1*01:03/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 159 759
HLA-DPA1*03:01/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 445 2124
HLA-DPA1*01:03/DPB1*04:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 214 1021
HLA-DPA1*04:01/DPB1*01:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 138 657
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 451 2144
HLA-DPA1*02:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 499 2371
HLA-DPA1*04:01/DPB1*04:02 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 347 1648
HLA-DPA1*04:01/DPB1*105:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 347 1648
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 200 943
HLA-DPA1*02:02/DPB1*05:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 460 2167
HLA-DPA1*04:01/DPB1*11:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 466 2195
HLA-DPA1*02:02/DPB1*01:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 118 555
HLA-DRB1*15:02 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 1156 246
HLA-DPA1*02:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 179 839
HLA-DPA1*04:01/DPB1*02:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 161 754
HLA-DRB1*15:03 FLGVYYHKNNKSWMESEFR FYYHKNNKSWMESEFR 380 1777
HLA-DPA1*04:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 287 1342
HLA-DRB1*15:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 131 612
HLA-DPA1*04:01/DPB1*11:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 467 2180
HLA-DPA1*01:03/DPB1*01:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 287 1338
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 218 1009
HLA-DPA1*04:01/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 267 1234
HLA-DPA1*02:02/DPB1*01:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 116 534
HLA-DPA1*02:02/DPB1*05:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 370 1703
HLA-DRB1*10:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1005 219
HLA-DRB1*04:02 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 206 944
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 496 2256
HLA-DRB1*15:02 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 1196 263
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 94 427
HLA-DPA1*03:01/DPB1*04:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 78 354
HLA-DPA1*03:01/DPB1*05:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 386 1749
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 469 2125
HLA-DPA1*02:02/DPB1*05:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 388 1753
HLA-DPA1*03:01/DPB1*01:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 263 1185
HLA-DPA1*02:01/DPB1*01:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 167 748
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 62 277
HLA-DPA1*04:01/DPB1*04:02 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 312 1390
HLA-DPA1*04:01/DPB1*105:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 312 1390
HLA-DPA1*02:02/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 133 591
HLA-DPA1*03:01/DPB1*04:02 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 256 1137
HLA-DPA1*03:01/DPB1*105:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 256 1137
HLA-DRB1*13:02 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 650 147
HLA-DPA1*02:02/DPB1*01:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 439 1941
HLA-DPA1*02:01/DPB1*02:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 418 1846
HLA-DPA1*02:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 453 1999
HLA-DPA1*03:01/DPB1*04:02 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 287 1266
HLA-DPA1*03:01/DPB1*105:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 287 1266
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 245 1079
HLA-DPA1*04:01/DPB1*01:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 140 615
HLA-DPA1*04:01/DPB1*05:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 497 2183
HLA-DRB1*15:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 123 536
HLA-DPA1*02:02/DPB1*02:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 224 975
HLA-DPA1*02:01/DPB1*02:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 401 1744
HLA-DPA1*02:02/DPB1*04:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 273 1187
HLA-DPA1*04:01/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 336 1457
HLA-DPA1*03:01/DPB1*04:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 126 545
HLA-DRB1*04:02 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 207 893
HLA-DPA1*01:03/DPB1*01:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 147 633
HLA-DPA1*02:02/DPB1*01:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 168 723
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 267 1148
HLA-DPA1*01:03/DPB1*02:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 237 1018
HLA-DPA1*01:03/DPB1*05:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 492 2109
HLA-DQA1*01:03/DQB1*05:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 381 1630
HLA-DRB1*15:02 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1711 400
HLA-DPA1*02:02/DPB1*04:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 246 1048
HLA-DPA1*02:02/DPB1*02:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 218 918
HLA-DPA1*03:01/DPB1*01:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 387 1629
HLA-DPA1*04:01/DPB1*05:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 267 1122
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 217 908
HLA-DPA1*04:01/DPB1*01:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 168 702
HLA-DPA1*02:01/DPB1*02:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 416 1735
HLA-DRB1*15:03 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 188 784
HLA-DPA1*02:02/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 348 1443
HLA-DRB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 215 891
HLA-DPA1*02:02/DPB1*01:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 171 708
HLA-DPA1*02:02/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 246 1018
HLA-DPA1*02:02/DPB1*04:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 437 1806
HLA-DPA1*01:03/DPB1*01:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 156 644
HLA-DRB1*04:02 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 229 944
HLA-DPA1*03:01/DPB1*01:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 111 457
HLA-DQA1*01:02/DQB1*05:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 284 1158
HLA-DPA1*01:03/DPB1*01:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 182 741
HLA-DRB1*11:04 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 282 1147
HLA-DRB1*11:02 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 136 553
HLA-DRB1*13:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 136 553
HLA-DPA1*04:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 140 566
HLA-DPA1*04:01/DPB1*04:02 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 463 1871
HLA-DPA1*04:01/DPB1*105:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 463 1871
HLA-DPA1*02:02/DPB1*04:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 323 1304
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 66 266
HLA-DRB1*15:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 79 318
HLA-DPA1*04:01/DPB1*04:02 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 417 1677
HLA-DPA1*04:01/DPB1*105:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 417 1677
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 297 1190
HLA-DPA1*03:01/DPB1*04:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 135 540
HLA-DPA1*04:01/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 354 1406
HLA-DPA1*03:01/DPB1*04:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 136 540
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 88 348
HLA-DPA1*04:01/DPB1*05:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 444 1753
HLA-DPA1*02:02/DPB1*05:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 432 1703
HLA-DPA1*03:01/DPB1*01:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 468 1843
HLA-DRB1*15:02 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 1192 303
HLA-DRB1*15:03 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 179 703
HLA-DPA1*02:02/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 425 1666
HLA-DPA1*02:02/DPB1*01:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 144 562
HLA-DPA1*02:02/DPB1*01:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 162 627
HLA-DRB1*08:02 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 428 1656
HLA-DPA1*01:03/DPB1*01:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 191 739
HLA-DPA1*02:01/DPB1*01:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 217 839
HLA-DPA1*02:02/DPB1*02:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 380 1469
HLA-DPA1*04:01/DPB1*05:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 372 1435
HLA-DRB1*11:02 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 142 547
HLA-DRB1*13:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 142 547
HLA-DRB1*04:04 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1501 390
HLA-DPA1*04:01/DPB1*04:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 165 632
HLA-DRB1*01:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 489 1873
HLA-DRB1*11:01 FLGVYYHKNNKSWMESEF FYYHKNNKSWMESEF 1337 350
HLA-DPA1*04:01/DPB1*01:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 134 510
HLA-DRB1*04:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 1790 472
HLA-DRB1*11:02 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 133 504
HLA-DRB1*13:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 133 504
HLA-DPA1*02:02/DPB1*02:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 291 1097
HLA-DPA1*02:02/DPB1*04:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 450 1695
HLA-DRB1*11:04 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 981 261
HLA-DPA1*03:01/DPB1*04:02 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 260 975
HLA-DPA1*03:01/DPB1*105:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 260 975
HLA-DPA1*04:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 161 603
HLA-DPA1*04:01/DPB1*05:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 398 1486
