Summary

This strain contains 23 protein-level mutations:

  • 8 mutations in Spike protein: T95I, G142D, E154K, L452R, E484Q, D614G, P681R, Q1071H
  • 2 mutations in N protein: R203M, D377Y
  • 1 mutation in M protein: I82S
  • 1 mutation in NS3 protein: S26L
  • 1 mutation in NS7a protein: V82A
  • 2 mutations in NS9c protein: G50W, C68Y
  • 1 mutation in NSP3 protein: T749I
  • 1 mutation in NSP6 protein: T77A
  • 1 mutation in NSP12 protein: P323L
  • 2 mutations in NSP13 protein: G206C, M429I
  • 3 mutations in NSP15 protein: P65S, K259R, S261A

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

T95I

Reference  VSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    VSGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSKTQSLLIV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*04:04 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1887 219
HLA-DRB1*04:04 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 2607 321
HLA-DRB1*04:04 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1362 177
HLA-DRB1*04:04 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 2806 366
HLA-DRB1*13:02 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 2332 311
HLA-DRB1*13:02 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 1733 238
HLA-DRB1*04:04 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 2315 318
HLA-DRB1*13:02 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1041 153
HLA-DRB1*11:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 740 114
HLA-DRB1*11:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 726 112
HLA-DRB1*11:04 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 756 117
HLA-DRB1*11:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1096 170
HLA-DRB1*11:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 996 155
HLA-DRB1*13:02 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 991 155
HLA-DRB1*11:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 971 153
HLA-DRB1*11:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 950 151
HLA-DRB1*13:02 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 1803 289
HLA-DRB1*11:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 910 146
HLA-DRB1*11:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1053 170
HLA-DRB1*11:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 983 159
HLA-DRB1*11:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 840 136
HLA-DRB1*11:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 829 135
HLA-DRB1*11:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 674 110
HLA-DRB1*11:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 863 142
HLA-DRB1*04:04 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 1898 315
HLA-DRB1*11:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 1024 171
HLA-DRB1*11:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 377 63
HLA-DRB1*11:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 669 113
HLA-DRB1*13:02 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1495 253
HLA-DRB1*11:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 719 122
HLA-DRB1*11:04 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1682 289
HLA-DRB1*13:02 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1304 233
HLA-DRB1*11:04 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 817 146
HLA-DRB1*11:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 414 74
HLA-DRB1*11:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 398 72
HLA-DRB1*11:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 429 78
HLA-DRB1*13:02 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 1384 253
HLA-DRB1*11:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 435 80
HLA-DRB1*11:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 402 74
HLA-DRB1*11:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 281 52
HLA-DRB1*11:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 302 56
HLA-DRB1*04:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1640 305
HLA-DRB1*13:02 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 1891 356
HLA-DRB1*08:04 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1336 252
HLA-DRB1*11:02 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 1206 229
HLA-DRB1*13:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 1206 229
HLA-DRB1*11:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 476 91
HLA-DRB1*11:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 475 92
HLA-DRB1*11:02 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1246 243
HLA-DRB1*13:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1246 243
HLA-DRB1*11:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 468 92
HLA-DRB1*11:02 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 503 99
HLA-DRB1*13:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 503 99
HLA-DRB1*11:02 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 1465 289
HLA-DRB1*13:01 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 1465 289
HLA-DRB1*11:02 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 508 101
HLA-DRB1*13:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 508 101
HLA-DRB1*08:04 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 2141 427
HLA-DRB1*11:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1363 272
HLA-DRB1*11:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 1619 324
HLA-DRB1*04:04 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 1788 361
HLA-DRB1*11:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 1105 224
HLA-DRB1*11:04 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1043 212