HLA-DPA1*02:02/DPB1*05:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 450 1680
HLA-DRB1*04:04 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 928 249
HLA-DRB1*13:02 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 688 185
HLA-DQA1*01:02/DQB1*05:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 318 1181
HLA-DRB1*01:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 468 1738
HLA-DPA1*01:03/DPB1*01:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 172 638
HLA-DPA1*02:01/DPB1*01:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 281 1034
HLA-DPA1*03:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 96 353
HLA-DPA1*04:01/DPB1*04:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNDPFY 247 908
HLA-DPA1*03:01/DPB1*01:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 101 370
HLA-DRB1*04:02 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 371 1357
HLA-DRB1*11:02 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 252 916
HLA-DRB1*13:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 252 916
HLA-DRB1*15:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 123 447
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 97 352
HLA-DPA1*02:02/DPB1*02:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 296 1072
HLA-DPA1*04:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 130 470
HLA-DPA1*03:01/DPB1*01:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 314 1135
HLA-DPA1*02:02/DPB1*05:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 396 1431
HLA-DRB1*04:04 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 266 960
HLA-DRB1*13:02 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 157 566
HLA-DRB1*15:03 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 173 623
HLA-DPA1*04:01/DPB1*01:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 478 1713
HLA-DPA1*02:01/DPB1*01:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 301 1077
HLA-DRB1*08:04 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 312 1116
HLA-DRB1*01:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 448 1594
HLA-DPA1*02:02/DPB1*01:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 151 536
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 481 1700
HLA-DPA1*02:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 230 809
HLA-DRB1*11:02 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 131 459
HLA-DRB1*13:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 131 459
HLA-DPA1*02:02/DPB1*02:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 326 1141
HLA-DQA1*01:03/DQB1*05:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 416 1456
HLA-DRB1*10:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 329 1148
HLA-DPA1*04:01/DPB1*01:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 354 1234
HLA-DQA1*01:02/DQB1*05:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 124 432
HLA-DRB1*11:04 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 989 284
HLA-DPA1*04:01/DPB1*01:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 383 1332
HLA-DRB1*11:04 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 963 277
HLA-DRB1*08:04 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 332 1153
HLA-DPA1*01:03/DPB1*01:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 258 896
HLA-DQA1*01:02/DQB1*05:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 181 628
HLA-DRB1*15:03 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 170 585
HLA-DRB1*15:03 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 170 584
HLA-DRB1*04:04 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 893 260
HLA-DPA1*01:03/DPB1*05:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 476 1633
HLA-DRB1*11:02 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 142 487
HLA-DRB1*13:01 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 142 487
HLA-DPA1*03:01/DPB1*05:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 219 750
HLA-DPA1*02:02/DPB1*05:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 390 1334
HLA-DRB1*08:02 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 1425 417
HLA-DPA1*01:03/DPB1*01:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 181 618
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 279 952
HLA-DRB1*08:04 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 303 1033
HLA-DPA1*03:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 102 347
HLA-DRB1*08:02 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 1447 427
HLA-DPA1*02:02/DPB1*02:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 285 964
HLA-DPA1*04:01/DPB1*01:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 165 556
HLA-DPA1*03:01/DPB1*05:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 205 690
HLA-DPA1*02:02/DPB1*01:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 160 538
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 370 1241
HLA-DPA1*04:01/DPB1*01:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 305 1022
HLA-DPA1*01:03/DPB1*04:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNDPFY 358 1199
HLA-DRB1*16:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 343 1148
HLA-DPA1*04:01/DPB1*05:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFYYHKNN 400 1337
HLA-DQA1*01:02/DQB1*05:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 315 1051
HLA-DPA1*02:02/DPB1*04:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 384 1276
HLA-DPA1*03:01/DPB1*02:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 348 1155
HLA-DRB1*15:03 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 452 1500
HLA-DRB1*11:02 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 428 1418
HLA-DRB1*13:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 428 1418
HLA-DPA1*03:01/DPB1*05:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 209 691
HLA-DRB1*08:04 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 313 1034
HLA-DPA1*04:01/DPB1*01:01 FQFCNDPFLGVYYHKNNK FQFCNDPFYYHKNNK 258 850
HLA-DPA1*04:01/DPB1*01:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 140 461
HLA-DRB1*11:02 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 632 194
HLA-DRB1*13:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 632 194
HLA-DPA1*02:02/DPB1*02:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 482 1569
HLA-DPA1*04:01/DPB1*02:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 444 1445
HLA-DRB1*08:04 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 487 1583
HLA-DRB1*11:02 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 652 201
HLA-DRB1*13:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 652 201
HLA-DRB1*08:04 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 304 986
HLA-DRB1*15:03 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 270 873
HLA-DPA1*02:01/DPB1*01:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 296 957
HLA-DPA1*01:03/DPB1*01:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 253 816
HLA-DRB1*08:02 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 1363 424
HLA-DQA1*01:03/DQB1*05:01 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 471 1513
HLA-DPA1*03:01/DPB1*02:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 76 244
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 86 276
HLA-DPA1*02:02/DPB1*05:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 451 1440
HLA-DPA1*04:01/DPB1*02:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 238 759
HLA-DRB1*04:02 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 354 1126
HLA-DQA1*01:02/DQB1*05:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 148 469
HLA-DRB1*15:03 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 183 579
HLA-DRB1*15:03 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 944 299
HLA-DPA1*02:02/DPB1*01:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 252 794
HLA-DQA1*01:03/DQB1*05:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 313 986
HLA-DPA1*01:03/DPB1*01:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 220 693
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 406 1276
HLA-DRB1*11:02 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 164 515
HLA-DRB1*13:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 164 515
HLA-DRB1*08:02 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1392 444
HLA-DPA1*04:01/DPB1*04:02 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 443 1383
HLA-DPA1*04:01/DPB1*105:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 443 1383
HLA-DRB1*11:04 FLGVYYHKNNKSWMESEFR FYYHKNNKSWMESEFR 459 1431
HLA-DPA1*04:01/DPB1*02:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 261 810
HLA-DRB1*11:04 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 231 716
HLA-DRB1*01:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 493 1527
HLA-DRB1*11:04 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1006 325
HLA-DRB1*08:04 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 345 1063
HLA-DQA1*01:02/DQB1*05:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 445 1371
HLA-DPA1*03:01/DPB1*01:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 210 646
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 374 1145
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 375 1146
HLA-DPA1*03:01/DPB1*01:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 197 601
HLA-DRB1*04:04 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 886 292
HLA-DRB1*15:02 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1250 412
HLA-DRB1*13:02 FLGVYYHKNNKSWMESEF FYYHKNNKSWMESEF 712 235
HLA-DRB1*11:04 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 223 673
HLA-DRB1*15:03 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 958 318
HLA-DPA1*02:02/DPB1*01:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 232 691
HLA-DRB1*10:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFYYHKNNK 492 1465
HLA-DPA1*04:01/DPB1*04:02 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 470 1398
HLA-DPA1*04:01/DPB1*105:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 470 1398
HLA-DPA1*02:02/DPB1*01:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 198 586
HLA-DRB1*13:02 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 361 1064
HLA-DRB1*04:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 430 1266
HLA-DRB1*11:02 FLGVYYHKNNKSWMESEFR FYYHKNNKSWMESEFR 285 839
HLA-DRB1*13:01 FLGVYYHKNNKSWMESEFR FYYHKNNKSWMESEFR 285 839
HLA-DRB1*11:04 FQFCNDPFLGVYYHKNNKSW FQFCNDPFYYHKNNKSW 405 1191
HLA-DRB1*11:02 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 635 216
HLA-DRB1*13:01 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 635 216
HLA-DRB1*13:02 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 144 423
HLA-DPA1*03:01/DPB1*05:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 238 699
HLA-DRB1*15:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 119 348
HLA-DQA1*01:02/DQB1*05:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 253 737
HLA-DPA1*02:02/DPB1*04:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 380 1106
HLA-DPA1*03:01/DPB1*01:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 467 1359
HLA-DQA1*01:03/DQB1*05:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 242 703
HLA-DPA1*02:02/DPB1*04:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 387 1124
HLA-DPA1*02:02/DPB1*02:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 370 1062
HLA-DRB1*11:02 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1029 361
HLA-DRB1*13:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1029 361
HLA-DRB1*04:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 564 198
HLA-DRB1*10:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 346 985
HLA-DPA1*03:01/DPB1*01:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 116 330
HLA-DPA1*04:01/DPB1*05:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNDPFYYHKN 406 1154
HLA-DRB1*11:02 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 664 234
HLA-DRB1*13:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 664 234
HLA-DRB1*15:02 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 279 791
HLA-DPA1*02:02/DPB1*02:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 380 1074
HLA-DRB1*15:03 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 1354 480
HLA-DPA1*04:01/DPB1*05:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 398 1122
HLA-DQA1*01:03/DQB1*05:01 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 464 1307
HLA-DRB1*04:04 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 248 695
HLA-DPA1*04:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 186 520
HLA-DRB1*11:04 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 227 634
HLA-DQA1*01:02/DQB1*05:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 238 664
HLA-DQA1*01:02/DQB1*05:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 217 604
HLA-DRB1*11:04 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 215 597
HLA-DRB1*15:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 120 332
HLA-DRB1*10:01 QFCNDPFLGVYYHKNNKS QFCNDPFYYHKNNKS 1274 461
HLA-DQA1*01:03/DQB1*05:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 341 939
HLA-DRB1*13:02 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 441 1213
HLA-DQA1*01:02/DQB1*05:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 115 316
HLA-DRB1*15:03 DPFLGVYYHKNNKSWMES DPFYYHKNNKSWMES 967 355
HLA-DRB1*15:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 476 1296
HLA-DRB1*04:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 818 301
HLA-DPA1*02:02/DPB1*02:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 383 1039
HLA-DRB1*13:02 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 139 376
HLA-DPA1*03:01/DPB1*05:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 295 797
HLA-DPA1*04:01/DPB1*01:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 175 471
HLA-DPA1*03:01/DPB1*01:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 123 331
HLA-DPA1*04:01/DPB1*05:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 372 1000
HLA-DPA1*03:01/DPB1*05:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 336 903
HLA-DPA1*04:01/DPB1*01:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 420 1128
HLA-DPA1*04:01/DPB1*02:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 251 672
HLA-DQA1*01:02/DQB1*05:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 119 318
HLA-DPA1*03:01/DPB1*05:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 472 1261
HLA-DPA1*03:01/DPB1*01:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 135 360
HLA-DRB1*11:04 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 214 569
HLA-DQA1*01:03/DQB1*05:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNDPFYYHKNNK 341 906
HLA-DRB1*10:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 224 594
HLA-DPA1*01:03/DPB1*01:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 354 936
HLA-DRB1*04:04 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 342 902
HLA-DQA1*01:03/DQB1*05:01 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 374 974
HLA-DRB1*11:04 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 267 692
HLA-DPA1*03:01/DPB1*04:02 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNDPFY 382 989
HLA-DPA1*03:01/DPB1*105:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNDPFY 382 989
HLA-DPA1*02:02/DPB1*04:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 403 1039
HLA-DRB1*04:02 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 338 871
HLA-DQA1*01:03/DQB1*05:01 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 403 1031
HLA-DQA1*01:02/DQB1*05:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 103 263
HLA-DRB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 482 189
HLA-DRB1*01:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 240 609
HLA-DPA1*03:01/DPB1*05:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNDPFYYH 300 760
HLA-DRB1*15:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 214 540
HLA-DRB1*11:02 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 417 1052
HLA-DRB1*13:01 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 417 1052
HLA-DPA1*03:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNDPFYY 125 314
HLA-DPA1*04:01/DPB1*05:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 389 977
HLA-DQA1*01:02/DQB1*05:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 106 266
HLA-DRB1*15:01 CNDPFLGVYYHKNNKSWM CNDPFYYHKNNKSWM 378 151
HLA-DPA1*04:01/DPB1*01:01 EFQFCNDPFLGVYYHKNN EFQFCNDPFYYHKNN 234 584
HLA-DPA1*02:02/DPB1*01:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 247 616
HLA-DPA1*04:01/DPB1*05:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 439 1093
HLA-DRB1*15:03 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 1005 404
HLA-DRB1*13:02 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 138 343
HLA-DRB1*15:01 FCNDPFLGVYYHKNNKSW FCNDPFYYHKNNKSW 623 251
HLA-DPA1*04:01/DPB1*01:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNDPFYYHK 186 459
HLA-DRB1*10:01 FLGVYYHKNNKSWMESEF FYYHKNNKSWMESEF 1084 442
HLA-DPA1*02:02/DPB1*02:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 495 1213
HLA-DRB1*11:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 292 714
HLA-DQA1*01:02/DQB1*05:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 99 242
HLA-DRB1*15:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 132 320
HLA-DPA1*02:01/DPB1*01:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNDPFY 383 925
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 188 454
HLA-DPA1*03:01/DPB1*05:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 478 1148
HLA-DRB1*04:04 NDPFLGVYYHKNNKSWMESE NDPFYYHKNNKSWMESE 240 576
HLA-DRB1*15:03 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 344 825
HLA-DQA1*01:02/DQB1*05:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 426 1020
HLA-DRB1*01:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 372 890
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 420 1001
HLA-DRB1*11:02 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 257 611
HLA-DRB1*13:01 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 257 611
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 103 244
HLA-DRB1*10:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 470 1111
HLA-DPA1*04:01/DPB1*01:01 CEFQFCNDPFLGVYYHKN CEFQFCNDPFYYHKN 237 560
HLA-DQA1*01:02/DQB1*05:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNDPFYYHK 104 245
HLA-DPA1*04:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 220 516
HLA-DRB1*04:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 469 200
HLA-DQA1*01:03/DQB1*05:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNDPFYYHKNN 289 677
HLA-DRB1*11:02 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 247 575
HLA-DRB1*13:01 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 247 575
HLA-DRB1*08:04 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 497 1142
HLA-DRB1*15:03 DPFLGVYYHKNNKSWMESE DPFYYHKNNKSWMESE 328 752
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVYYHK VCEFQFCNDPFYYHK 200 458
HLA-DRB1*15:01 NDPFLGVYYHKNNKSWME NDPFYYHKNNKSWME 379 166
HLA-DRB1*15:02 DPFLGVYYHKNNKSWMESEF DPFYYHKNNKSWMESEF 268 608
HLA-DRB1*13:02 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 135 306
HLA-DPA1*01:03/DPB1*01:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNDPFYYH 336 759
HLA-DRB1*01:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 462 205
HLA-DRB1*04:04 CNDPFLGVYYHKNNKSWMES CNDPFYYHKNNKSWMES 239 537
HLA-DRB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 419 187
HLA-DPA1*03:01/DPB1*05:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 334 748
HLA-DPA1*03:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNDPFY 138 308
HLA-DRB1*11:02 FLGVYYHKNNKSWMESEF FYYHKNNKSWMESEF 717 324
HLA-DRB1*13:01 FLGVYYHKNNKSWMESEF FYYHKNNKSWMESEF 717 324
HLA-DPA1*03:01/DPB1*04:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNDPFY 176 387
HLA-DRB1*13:02 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 151 331
HLA-DRB1*10:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNDPFYYH 445 975
HLA-DPA1*04:01/DPB1*01:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNDPFYY 321 701
HLA-DRB1*04:04 PFLGVYYHKNNKSWMESE PFYYHKNNKSWMESE 917 420
HLA-DRB1*04:04 FCNDPFLGVYYHKNNKSWME FCNDPFYYHKNNKSWME 248 536
HLA-DRB1*11:04 PFLGVYYHKNNKSWMESEF PFYYHKNNKSWMESEF 392 845
HLA-DRB1*04:02 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 335 722
HLA-DRB1*08:02 PFLGVYYHKNNKSWMESEFR PFYYHKNNKSWMESEFR 377 810
HLA-DPA1*02:02/DPB1*01:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNDPFY 302 647
HLA-DRB1*13:02 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 178 381