HLA-DPA1*03:01/DPB1*02:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 749 153
HLA-DRB1*11:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1159 237
HLA-DRB1*04:04 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1322 271
HLA-DRB1*11:02 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1536 315
HLA-DRB1*13:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1536 315
HLA-DRB1*13:02 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1309 269
HLA-DRB1*04:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 2393 492
HLA-DQA1*01:02/DQB1*05:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1288 267
HLA-DRB1*11:04 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1553 322
HLA-DRB1*08:04 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1258 261
HLA-DRB1*08:04 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1568 326
HLA-DQA1*01:02/DQB1*05:01 DGVYFASTEKSNIIRGWI DGVYFASIEKSNIIRGWI 1056 220
HLA-DRB1*11:04 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1087 227
HLA-DPA1*03:01/DPB1*02:01 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 1008 212
HLA-DRB1*08:04 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1918 407
HLA-DPA1*03:01/DPB1*04:02 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 2253 479
HLA-DPA1*03:01/DPB1*105:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 2253 479
HLA-DPA1*03:01/DPB1*04:02 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1635 349
HLA-DPA1*03:01/DPB1*105:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1635 349
HLA-DRB1*08:04 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 1128 241
HLA-DRB1*13:02 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1365 292
HLA-DQA1*01:02/DQB1*06:02 NDGVYFASTEKSNII NDGVYFASIEKSNII 774 166
HLA-DPA1*03:01/DPB1*04:02 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 1445 310
HLA-DPA1*03:01/DPB1*105:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 1445 310
HLA-DPA1*03:01/DPB1*04:02 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 1341 288
HLA-DPA1*03:01/DPB1*105:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 1341 288
HLA-DRB1*08:04 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 1886 407
HLA-DRB1*11:02 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 931 201
HLA-DRB1*13:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 931 201
HLA-DRB1*11:02 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 495 107
HLA-DRB1*13:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 495 107
HLA-DRB1*11:02 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1109 242
HLA-DRB1*13:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1109 242
HLA-DQA1*01:02/DQB1*06:02 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 870 190
HLA-DRB1*13:02 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 691 151
HLA-DRB1*11:04 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 529 116
HLA-DRB1*08:02 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1627 358
HLA-DRB1*11:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 1262 278
HLA-DQA1*01:02/DQB1*06:02 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 725 160
HLA-DQA1*01:02/DQB1*06:02 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 779 173
HLA-DRB1*11:02 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 886 197
HLA-DRB1*13:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 886 197
HLA-DQA1*01:02/DQB1*06:02 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 948 211
HLA-DQA1*01:02/DQB1*05:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 584 130
HLA-DQA1*01:02/DQB1*05:01 VYFASTEKSNIIRGWIFG VYFASIEKSNIIRGWIFG 946 211
HLA-DRB1*11:04 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 1384 309
HLA-DRB1*08:02 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1849 413
HLA-DPA1*03:01/DPB1*04:02 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1537 344
HLA-DPA1*03:01/DPB1*105:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1537 344
HLA-DRB1*11:04 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1174 263
HLA-DRB1*13:02 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 1231 276
HLA-DRB1*11:02 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 752 170
HLA-DRB1*13:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 752 170
HLA-DRB1*10:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 840 191
HLA-DRB1*04:04 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1700 387
HLA-DQA1*01:02/DQB1*06:02 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 839 191
HLA-DPA1*03:01/DPB1*02:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 697 159
HLA-DPA1*03:01/DPB1*04:02 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1492 342
HLA-DPA1*03:01/DPB1*105:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1492 342
HLA-DRB1*11:04 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1396 320
HLA-DRB1*13:02 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1361 312
HLA-DQA1*01:02/DQB1*06:02 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 807 185
HLA-DRB1*11:04 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1501 345
HLA-DQA1*01:02/DQB1*06:02 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 787 181
HLA-DPA1*03:01/DPB1*04:02 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 2144 494
HLA-DPA1*03:01/DPB1*105:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 2144 494
HLA-DPA1*03:01/DPB1*04:02 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1630 376
HLA-DPA1*03:01/DPB1*105:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1630 376
HLA-DRB1*13:02 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1416 327
HLA-DQA1*01:02/DQB1*05:01 GVYFASTEKSNIIRGWIF GVYFASIEKSNIIRGWIF 775 179