HLA-DPA1*04:01/DPB1*01:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 368 776
HLA-DRB1*10:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 316 666
HLA-DQA1*01:03/DQB1*05:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNDPFYYHKN 287 604
HLA-DRB1*01:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 397 189
HLA-DQA1*01:03/DQB1*05:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFYYHKNNKS 475 997
HLA-DRB1*08:04 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 488 1024
HLA-DRB1*15:02 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFYYHKNNKS 487 1020
HLA-DQA1*01:03/DQB1*05:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 349 718
HLA-DPA1*03:01/DPB1*01:01 FLGVYYHKNNKSWMESEFRV FYYHKNNKSWMESEFRV 349 717
HLA-DRB1*04:02 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 358 729
HLA-DRB1*11:02 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 248 505
HLA-DRB1*13:01 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 248 505
HLA-DRB1*11:02 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 236 479
HLA-DRB1*13:01 NDPFLGVYYHKNNKSWMES NDPFYYHKNNKSWMES 236 479
HLA-DQA1*01:02/DQB1*06:09 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNDPFY 440 892
HLA-DRB1*04:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFYYHKNNKSWM 431 213
HLA-DQA1*01:03/DQB1*05:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNDPFYY 309 624
HLA-DRB1*04:02 CNDPFLGVYYHKNNKSWME CNDPFYYHKNNKSWME 348 700
HLA-DRB1*11:02 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 266 535
HLA-DRB1*13:01 FCNDPFLGVYYHKNNKSWM FCNDPFYYHKNNKSWM 266 535
HLA-DRB1*15:03 QFCNDPFLGVYYHKNNKSW QFCNDPFYYHKNNKSW 480 964

LA 242-243 deletion

Reference  PQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVG
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    PQGFSALEPLVDLPIGINITRFQTL‑‑LHRSYLTPGDSSSGWTAGAAACYVG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*02:01 VDLPIGINITRFQTLLA - 14 -
HLA-DPA1*03:01/DPB1*02:01 DLPIGINITRFQTLLAL - 14 -
HLA-DPA1*03:01/DPB1*02:01 PLVDLPIGINITRFQTLLA - 18 -
HLA-DPA1*03:01/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 20 -
HLA-DPA1*03:01/DPB1*04:01 DLPIGINITRFQTLLAL - 20 -
HLA-DPA1*03:01/DPB1*02:01 LVDLPIGINITRFQTLLAL - 21 -
HLA-DPA1*03:01/DPB1*04:01 VDLPIGINITRFQTLLA - 22 -
HLA-DPA1*03:01/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 24 -
HLA-DPA1*01:03/DPB1*04:01 VDLPIGINITRFQTLLA - 25 -
HLA-DPA1*01:03/DPB1*04:01 DLPIGINITRFQTLLAL - 26 -
HLA-DPA1*03:01/DPB1*04:01 PLVDLPIGINITRFQTLLA - 27 -
HLA-DPA1*01:03/DPB1*02:01 VDLPIGINITRFQTLLA - 28 -
HLA-DPA1*03:01/DPB1*02:01 LVDLPIGINITRFQTLLA - 28 -
HLA-DPA1*03:01/DPB1*04:01 LVDLPIGINITRFQTLLAL - 28 -
HLA-DPA1*03:01/DPB1*02:01 VDLPIGINITRFQTLLAL - 29 -
HLA-DPA1*01:03/DPB1*02:01 DLPIGINITRFQTLLAL - 30 -
HLA-DPA1*04:01/DPB1*02:01 VDLPIGINITRFQTLLA - 31 -
HLA-DPA1*04:01/DPB1*04:01 VDLPIGINITRFQTLLA - 31 -
HLA-DPA1*04:01/DPB1*04:01 DLPIGINITRFQTLLAL - 31 -
HLA-DPA1*03:01/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 32 -
HLA-DPA1*04:01/DPB1*02:01 DLPIGINITRFQTLLAL - 33 -
HLA-DPA1*03:01/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 36 -
HLA-DPA1*03:01/DPB1*04:01 VDLPIGINITRFQTLLAL - 37 -
HLA-DPA1*01:03/DPB1*04:01 PLVDLPIGINITRFQTLLA - 39 -
HLA-DPA1*03:01/DPB1*04:01 LVDLPIGINITRFQTLLA - 40 -
HLA-DPA1*03:01/DPB1*01:01 DLPIGINITRFQTLLAL - 41 -
HLA-DPA1*04:01/DPB1*04:01 PLVDLPIGINITRFQTLLA - 43 -
HLA-DPA1*01:03/DPB1*02:01 PLVDLPIGINITRFQTLLA - 44 -
HLA-DPA1*04:01/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 44 -
HLA-DPA1*04:01/DPB1*02:01 PLVDLPIGINITRFQTLLA - 45 -
HLA-DPA1*01:03/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 47 -
HLA-DPA1*01:03/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 47 -
HLA-DPA1*01:03/DPB1*04:01 LVDLPIGINITRFQTLLAL - 47 -
HLA-DPA1*03:01/DPB1*04:02 VDLPIGINITRFQTLLA - 47 -
HLA-DPA1*03:01/DPB1*04:02 DLPIGINITRFQTLLAL - 47 -
HLA-DPA1*03:01/DPB1*105:01 VDLPIGINITRFQTLLA - 47 -
HLA-DPA1*03:01/DPB1*105:01 DLPIGINITRFQTLLAL - 47 -
HLA-DRB1*15:01 DLPIGINITRFQTLLAL - 47 -
HLA-DPA1*04:01/DPB1*04:01 LVDLPIGINITRFQTLLAL - 48 -
HLA-DPA1*04:01/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 49 -
HLA-DPA1*04:01/DPB1*02:01 LVDLPIGINITRFQTLLAL - 49 -
HLA-DPA1*03:01/DPB1*01:01 LVDLPIGINITRFQTLLAL - 50 -
HLA-DPA1*04:01/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 50 -
HLA-DPA1*01:03/DPB1*02:01 LVDLPIGINITRFQTLLAL - 51 -
HLA-DRB1*04:04 DLPIGINITRFQTLLAL - 51 -
HLA-DPA1*03:01/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 54 -
HLA-DPA1*03:01/DPB1*01:01 VDLPIGINITRFQTLLA - 55 -
HLA-DPA1*01:03/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 58 -
HLA-DPA1*03:01/DPB1*01:01 PLVDLPIGINITRFQTLLA - 58 -
HLA-DPA1*04:01/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 58 -
HLA-DPA1*03:01/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 60 -
HLA-DPA1*01:03/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 62 -
HLA-DPA1*03:01/DPB1*04:02 PLVDLPIGINITRFQTLLA - 68 -
HLA-DPA1*03:01/DPB1*105:01 PLVDLPIGINITRFQTLLA - 68 -
HLA-DPA1*04:01/DPB1*04:01 LVDLPIGINITRFQTLLA - 68 -
HLA-DQA1*01:02/DQB1*05:01 EPLVDLPIGINITRFQTLLA - 68 -
HLA-DPA1*04:01/DPB1*02:01 LVDLPIGINITRFQTLLA - 69 -
HLA-DPA1*03:01/DPB1*01:01 VDLPIGINITRFQTLLAL - 71 -
HLA-DPA1*04:01/DPB1*04:01 VDLPIGINITRFQTLLAL - 71 -
HLA-DQA1*01:02/DQB1*05:01 PLVDLPIGINITRFQTLLAL - 71 -
HLA-DPA1*04:01/DPB1*01:01 DLPIGINITRFQTLLAL - 72 -
HLA-DPA1*04:01/DPB1*02:01 VDLPIGINITRFQTLLAL - 72 -
HLA-DQA1*01:02/DQB1*05:01 DLPIGINITRFQTLLAL - 72 -
HLA-DPA1*01:03/DPB1*04:01 LVDLPIGINITRFQTLLA - 73 -
HLA-DPA1*02:02/DPB1*01:01 VDLPIGINITRFQTLLA - 73 -
HLA-DPA1*01:03/DPB1*04:01 VDLPIGINITRFQTLLAL - 74 -
HLA-DPA1*03:01/DPB1*04:02 EPLVDLPIGINITRFQTLLA - 74 -
HLA-DPA1*03:01/DPB1*105:01 EPLVDLPIGINITRFQTLLA - 74 -
HLA-DPA1*02:01/DPB1*01:01 VDLPIGINITRFQTLLA - 76 -
HLA-DPA1*02:02/DPB1*01:01 DLPIGINITRFQTLLAL - 76 -
HLA-DPA1*01:03/DPB1*02:01 LVDLPIGINITRFQTLLA - 79 -
HLA-DPA1*03:01/DPB1*04:02 LVDLPIGINITRFQTLLAL - 79 -
HLA-DPA1*03:01/DPB1*105:01 LVDLPIGINITRFQTLLAL - 79 -
HLA-DQA1*01:02/DQB1*05:01 VDLPIGINITRFQTLLA - 81 -
HLA-DPA1*04:01/DPB1*01:01 VDLPIGINITRFQTLLA - 82 -
HLA-DRB1*15:01 VDLPIGINITRFQTLLA - 82 -
HLA-DQA1*01:02/DQB1*05:01 PLVDLPIGINITRFQTLLA - 83 -
HLA-DQA1*01:02/DQB1*05:01 LVDLPIGINITRFQTLLAL - 83 -
HLA-DPA1*02:01/DPB1*01:01 DLPIGINITRFQTLLAL - 84 -
HLA-DPA1*01:03/DPB1*02:01 VDLPIGINITRFQTLLAL - 85 -
HLA-DPA1*03:01/DPB1*01:01 LVDLPIGINITRFQTLLA - 90 -
HLA-DPA1*04:01/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 90 -
HLA-DPA1*03:01/DPB1*04:02 PLVDLPIGINITRFQTLLAL - 92 -
HLA-DPA1*03:01/DPB1*105:01 PLVDLPIGINITRFQTLLAL - 92 -
HLA-DRB1*04:04 VDLPIGINITRFQTLLA - 93 -
HLA-DPA1*01:03/DPB1*01:01 DLPIGINITRFQTLLAL - 94 -
HLA-DPA1*04:01/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 94 -
HLA-DPA1*04:01/DPB1*01:01 LVDLPIGINITRFQTLLAL - 95 -
HLA-DPA1*02:02/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 97 -
HLA-DPA1*04:01/DPB1*01:01 PLVDLPIGINITRFQTLLA - 100 -
HLA-DPA1*02:02/DPB1*01:01 PLVDLPIGINITRFQTLLA - 102 -
HLA-DPA1*01:03/DPB1*01:01 VDLPIGINITRFQTLLA - 104 -
HLA-DPA1*02:02/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 113 -
HLA-DPA1*02:02/DPB1*02:01 DLPIGINITRFQTLLAL - 115 -
HLA-DRB1*15:01 PLVDLPIGINITRFQTLLAL - 115 -
HLA-DPA1*02:02/DPB1*01:01 LVDLPIGINITRFQTLLAL - 117 -
HLA-DPA1*02:02/DPB1*02:01 VDLPIGINITRFQTLLA - 118 -
HLA-DPA1*01:03/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 120 -
HLA-DQA1*01:02/DQB1*05:01 VDLPIGINITRFQTLLAL - 121 -
HLA-DPA1*03:01/DPB1*04:02 VDLPIGINITRFQTLLAL - 123 -
HLA-DPA1*03:01/DPB1*105:01 VDLPIGINITRFQTLLAL - 123 -
HLA-DPA1*03:01/DPB1*04:02 LVDLPIGINITRFQTLLA - 125 -
HLA-DPA1*03:01/DPB1*105:01 LVDLPIGINITRFQTLLA - 125 -
HLA-DPA1*01:03/DPB1*01:01 PLVDLPIGINITRFQTLLA - 126 -
HLA-DQA1*01:02/DQB1*05:01 LVDLPIGINITRFQTLLA - 126 -
HLA-DPA1*02:01/DPB1*01:01 PLVDLPIGINITRFQTLLA - 127 -
HLA-DPA1*01:03/DPB1*01:01 LVDLPIGINITRFQTLLAL - 131 -
HLA-DRB1*10:01 DLPIGINITRFQTLLAL - 132 -
HLA-DPA1*01:03/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 133 -
HLA-DQA1*01:03/DQB1*05:01 DLPIGINITRFQTLLAL - 133 -
HLA-DPA1*02:02/DPB1*01:01 LVDLPIGINITRFQTLLA - 137 -
HLA-DRB1*15:01 LVDLPIGINITRFQTLLAL - 139 -
HLA-DPA1*04:01/DPB1*01:01 VDLPIGINITRFQTLLAL - 141 -
HLA-DPA1*02:01/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 143 -
HLA-DQA1*01:03/DQB1*05:01 PLVDLPIGINITRFQTLLAL - 144 -
HLA-DRB1*15:01 EPLVDLPIGINITRFQTLLA - 145 -
HLA-DPA1*03:01/DPB1*05:01 DLPIGINITRFQTLLAL - 146 -
HLA-DRB1*04:04 LVDLPIGINITRFQTLLAL - 146 -
HLA-DPA1*02:02/DPB1*01:01 VDLPIGINITRFQTLLAL - 147 -
HLA-DPA1*02:02/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 150 -
HLA-DPA1*02:02/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 151 -
HLA-DQA1*01:03/DQB1*05:01 EPLVDLPIGINITRFQTLLA - 151 -
HLA-DQA1*01:03/DQB1*05:01 VDLPIGINITRFQTLLA - 151 -
HLA-DPA1*02:02/DPB1*04:01 DLPIGINITRFQTLLAL - 153 -
HLA-DPA1*02:01/DPB1*01:01 LVDLPIGINITRFQTLLAL - 155 -
HLA-DPA1*04:01/DPB1*01:01 LVDLPIGINITRFQTLLA - 155 -
HLA-DPA1*02:01/DPB1*01:01 LVDLPIGINITRFQTLLA - 157 -
HLA-DRB1*04:04 PLVDLPIGINITRFQTLLAL - 159 -
HLA-DPA1*02:02/DPB1*04:01 VDLPIGINITRFQTLLA - 160 -
HLA-DPA1*03:01/DPB1*05:01 PLVDLPIGINITRFQTLLAL - 160 -
HLA-DPA1*02:02/DPB1*02:01 LVDLPIGINITRFQTLLAL - 164 -
HLA-DPA1*02:01/DPB1*02:01 VDLPIGINITRFQTLLA - 167 -
HLA-DPA1*02:01/DPB1*02:01 DLPIGINITRFQTLLAL - 170 -
HLA-DPA1*03:01/DPB1*05:01 EPLVDLPIGINITRFQTLLA - 170 -
HLA-DQA1*01:03/DQB1*05:01 LVDLPIGINITRFQTLLAL - 171 -
HLA-DPA1*02:01/DPB1*04:01 VDLPIGINITRFQTLLA - 172 -
HLA-DPA1*02:02/DPB1*02:01 PLVDLPIGINITRFQTLLA - 172 -
HLA-DRB1*11:04 DLPIGINITRFQTLLAL - 173 -
HLA-DRB1*10:01 VDLPIGINITRFQTLLA - 177 -
HLA-DPA1*01:03/DPB1*01:01 VDLPIGINITRFQTLLAL - 178 -
HLA-DPA1*02:01/DPB1*01:01 VDLPIGINITRFQTLLAL - 179 -
HLA-DPA1*02:01/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 184 -
HLA-DPA1*02:01/DPB1*04:01 DLPIGINITRFQTLLAL - 184 -
HLA-DRB1*01:01 DLPIGINITRFQTLLAL - 184 -
HLA-DPA1*03:01/DPB1*05:01 VDLPIGINITRFQTLLA - 185 -
HLA-DRB1*10:01 EPLVDLPIGINITRFQTLLA - 186 -
HLA-DQA1*01:03/DQB1*05:01 PLVDLPIGINITRFQTLLA - 187 -
HLA-DRB1*13:02 EPLVDLPIGINITRFQTLLA - 187 -
HLA-DPA1*01:03/DPB1*01:01 LVDLPIGINITRFQTLLA - 197 -
HLA-DRB1*13:02 PLVDLPIGINITRFQTLLAL - 199 -
HLA-DRB1*15:01 PLVDLPIGINITRFQTLLA - 201 -
HLA-DRB1*10:01 PLVDLPIGINITRFQTLLAL - 202 -
HLA-DRB1*11:02 DLPIGINITRFQTLLAL - 203 -
HLA-DRB1*13:01 DLPIGINITRFQTLLAL - 203 -
HLA-DRB1*15:03 DLPIGINITRFQTLLAL - 203 -
HLA-DPA1*03:01/DPB1*05:01 LVDLPIGINITRFQTLLAL - 204 -
HLA-DRB1*11:04 VDLPIGINITRFQTLLA - 210 -
HLA-DRB1*13:02 VDLPIGINITRFQTLLA - 218 -
HLA-DRB1*04:04 EPLVDLPIGINITRFQTLLA - 219 -
HLA-DPA1*04:01/DPB1*04:02 DLPIGINITRFQTLLAL - 220 -
HLA-DPA1*04:01/DPB1*105:01 DLPIGINITRFQTLLAL - 220 -
HLA-DRB1*04:04 PLVDLPIGINITRFQTLLA - 222 -
HLA-DRB1*13:02 DLPIGINITRFQTLLAL - 223 -
HLA-DRB1*11:02 VDLPIGINITRFQTLLA - 226 -
HLA-DRB1*13:01 VDLPIGINITRFQTLLA - 226 -
HLA-DPA1*02:02/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 228 -
HLA-DRB1*01:01 EPLVDLPIGINITRFQTLLA - 232 -
HLA-DPA1*02:02/DPB1*04:01 LVDLPIGINITRFQTLLAL - 234 -
HLA-DRB1*04:04 VDLPIGINITRFQTLLAL - 235 -
HLA-DPA1*02:02/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 236 -
HLA-DRB1*15:02 DLPIGINITRFQTLLAL - 236 -
HLA-DPA1*03:01/DPB1*05:01 PLVDLPIGINITRFQTLLA - 237 -
HLA-DPA1*02:02/DPB1*02:01 VDLPIGINITRFQTLLAL - 239 -
HLA-DRB1*01:01 PLVDLPIGINITRFQTLLAL - 239 -
HLA-DPA1*04:01/DPB1*04:02 VDLPIGINITRFQTLLA - 241 -
HLA-DPA1*04:01/DPB1*105:01 VDLPIGINITRFQTLLA - 241 -
HLA-DPA1*03:01/DPB1*13:01 DLPIGINITRFQTLLAL - 242 -
HLA-DRB1*08:04 DLPIGINITRFQTLLAL - 245 -
HLA-DQA1*02:01/DQB1*03:01 ALHRSYLTPGDSSSGWTAGA - 249 -
HLA-DQA1*02:01/DQB1*03:19 ALHRSYLTPGDSSSGWTAGA - 249 -
HLA-DPA1*02:02/DPB1*04:01 PLVDLPIGINITRFQTLLA - 250 -
HLA-DPA1*02:01/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 253 -
HLA-DRB1*01:01 VDLPIGINITRFQTLLA - 256 -
HLA-DPA1*02:02/DPB1*02:01 LVDLPIGINITRFQTLLA - 257 -
HLA-DRB1*15:01 VDLPIGINITRFQTLLAL - 259 -
HLA-DPA1*02:01/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 261 -
HLA-DRB1*10:01 PLVDLPIGINITRFQTLLA - 263 -
HLA-DPA1*02:01/DPB1*02:01 LVDLPIGINITRFQTLLAL - 266 -
HLA-DPA1*02:01/DPB1*02:01 PLVDLPIGINITRFQTLLA - 268 -
HLA-DQA1*01:03/DQB1*05:01 VDLPIGINITRFQTLLAL - 268 -
HLA-DPA1*03:01/DPB1*11:01 PLVDLPIGINITRFQTLLAL - 270 -
HLA-DPA1*03:01/DPB1*11:01 DLPIGINITRFQTLLAL - 271 -
HLA-DRB1*15:03 VDLPIGINITRFQTLLA - 272 -
HLA-DPA1*04:01/DPB1*05:01 PLVDLPIGINITRFQTLLAL - 273 -
HLA-DPA1*03:01/DPB1*13:01 PLVDLPIGINITRFQTLLAL - 274 -
HLA-DPA1*03:01/DPB1*13:01 LVDLPIGINITRFQTLLAL - 274 -
HLA-DRB1*07:01 VDLPIGINITRFQTLLA - 274 -
HLA-DPA1*04:01/DPB1*05:01 DLPIGINITRFQTLLAL - 275 -
HLA-DRB1*10:01 LVDLPIGINITRFQTLLAL - 275 -
HLA-DRB1*13:02 PLVDLPIGINITRFQTLLA - 280 -
HLA-DPA1*03:01/DPB1*11:01 EPLVDLPIGINITRFQTLLA - 282 -
HLA-DRB1*13:02 LVDLPIGINITRFQTLLAL - 289 -
HLA-DPA1*04:01/DPB1*05:01 EPLVDLPIGINITRFQTLLA - 292 -
HLA-DQA1*01:03/DQB1*05:01 LVDLPIGINITRFQTLLA - 293 -
HLA-DPA1*04:01/DPB1*13:01 DLPIGINITRFQTLLAL - 294 -
HLA-DPA1*03:01/DPB1*13:01 EPLVDLPIGINITRFQTLLA - 295 -
HLA-DPA1*03:01/DPB1*11:01 LVDLPIGINITRFQTLLAL - 296 -
HLA-DRB1*07:01 DLPIGINITRFQTLLAL - 296 -
HLA-DQA1*01:02/DQB1*05:03 DLPIGINITRFQTLLAL - 299 -
HLA-DRB1*14:04 DLPIGINITRFQTLLAL - 300 -
HLA-DRB1*08:04 VDLPIGINITRFQTLLA - 302 -
HLA-DPA1*02:02/DPB1*04:01 VDLPIGINITRFQTLLAL - 305 -
HLA-DPA1*01:03/DPB1*04:02 VDLPIGINITRFQTLLA - 308 -
HLA-DPA1*01:03/DPB1*105:01 VDLPIGINITRFQTLLA - 308 -
HLA-DPA1*01:03/DPB1*04:02 DLPIGINITRFQTLLAL - 310 -
HLA-DPA1*01:03/DPB1*105:01 DLPIGINITRFQTLLAL - 310 -
HLA-DPA1*04:01/DPB1*04:02 EPLVDLPIGINITRFQTLLA - 310 -
HLA-DPA1*04:01/DPB1*105:01 EPLVDLPIGINITRFQTLLA - 310 -
HLA-DQA1*01:03/DQB1*06:09 PLVDLPIGINITRFQTLLAL - 311 -
HLA-DQA1*01:02/DQB1*05:03 EPLVDLPIGINITRFQTLLA - 314 -
HLA-DQA1*01:02/DQB1*05:03 PLVDLPIGINITRFQTLLAL - 315 -
HLA-DRB1*11:02 PLVDLPIGINITRFQTLLAL - 315 -
HLA-DRB1*13:01 PLVDLPIGINITRFQTLLAL - 315 -
HLA-DPA1*04:01/DPB1*13:01 PLVDLPIGINITRFQTLLAL - 320 -
HLA-DPA1*04:01/DPB1*13:01 EPLVDLPIGINITRFQTLLA - 323 -
HLA-DRB1*11:02 EPLVDLPIGINITRFQTLLA - 323 -
HLA-DRB1*13:01 EPLVDLPIGINITRFQTLLA - 323 -
HLA-DPA1*03:01/DPB1*05:01 VDLPIGINITRFQTLLAL - 324 -
HLA-DPA1*04:01/DPB1*04:02 PLVDLPIGINITRFQTLLAL - 325 -
HLA-DPA1*04:01/DPB1*105:01 PLVDLPIGINITRFQTLLAL - 325 -
HLA-DQA1*01:03/DQB1*06:09 EPLVDLPIGINITRFQTLLA - 325 -
HLA-DPA1*03:01/DPB1*13:01 VDLPIGINITRFQTLLA - 326 -
HLA-DPA1*03:01/DPB1*13:01 PLVDLPIGINITRFQTLLA - 328 -
HLA-DPA1*04:01/DPB1*05:01 VDLPIGINITRFQTLLA - 328 -
HLA-DPA1*03:01/DPB1*06:01 DLPIGINITRFQTLLAL - 330 -
HLA-DQA1*01:02/DQB1*05:03 VDLPIGINITRFQTLLA - 331 -
HLA-DRB1*14:04 VDLPIGINITRFQTLLA - 333 -
HLA-DPA1*02:01/DPB1*04:01 PLVDLPIGINITRFQTLLA - 334 -
HLA-DPA1*02:02/DPB1*05:01 DLPIGINITRFQTLLAL - 336 -
HLA-DPA1*04:01/DPB1*04:02 LVDLPIGINITRFQTLLAL - 336 -
HLA-DPA1*04:01/DPB1*105:01 LVDLPIGINITRFQTLLAL - 336 -
HLA-DRB1*15:02 PLVDLPIGINITRFQTLLAL - 336 -
HLA-DPA1*04:01/DPB1*04:02 PLVDLPIGINITRFQTLLA - 337 -
HLA-DPA1*04:01/DPB1*105:01 PLVDLPIGINITRFQTLLA - 337 -
HLA-DPA1*02:01/DPB1*04:01 LVDLPIGINITRFQTLLAL - 338 -
HLA-DPA1*03:01/DPB1*11:01 PLVDLPIGINITRFQTLLA - 341 -
HLA-DQA1*01:02/DQB1*05:01 LALHRSYLTPGDSSSGWTAG - 342 -
HLA-DPA1*02:02/DPB1*04:01 LVDLPIGINITRFQTLLA - 343 -
HLA-DRB1*16:01 DLPIGINITRFQTLLAL - 343 -
HLA-DRB1*14:01 DLPIGINITRFQTLLAL - 344 -
HLA-DPA1*04:01/DPB1*13:01 VDLPIGINITRFQTLLA - 348 -
HLA-DRB1*11:01 DLPIGINITRFQTLLAL - 348 -
HLA-DQA1*01:03/DQB1*06:09 DLPIGINITRFQTLLAL - 351 -
HLA-DRB1*15:02 VDLPIGINITRFQTLLA - 351 -
HLA-DPA1*02:02/DPB1*13:01 DLPIGINITRFQTLLAL - 352 -
HLA-DPA1*02:02/DPB1*05:01 VDLPIGINITRFQTLLA - 353 -
HLA-DPA1*02:01/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 354 -
HLA-DQA1*01:02/DQB1*05:03 LVDLPIGINITRFQTLLAL - 355 -
HLA-DQA1*01:03/DQB1*06:09 VDLPIGINITRFQTLLA - 357 -
HLA-DRB1*15:02 EPLVDLPIGINITRFQTLLA - 359 -
HLA-DPA1*04:01/DPB1*13:01 LVDLPIGINITRFQTLLAL - 361 -
HLA-DPA1*03:01/DPB1*11:01 VDLPIGINITRFQTLLA - 362 -
HLA-DQA1*01:02/DQB1*05:03 PLVDLPIGINITRFQTLLA - 367 -
HLA-DPA1*04:01/DPB1*05:01 LVDLPIGINITRFQTLLAL - 368 -
HLA-DPA1*02:02/DPB1*05:01 EPLVDLPIGINITRFQTLLA - 370 -
HLA-DPA1*04:01/DPB1*11:01 DLPIGINITRFQTLLAL - 371 -
HLA-DQA1*01:03/DQB1*06:09 LVDLPIGINITRFQTLLAL - 371 -
HLA-DRB1*04:01 DLPIGINITRFQTLLAL - 373 -
HLA-DRB1*11:04 PLVDLPIGINITRFQTLLAL - 374 -
HLA-DRB1*01:01 LVDLPIGINITRFQTLLAL - 376 -
HLA-DPA1*02:01/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 378 -
HLA-DQA1*02:01/DQB1*03:01 LALHRSYLTPGDSSSGWTAG - 378 -
HLA-DQA1*02:01/DQB1*03:19 LALHRSYLTPGDSSSGWTAG - 378 -
HLA-DRB1*11:01 VDLPIGINITRFQTLLA - 378 -
HLA-DPA1*03:01/DPB1*06:01 EPLVDLPIGINITRFQTLLA - 381 -
HLA-DQA1*01:02/DQB1*06:09 LVDLPIGINITRFQTLLAL - 381 -
HLA-DQA1*01:02/DQB1*06:09 PLVDLPIGINITRFQTLLAL - 382 -
HLA-DPA1*03:01/DPB1*06:01 PLVDLPIGINITRFQTLLAL - 383 -
HLA-DPA1*03:01/DPB1*17:01 DLPIGINITRFQTLLAL - 383 -
HLA-DRB1*14:01 VDLPIGINITRFQTLLA - 385 -
HLA-DPA1*02:01/DPB1*02:01 VDLPIGINITRFQTLLAL - 386 -
HLA-DRB1*08:02 DLPIGINITRFQTLLAL - 390 -
HLA-DRB1*15:03 PLVDLPIGINITRFQTLLAL - 390 -
HLA-DPA1*04:01/DPB1*13:01 PLVDLPIGINITRFQTLLA - 391 -
HLA-DPA1*03:01/DPB1*05:01 LVDLPIGINITRFQTLLA - 394 -
HLA-DQA1*01:03/DQB1*06:09 PLVDLPIGINITRFQTLLA - 397 -
HLA-DPA1*03:01/DPB1*09:01 DLPIGINITRFQTLLAL - 398 -
HLA-DPA1*04:01/DPB1*05:01 PLVDLPIGINITRFQTLLA - 399 -
HLA-DPA1*02:02/DPB1*13:01 VDLPIGINITRFQTLLA - 402 -
HLA-DRB1*07:01 EPLVDLPIGINITRFQTLLA - 403 -
HLA-DPA1*03:01/DPB1*06:01 VDLPIGINITRFQTLLA - 404 -
HLA-DQA1*01:02/DQB1*05:01 LALHRSYLTPGDSSSGW - 404 -
HLA-DRB1*01:01 PLVDLPIGINITRFQTLLA - 404 -
HLA-DPA1*02:02/DPB1*05:01 PLVDLPIGINITRFQTLLAL - 406 -
HLA-DPA1*03:01/DPB1*85:01 PLVDLPIGINITRFQTLLAL - 406 -
HLA-DPA1*03:01/DPB1*06:01 LVDLPIGINITRFQTLLAL - 407 -
HLA-DPA1*03:01/DPB1*85:01 DLPIGINITRFQTLLAL - 407 -
HLA-DPA1*04:01/DPB1*11:01 PLVDLPIGINITRFQTLLAL - 407 -
HLA-DQA1*01:02/DQB1*06:09 DLPIGINITRFQTLLAL - 409 -
HLA-DQA1*01:03/DQB1*06:01 LALHRSYLTPGDSSSGWTAG - 409 -
HLA-DQA1*01:02/DQB1*06:09 EPLVDLPIGINITRFQTLLA - 410 -
HLA-DPA1*02:02/DPB1*04:02 DLPIGINITRFQTLLAL - 413 -
HLA-DPA1*02:02/DPB1*105:01 DLPIGINITRFQTLLAL - 413 -
HLA-DRB1*11:04 EPLVDLPIGINITRFQTLLA - 414 -
HLA-DPA1*02:01/DPB1*02:01 LVDLPIGINITRFQTLLA - 415 -
HLA-DPA1*03:01/DPB1*17:01 PLVDLPIGINITRFQTLLAL - 417 -
HLA-DQA1*01:02/DQB1*06:09 PLVDLPIGINITRFQTLLA - 419 -
HLA-DRB1*04:04 LVDLPIGINITRFQTLLA - 429 -
HLA-DPA1*03:01/DPB1*09:01 PLVDLPIGINITRFQTLLAL - 430 -
HLA-DQA1*01:02/DQB1*05:03 VDLPIGINITRFQTLLAL - 431 -
HLA-DPA1*02:02/DPB1*13:01 EPLVDLPIGINITRFQTLLA - 434 -
HLA-DPA1*03:01/DPB1*85:01 LVDLPIGINITRFQTLLAL - 439 -
HLA-DPA1*04:01/DPB1*11:01 EPLVDLPIGINITRFQTLLA - 440 -
HLA-DQA1*01:02/DQB1*05:03 LVDLPIGINITRFQTLLA - 441 -
HLA-DRB1*11:02 LVDLPIGINITRFQTLLAL - 441 -
HLA-DRB1*13:01 LVDLPIGINITRFQTLLAL - 441 -
HLA-DPA1*02:02/DPB1*13:01 PLVDLPIGINITRFQTLLAL - 443 -
HLA-DQA1*01:03/DQB1*06:01 ALHRSYLTPGDSSSGWTAGA - 444 -
HLA-DPA1*03:01/DPB1*06:01 PLVDLPIGINITRFQTLLA - 445 -
HLA-DPA1*03:01/DPB1*13:01 VDLPIGINITRFQTLLAL - 445 -
HLA-DRB1*14:04 EPLVDLPIGINITRFQTLLA - 445 -
HLA-DPA1*04:01/DPB1*06:01 PLVDLPIGINITRFQTLLAL - 446 -
HLA-DQA1*01:02/DQB1*06:09 VDLPIGINITRFQTLLA - 446 -
HLA-DRB1*15:02 LVDLPIGINITRFQTLLAL - 446 -
HLA-DPA1*03:01/DPB1*17:01 EPLVDLPIGINITRFQTLLA - 449 -
HLA-DPA1*03:01/DPB1*85:01 EPLVDLPIGINITRFQTLLA - 449 -
HLA-DQA1*01:03/DQB1*06:01 LALHRSYLTPGDSSSGW - 449 -
HLA-DRB1*08:04 PLVDLPIGINITRFQTLLAL - 452 -
HLA-DPA1*02:01/DPB1*04:01 VDLPIGINITRFQTLLAL - 455 -
HLA-DPA1*01:03/DPB1*04:02 EPLVDLPIGINITRFQTLLA - 456 -
HLA-DPA1*01:03/DPB1*105:01 EPLVDLPIGINITRFQTLLA - 456 -
HLA-DRB1*14:04 PLVDLPIGINITRFQTLLAL - 457 -
HLA-DRB1*07:01 PLVDLPIGINITRFQTLLAL - 459 -
HLA-DRB1*15:01 LVDLPIGINITRFQTLLA - 460 -
HLA-DRB1*11:04 LVDLPIGINITRFQTLLAL - 461 -
HLA-DRB1*11:02 PLVDLPIGINITRFQTLLA - 462 -
HLA-DRB1*13:01 PLVDLPIGINITRFQTLLA - 462 -
HLA-DPA1*03:01/DPB1*17:01 LVDLPIGINITRFQTLLAL - 465 -
HLA-DPA1*04:01/DPB1*09:01 DLPIGINITRFQTLLAL - 466 -
HLA-DPA1*04:01/DPB1*06:01 DLPIGINITRFQTLLAL - 469 -
HLA-DRB1*08:04 EPLVDLPIGINITRFQTLLA - 470 -
HLA-DQA1*05:01/DQB1*03:01 ALHRSYLTPGDSSSGWTAGA - 473 -
HLA-DQA1*05:01/DQB1*03:19 ALHRSYLTPGDSSSGWTAGA - 473 -
HLA-DRB1*15:03 EPLVDLPIGINITRFQTLLA - 477 -
HLA-DPA1*01:03/DPB1*05:01 DLPIGINITRFQTLLAL - 481 -
HLA-DPA1*02:01/DPB1*04:01 LVDLPIGINITRFQTLLA - 483 -
HLA-DPA1*02:02/DPB1*04:02 VDLPIGINITRFQTLLA - 485 -
HLA-DPA1*02:02/DPB1*105:01 VDLPIGINITRFQTLLA - 485 -
HLA-DPA1*02:02/DPB1*11:01 DLPIGINITRFQTLLAL - 485 -
HLA-DPA1*03:01/DPB1*09:01 EPLVDLPIGINITRFQTLLA - 485 -
HLA-DPA1*01:03/DPB1*05:01 PLVDLPIGINITRFQTLLAL - 486 -
HLA-DQA1*01:02/DQB1*05:01 LALHRSYLTPGDSSSGWTA - 487 -
HLA-DQA1*02:01/DQB1*03:01 ALHRSYLTPGDSSSGW - 487 -
HLA-DQA1*02:01/DQB1*03:19 ALHRSYLTPGDSSSGW - 487 -
HLA-DRB1*08:02 VDLPIGINITRFQTLLA - 487 -
HLA-DPA1*04:01/DPB1*11:01 VDLPIGINITRFQTLLA - 489 -
HLA-DPA1*04:01/DPB1*06:01 EPLVDLPIGINITRFQTLLA - 497 -
HLA-DPA1*02:01/DPB1*13:01 DLPIGINITRFQTLLAL - 498 -
HLA-DPA1*02:02/DPB1*11:01 EPLVDLPIGINITRFQTLLA - 498 -
HLA-DPA1*04:01/DPB1*11:01 LVDLPIGINITRFQTLLAL - 499 -
HLA-DPA1*03:01/DPB1*09:01 LVDLPIGINITRFQTLLAL - 500 -
HLA-DRB1*15:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 79 8949
HLA-DRB1*15:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 44 4869
HLA-DRB1*15:01 LLALHRSYLTPGDSSSGWTA LLHRSYLTPGDSSSGWTA 185 13216
HLA-DRB1*15:03 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 89 6220
HLA-DRB1*11:02 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 92 6150
HLA-DRB1*13:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 92 6150
HLA-DRB1*15:03 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 152 9854
HLA-DRB1*15:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 36 2236
HLA-DRB1*11:04 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 98 6063
HLA-DRB1*11:02 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 171 10035
HLA-DRB1*13:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 171 10035
HLA-DRB1*11:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 157 8520
HLA-DRB1*07:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 166 7396
HLA-DRB1*15:03 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 72 3113
HLA-DRB1*01:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 97 4144
HLA-DRB1*11:04 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 65 2715
HLA-DRB1*15:02 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 197 7899
HLA-DRB1*11:02 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 78 3048
HLA-DRB1*13:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 78 3048
HLA-DRB1*11:04 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 226 8683
HLA-DPA1*01:03/DPB1*03:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 135 5144
HLA-DRB1*15:03 LLALHRSYLTPGDSSSGWTA LLHRSYLTPGDSSSGWTA 352 13170
HLA-DRB1*11:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 103 3795
HLA-DRB1*01:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 150 5500
HLA-DRB1*15:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 33 1176
HLA-DRB1*07:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 287 10008
HLA-DRB1*15:02 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 331 11086
HLA-DRB1*07:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 133 4411
HLA-DRB1*15:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 31 998
HLA-DRB1*13:02 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 258 8222
HLA-DRB1*11:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 348 11072
HLA-DRB1*01:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 67 2126
HLA-DRB1*11:02 LLALHRSYLTPGDSSSGWTA LLHRSYLTPGDSSSGWTA 416 12964
HLA-DRB1*13:01 LLALHRSYLTPGDSSSGWTA LLHRSYLTPGDSSSGWTA 416 12964
HLA-DRB1*16:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 225 6630
HLA-DRB1*15:01 LLALHRSYLTPGDSSSG LLHRSYLTPGDSSSG 141 4014
HLA-DRB1*08:04 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 218 6202
HLA-DRB1*15:01 TLLALHRSYLTPGDSSSGW TLLHRSYLTPGDSSSGW 119 3243
HLA-DRB1*01:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 39 1060
HLA-DRB1*01:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 34 923
HLA-DRB1*15:03 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 62 1672
HLA-DRB1*15:02 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 163 4369
HLA-DRB1*13:02 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 213 5638
HLA-DRB1*01:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 45 1165
HLA-DRB1*15:01 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 66 1695
HLA-DRB1*01:01 LLALHRSYLTPGDSSSGWTA LLHRSYLTPGDSSSGWTA 268 6851
HLA-DRB1*13:02 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 444 11283
HLA-DRB1*16:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 359 9079
HLA-DRB1*11:02 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 66 1643
HLA-DRB1*13:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 66 1643
HLA-DRB1*15:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 29 719
HLA-DRB1*08:04 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 156 3859
HLA-DRB1*15:03 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 58 1422
HLA-DRB1*12:02 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 396 9249
HLA-DRB1*11:04 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 49 1141
HLA-DRB1*07:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 112 2580
HLA-DRB1*15:01 LLALHRSYLTPGDSSSGWT LLHRSYLTPGDSSSGWT 277 6222
HLA-DRB1*01:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 32 717
HLA-DRB1*16:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 158 3522
HLA-DPA1*04:01/DPB1*03:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 100 2203
HLA-DRB1*08:04 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 394 8624
HLA-DRB1*14:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 254 5476
HLA-DRB1*07:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 101 2164
HLA-DPA1*01:03/DPB1*03:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 93 1987
HLA-DRB1*01:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 57 1212
HLA-DRB1*01:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 30 630
HLA-DRB1*01:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 32 662
HLA-DRB1*11:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 76 1562
HLA-DRB1*15:02 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 140 2863
HLA-DRB1*16:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 78 1591
HLA-DRB1*11:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 60 1206
HLA-DRB1*13:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 60 1206
HLA-DRB1*14:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 420 8399
HLA-DRB1*15:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 130 2577
HLA-DRB1*16:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 104 2020
HLA-DRB1*10:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 40 776
HLA-DRB1*15:03 LLALHRSYLTPGDSSSG LLHRSYLTPGDSSSG 280 5344
HLA-DRB1*13:02 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 190 3513
HLA-DRB1*08:04 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 122 2231
HLA-DRB1*14:04 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 423 7732
HLA-DRB1*07:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 96 1732
HLA-DRB1*08:02 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 354 6376
HLA-DRB1*04:04 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 363 6493
HLA-DRB1*01:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 29 513
HLA-DPA1*01:03/DPB1*14:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 201 3555
HLA-DRB1*10:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 101 1786
HLA-DRB1*15:01 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 72 1267
HLA-DPA1*01:03/DPB1*03:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 434 7588
HLA-DRB1*10:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 58 1012
HLA-DRB1*10:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 152 2614
HLA-DRB1*15:03 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 136 2323
HLA-DRB1*13:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 176 3003
HLA-DRB1*04:04 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 281 4762
HLA-DRB1*11:02 TLLALHRSYLTPGDSSSGW TLLHRSYLTPGDSSSGW 241 4067
HLA-DRB1*13:01 TLLALHRSYLTPGDSSSGW TLLHRSYLTPGDSSSGW 241 4067
HLA-DRB1*04:04 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 170 2854
HLA-DRB1*14:04 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 288 4831
HLA-DRB1*01:01 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 28 469
HLA-DRB1*15:03 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 57 954
HLA-DRB1*15:03 TLLALHRSYLTPGDSSSGW TLLHRSYLTPGDSSSGW 253 4213
HLA-DRB1*11:04 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 43 716
HLA-DRB1*08:02 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 267 4327
HLA-DRB1*10:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 207 3346
HLA-DRB1*01:01 PIGINITRFQTLLALHRSYL PIGINITRFQTLLHRSYL 33 532
HLA-DRB1*14:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 209 3356
HLA-DRB1*15:02 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 119 1892
HLA-DRB1*16:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 69 1089
HLA-DRB1*04:04 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 206 3247
HLA-DRB1*07:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 90 1415
HLA-DRB1*01:02 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 228 3564
HLA-DRB1*01:02 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 367 5717
HLA-DRB1*11:04 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 122 1900
HLA-DRB1*11:04 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 98 1525
HLA-DRB1*08:04 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 105 1629
HLA-DPA1*01:03/DPB1*03:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 74 1136
HLA-DPA1*03:01/DPB1*03:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 185 2796
HLA-DRB1*15:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 25 373
HLA-DRB1*01:01 IGINITRFQTLLALHRSYLT IGINITRFQTLLHRSYLT 30 447
HLA-DRB1*11:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 63 935
HLA-DRB1*11:04 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 54 795
HLA-DRB1*13:02 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 172 2475
HLA-DPA1*01:03/DPB1*06:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 124 1777
HLA-DRB1*10:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 36 507
HLA-DRB1*11:02 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 57 786
HLA-DRB1*13:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 57 786
HLA-DRB1*10:01 LLALHRSYLTPGDSSSGWTA LLHRSYLTPGDSSSGWTA 304 4173
HLA-DRB1*11:01 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 226 3101
HLA-DRB1*11:02 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 143 1945
HLA-DRB1*13:01 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 143 1945
HLA-DPA1*01:03/DPB1*03:01 PIGINITRFQTLLALHR PIGINITRFQTLLHR 110 1494
HLA-DRB1*11:01 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 114 1540
HLA-DPA1*04:01/DPB1*03:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 255 3440
HLA-DPA1*01:03/DPB1*14:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 147 1975
HLA-DRB1*01:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 129 1713
HLA-DRB1*15:03 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 157 2082
HLA-DRB1*15:01 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 44 579
HLA-DRB1*01:02 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 163 2116
HLA-DRB1*14:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 184 2388
HLA-DRB1*08:02 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 218 2811
HLA-DRB1*11:01 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 212 2716
HLA-DRB1*15:02 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 103 1308
HLA-DRB1*11:02 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 122 1520
HLA-DRB1*13:01 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 122 1520
HLA-DRB1*07:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 91 1105
HLA-DPA1*04:01/DPB1*06:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 76 920
HLA-DPA1*01:03/DPB1*26:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 280 3385
HLA-DPA1*04:01/DPB1*03:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 75 900
HLA-DPA1*03:01/DPB1*02:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 398 4736
HLA-DRB1*04:04 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 140 1645
HLA-DPA1*04:01/DPB1*14:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 146 1715
HLA-DPA1*01:03/DPB1*85:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 194 2277
HLA-DRB1*08:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 191 2241
HLA-DRB1*16:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 62 717
HLA-DRB1*13:02 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 170 1965
HLA-DRB1*04:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 322 3665
HLA-DPA1*01:03/DPB1*14:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 123 1377
HLA-DRB1*14:04 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 248 2776
HLA-DRB1*11:04 TLLALHRSYLTPGDSSSGW TLLHRSYLTPGDSSSGW 273 3053
HLA-DRB1*11:04 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 39 435
HLA-DPA1*01:03/DPB1*03:01 PIGINITRFQTLLALHRSYL PIGINITRFQTLLHRSYL 72 795
HLA-DRB1*15:02 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 319 3471
HLA-DRB1*15:03 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 92 1001
HLA-DRB1*11:02 LLALHRSYLTPGDSSSG LLHRSYLTPGDSSSG 274 2969
HLA-DRB1*13:01 LLALHRSYLTPGDSSSG LLHRSYLTPGDSSSG 274 2969
HLA-DRB1*10:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 32 345
HLA-DRB1*01:02 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 116 1245
HLA-DRB1*12:02 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 274 2939
HLA-DRB1*15:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 66 702
HLA-DPA1*03:01/DPB1*03:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 150 1587
HLA-DRB1*11:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 58 612
HLA-DRB1*04:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 389 4098
HLA-DPA1*03:01/DPB1*02:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 270 2836
HLA-DPA1*01:03/DPB1*11:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 119 1244
HLA-DPA1*01:03/DPB1*11:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 109 1133
HLA-DQA1*01:02/DQB1*05:01 LLALHRSYLTPGDSSSGWTA LLHRSYLTPGDSSSGWTA 187 1938
HLA-DRB1*04:02 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 434 4450
HLA-DRB1*10:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 36 368
HLA-DPA1*01:03/DPB1*03:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 83 846
HLA-DPA1*01:03/DPB1*85:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 172 1752
HLA-DPA1*01:03/DPB1*03:01 IGINITRFQTLLALHRSYLT IGINITRFQTLLHRSYLT 71 723
HLA-DPA1*01:03/DPB1*03:01 DLPIGINITRFQTLLALHR DLPIGINITRFQTLLHR 204 2076
HLA-DPA1*04:01/DPB1*03:01 PIGINITRFQTLLALHR PIGINITRFQTLLHR 78 793
HLA-DQA1*01:02/DQB1*05:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 143 1453
HLA-DRB1*04:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 405 4097
HLA-DPA1*01:03/DPB1*05:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 99 1001
HLA-DRB1*07:01 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 262 2641
HLA-DPA1*01:03/DPB1*85:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 161 1621
HLA-DPA1*01:03/DPB1*26:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 235 2355
HLA-DPA1*01:03/DPB1*03:01 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 72 718
HLA-DPA1*01:03/DPB1*10:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 350 3488
HLA-DQA1*01:03/DQB1*05:01 LLALHRSYLTPGDSSSGWTA LLHRSYLTPGDSSSGWTA 290 2877
HLA-DRB1*11:01 TLLALHRSYLTPGDSSSGW TLLHRSYLTPGDSSSGW 485 4798
HLA-DRB1*15:03 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 51 504
HLA-DRB1*13:02 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 402 3969
HLA-DPA1*01:03/DPB1*03:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 75 740
HLA-DPA1*04:01/DPB1*26:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 175 1726
HLA-DRB1*04:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 284 2798
HLA-DRB1*15:01 TLLALHRSYLTPGDSSSG TLLHRSYLTPGDSSSG 365 3596
HLA-DRB1*08:04 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 94 925
HLA-DRB1*14:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 171 1678
HLA-DPA1*02:02/DPB1*05:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 294 2865
HLA-DRB1*12:02 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 434 4195
HLA-DQA1*01:02/DQB1*05:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 109 1052
HLA-DPA1*01:03/DPB1*11:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 94 907
HLA-DPA1*03:01/DPB1*17:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 131 1263
HLA-DRB1*07:01 TLLALHRSYLTPGDSSSGW TLLHRSYLTPGDSSSGW 418 4022
HLA-DPA1*01:03/DPB1*06:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 93 891
HLA-DPA1*01:03/DPB1*14:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 142 1354
HLA-DPA1*01:03/DPB1*11:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 187 1777
HLA-DRB1*07:01 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 95 901
HLA-DRB1*14:04 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 219 2075
HLA-DQA1*01:03/DQB1*05:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 180 1702
HLA-DPA1*03:01/DPB1*03:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 409 3867
HLA-DRB1*11:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 55 520
HLA-DQA1*01:03/DQB1*05:01 TLLALHRSYLTPGDSSSGWT TLLHRSYLTPGDSSSGWT 227 2143
HLA-DPA1*01:03/DPB1*11:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 131 1231
HLA-DPA1*01:03/DPB1*17:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 214 2007
HLA-DPA1*04:01/DPB1*85:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 134 1251
HLA-DPA1*04:01/DPB1*03:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 63 582
HLA-DRB1*12:02 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 460 4237
HLA-DPA1*03:01/DPB1*03:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 130 1195
HLA-DPA1*02:01/DPB1*05:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 271 2481
HLA-DPA1*01:03/DPB1*85:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 159 1454
HLA-DRB1*15:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 30 274
HLA-DPA1*03:01/DPB1*04:02 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 211 1921
HLA-DPA1*03:01/DPB1*105:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 211 1921
HLA-DPA1*01:03/DPB1*06:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 311 2818
HLA-DRB1*04:04 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 83 752
HLA-DRB1*14:01 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 467 4229
HLA-DPA1*02:02/DPB1*05:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 148 1338
HLA-DPA1*01:03/DPB1*06:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 89 804
HLA-DPA1*02:01/DPB1*05:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 179 1617
HLA-DRB1*15:02 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 376 3381
HLA-DRB1*01:02 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 109 979
HLA-DPA1*01:03/DPB1*85:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 136 1220
HLA-DPA1*03:01/DPB1*04:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 145 1300
HLA-DPA1*03:01/DPB1*105:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 145 1300
HLA-DPA1*01:03/DPB1*05:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 184 1649
HLA-DRB1*08:02 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 175 1565
HLA-DPA1*03:01/DPB1*04:02 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 415 3708
HLA-DPA1*03:01/DPB1*105:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 415 3708
HLA-DPA1*03:01/DPB1*17:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 212 1890
HLA-DRB1*11:02 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 55 490
HLA-DRB1*13:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 55 490
HLA-DPA1*04:01/DPB1*17:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 121 1078
HLA-DPA1*01:03/DPB1*11:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 98 873
HLA-DRB1*01:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 193 1719
HLA-DPA1*03:01/DPB1*17:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 152 1353
HLA-DPA1*01:03/DPB1*11:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 80 711
HLA-DRB1*10:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 49 435
HLA-DRB1*16:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 96 840
HLA-DRB1*15:02 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 96 839
HLA-DPA1*01:03/DPB1*85:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 206 1796
HLA-DRB1*16:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 74 644
HLA-DRB1*04:02 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 367 3167
HLA-DPA1*01:03/DPB1*04:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 350 3019
HLA-DPA1*01:03/DPB1*105:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 350 3019
HLA-DPA1*02:02/DPB1*11:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 204 1757
HLA-DPA1*01:03/DPB1*03:01 LPIGINITRFQTLLALH LPIGINITRFQTLLH 325 2796
HLA-DPA1*01:03/DPB1*14:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 136 1165
HLA-DPA1*01:03/DPB1*03:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 145 1241
HLA-DPA1*01:03/DPB1*26:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 203 1734
HLA-DRB1*15:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 24 205
HLA-DPA1*02:01/DPB1*11:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 347 2963
HLA-DPA1*03:01/DPB1*85:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 179 1527
HLA-DRB1*14:04 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 491 4186
HLA-DPA1*01:03/DPB1*06:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 165 1403
HLA-DRB1*13:02 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 169 1430
HLA-DPA1*01:03/DPB1*14:01 PIGINITRFQTLLALHRSYL PIGINITRFQTLLHRSYL 127 1074
HLA-DPA1*01:03/DPB1*14:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 238 2011
HLA-DPA1*01:03/DPB1*85:01 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 145 1223
HLA-DPA1*01:03/DPB1*26:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 250 2103
HLA-DPA1*02:01/DPB1*03:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 397 3339
HLA-DRB1*12:02 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 276 2306
HLA-DRB1*16:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 59 492
HLA-DPA1*01:03/DPB1*11:01 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 89 739
HLA-DPA1*01:03/DPB1*14:01 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 130 1079
HLA-DRB1*07:01 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 246 2035
HLA-DRB1*14:01 FQTLLALHRSYLTPGDSSS FQTLLHRSYLTPGDSSS 279 2304
HLA-DPA1*01:03/DPB1*14:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 166 1368
HLA-DRB1*14:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 158 1301
HLA-DPA1*01:03/DPB1*05:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 83 683
HLA-DPA1*03:01/DPB1*03:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 153 1258
HLA-DRB1*15:02 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 86 707
HLA-DPA1*04:01/DPB1*06:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 165 1356
HLA-DRB1*15:01 FQTLLALHRSYLTPGDSSS FQTLLHRSYLTPGDSSS 60 493
HLA-DQA1*01:03/DQB1*05:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 142 1163
HLA-DPA1*01:03/DPB1*06:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 114 931
HLA-DPA1*01:03/DPB1*17:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 161 1314
HLA-DPA1*01:03/DPB1*14:01 IGINITRFQTLLALHRSYLT IGINITRFQTLLHRSYLT 127 1035
HLA-DPA1*01:03/DPB1*03:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 103 839
HLA-DPA1*04:01/DPB1*04:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 222 1802
HLA-DPA1*04:01/DPB1*105:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 222 1802
HLA-DPA1*04:01/DPB1*11:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 81 657
HLA-DRB1*15:02 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 130 1053
HLA-DRB1*11:04 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 36 291
HLA-DRB1*13:02 FQTLLALHRSYLTPGDSSS FQTLLHRSYLTPGDSSS 332 2680
HLA-DRB1*11:04 FQTLLALHRSYLTPGDSSS FQTLLHRSYLTPGDSSS 76 611
HLA-DPA1*03:01/DPB1*85:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 205 1648
HLA-DPA1*02:02/DPB1*03:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 358 2875
HLA-DPA1*02:02/DPB1*11:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 295 2369
HLA-DRB1*11:04 FQTLLALHRSYLTPGDS FQTLLHRSYLTPGDS 33 265
HLA-DPA1*01:03/DPB1*85:01 IGINITRFQTLLALHRSYLT IGINITRFQTLLHRSYLT 137 1098
HLA-DRB1*10:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 32 256
HLA-DPA1*04:01/DPB1*85:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 118 944
HLA-DPA1*01:03/DPB1*06:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 83 663
HLA-DRB1*11:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 54 431
HLA-DPA1*03:01/DPB1*85:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 281 2242
HLA-DPA1*01:03/DPB1*06:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 76 605
HLA-DPA1*01:03/DPB1*85:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 406 3228
HLA-DPA1*04:01/DPB1*04:02 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 326 2589
HLA-DPA1*04:01/DPB1*105:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 326 2589
HLA-DPA1*03:01/DPB1*05:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 133 1053
HLA-DPA1*03:01/DPB1*03:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 231 1826
HLA-DRB1*10:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 31 245
HLA-DPA1*02:02/DPB1*14:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 333 2629
HLA-DPA1*04:01/DPB1*85:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 199 1571
HLA-DPA1*01:03/DPB1*85:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 321 2524
HLA-DPA1*04:01/DPB1*11:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 94 738
HLA-DPA1*04:01/DPB1*05:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 130 1018
HLA-DQA1*01:03/DQB1*06:02 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 205 1604
HLA-DRB1*11:01 FQTLLALHRSYLTPGDSSS FQTLLHRSYLTPGDSSS 136 1064
HLA-DPA1*04:01/DPB1*14:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 114 891
HLA-DPA1*04:01/DPB1*26:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 148 1156
HLA-DPA1*01:03/DPB1*26:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 229 1786
HLA-DPA1*03:01/DPB1*05:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 74 577
HLA-DRB1*11:02 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 82 639
HLA-DRB1*13:01 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 82 639
HLA-DPA1*03:01/DPB1*11:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 192 1496
HLA-DPA1*01:03/DPB1*85:01 PIGINITRFQTLLALHRSYL PIGINITRFQTLLHRSYL 133 1036
HLA-DRB1*14:01 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 297 2312
HLA-DPA1*02:01/DPB1*14:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 386 2996
HLA-DPA1*01:03/DPB1*11:01 IGINITRFQTLLALHRSYLT IGINITRFQTLLHRSYLT 84 651
HLA-DRB1*11:04 QTLLALHRSYLTPGDSSS QTLLHRSYLTPGDSSS 287 2206
HLA-DPA1*01:03/DPB1*05:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 460 3526
HLA-DPA1*01:03/DPB1*03:01 RFQTLLALHRSYLTPGDSSS RFQTLLHRSYLTPGDSSS 286 2191
HLA-DPA1*01:03/DPB1*26:01 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 210 1607
HLA-DQA1*01:02/DQB1*05:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 89 681
HLA-DRB1*01:02 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 156 1192
HLA-DPA1*04:01/DPB1*05:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 77 587
HLA-DPA1*03:01/DPB1*14:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLLHR 231 1761
HLA-DPA1*02:01/DPB1*14:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 383 2915
HLA-DPA1*02:02/DPB1*05:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 105 797
HLA-DPA1*03:01/DPB1*05:01 FQTLLALHRSYLTPGDSSSG FQTLLHRSYLTPGDSSSG 306 2315
HLA-DRB1*11:01 FQTLLALHRSYLTPGDS FQTLLHRSYLTPGDS 64 483
HLA-DRB1*16:01 GINITRFQTLLALHRSYLTP GINITRFQTLLHRSYLTP 55 415
HLA-DPA1*03:01/DPB1*10:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 271 2037
HLA-DRB1*16:01 QTLLALHRSYLTPGDSSSG QTLLHRSYLTPGDSSSG 373 2800
HLA-DRB1*15:02 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 127 953
HLA-DPA1*01:03/DPB1*17:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 199 1493
HLA-DPA1*04:01/DPB1*03:01 DLPIGINITRFQTLLALHR DLPIGINITRFQTLLHR 132 988
HLA-DPA1*03:01/DPB1*06:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 137 1025
HLA-DPA1*02:02/DPB1*01:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 472 3530
HLA-DPA1*02:02/DPB1*26:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 388 2901
HLA-DRB1*15:02 QTLLALHRSYLTPGDSS QTLLHRSYLTPGDSS 257 1917
HLA-DPA1*01:03/DPB1*11:01 PIGINITRFQTLLALHRSYL PIGINITRFQTLLHRSYL 81 604
HLA-DPA1*03:01/DPB1*04:02 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 106 790
HLA-DPA1*03:01/DPB1*105:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 106 790
HLA-DPA1*04:01/DPB1*11:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 99 737
HLA-DRB1*11:02 FQTLLALHRSYLTPGDSSS FQTLLHRSYLTPGDSSS 113 840
HLA-DRB1*13:01 FQTLLALHRSYLTPGDSSS FQTLLHRSYLTPGDSSS 113 840
HLA-DPA1*01:03/DPB1*17:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 164 1219
HLA-DPA1*02:02/DPB1*85:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 334 2482
HLA-DRB1*14:04 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 202 1501
HLA-DPA1*04:01/DPB1*11:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 138 1024
HLA-DRB1*16:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 62 460
HLA-DRB1*16:01 TLLALHRSYLTPGDSSS TLLHRSYLTPGDSSS 389 2880
HLA-DPA1*04:01/DPB1*05:01 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 494 3655
HLA-DPA1*04:01/DPB1*85:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 117 864
HLA-DPA1*01:03/DPB1*26:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 419 3093
HLA-DPA1*04:01/DPB1*11:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 79 583
HLA-DRB1*01:02 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 105 774
HLA-DPA1*03:01/DPB1*17:01 INITRFQTLLALHRSYLTPG INITRFQTLLHRSYLTPG 112 824
HLA-DPA1*02:01/DPB1*03:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 320 2352
HLA-DPA1*02:01/DPB1*14:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLLHRSY 326 2396
HLA-DPA1*01:03/DPB1*11:01 LVDLPIGINITRFQTLLALH LVDLPIGINITRFQTLLH 255 1874
HLA-DQA1*01:03/DQB1*05:03 QTLLALHRSYLTPGDSSSGW QTLLHRSYLTPGDSSSGW 439 3225
HLA-DPA1*04:01/DPB1*03:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 70 514
HLA-DPA1*02:01/DPB1*03:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 454 3332
HLA-DPA1*03:01/DPB1*03:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 177 1297
HLA-DPA1*02:01/DPB1*17:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 417 3055
HLA-DPA1*01:03/DPB1*10:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 273 1999
HLA-DRB1*08:02 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 156 1142
HLA-DPA1*03:01/DPB1*04:02 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 89 651
HLA-DPA1*03:01/DPB1*105:01 NITRFQTLLALHRSYLTPGD NITRFQTLLHRSYLTPGD 89 651
HLA-DPA1*04:01/DPB1*03:01 TRFQTLLALHRSYLTPGDSS TRFQTLLHRSYLTPGDSS 121 885
HLA-DRB1*15:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLLHRS 29 212
HLA-DPA1*04:01/DPB1*85:01 ITRFQTLLALHRSYLTPGDS ITRFQTLLHRSYLTPGDS 142 1037
HLA-DPA1*01:03/DPB1*06:01