HLA-DQA1*01:02/DQB1*06:02 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 622 144
HLA-DPA1*03:01/DPB1*04:02 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1816 421
HLA-DPA1*03:01/DPB1*105:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1816 421
HLA-DPA1*03:01/DPB1*04:01 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 1728 401
HLA-DRB1*04:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1318 308
HLA-DQA1*01:02/DQB1*06:02 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 751 176
HLA-DPA1*03:01/DPB1*04:02 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1589 373
HLA-DPA1*03:01/DPB1*105:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1589 373
HLA-DRB1*08:02 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 2078 492
HLA-DPA1*03:01/DPB1*02:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 502 119
HLA-DPA1*03:01/DPB1*02:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 518 123
HLA-DQA1*01:02/DQB1*05:01 NDGVYFASTEKSNIIRGW NDGVYFASIEKSNIIRGW 1080 257
HLA-DPA1*03:01/DPB1*04:02 NDGVYFASTEKSNII NDGVYFASIEKSNII 1458 347
HLA-DPA1*03:01/DPB1*105:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 1458 347
HLA-DQA1*01:02/DQB1*06:02 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 872 208
HLA-DRB1*13:02 YFASTEKSNIIRGWIFGTT YFASIEKSNIIRGWIFGTT 1666 398
HLA-DPA1*03:01/DPB1*04:02 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1360 325
HLA-DPA1*03:01/DPB1*105:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1360 325
HLA-DPA1*03:01/DPB1*02:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 573 137
HLA-DQA1*01:02/DQB1*06:02 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 1374 329
HLA-DRB1*11:01 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 610 147
HLA-DRB1*11:02 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1026 248
HLA-DRB1*13:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1026 248
HLA-DQA1*01:02/DQB1*06:02 NDGVYFASTEKSNIIRGW NDGVYFASIEKSNIIRGW 1370 332
HLA-DQA1*01:02/DQB1*05:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 568 138
HLA-DQA1*01:02/DQB1*05:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 847 206
HLA-DQA1*01:02/DQB1*06:02 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 1006 245
HLA-DRB1*11:02 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 1018 248
HLA-DRB1*13:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 1018 248
HLA-DQA1*01:02/DQB1*06:02 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 930 228
HLA-DRB1*11:02 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1185 291
HLA-DRB1*13:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1185 291
HLA-DQA1*01:02/DQB1*05:01 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 602 148
HLA-DRB1*11:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 1567 386
HLA-DRB1*13:02 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1335 330
HLA-DPA1*03:01/DPB1*04:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 1173 290
HLA-DRB1*11:02 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 517 128
HLA-DRB1*13:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 517 128
HLA-DRB1*11:02 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1453 361
HLA-DRB1*13:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1453 361
HLA-DRB1*11:04 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1428 356
HLA-DRB1*04:04 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1793 447
HLA-DRB1*11:04 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1590 397
HLA-DPA1*03:01/DPB1*04:02 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1644 411
HLA-DPA1*03:01/DPB1*105:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1644 411
HLA-DPA1*03:01/DPB1*04:02 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 1331 333
HLA-DPA1*03:01/DPB1*105:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 1331 333
HLA-DPA1*03:01/DPB1*02:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 555 139
HLA-DPA1*03:01/DPB1*02:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 471 118
HLA-DQA1*01:02/DQB1*05:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 577 145
HLA-DRB1*10:01 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 1238 312
HLA-DRB1*13:02 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1316 332
HLA-DRB1*11:04 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 1382 349
HLA-DPA1*03:01/DPB1*02:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 488 124
HLA-DPA1*03:01/DPB1*02:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 751 192
HLA-DQA1*01:02/DQB1*06:02 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 919 235
HLA-DQA1*01:02/DQB1*06:02 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 1347 345
HLA-DRB1*11:02 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 1006 258
HLA-DRB1*13:01 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 1006 258
HLA-DRB1*08:02 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1418 365
HLA-DRB1*11:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 990 255
HLA-DQA1*01:02/DQB1*06:02 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 899 232
HLA-DQA1*01:02/DQB1*06:02 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 1107 286
HLA-DRB1*10:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 503 130
HLA-DQA1*01:02/DQB1*05:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 529 137
HLA-DRB1*11:02 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 633 164
HLA-DRB1*13:01 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 633 164
HLA-DPA1*03:01/DPB1*04:02 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 1028 267
HLA-DPA1*03:01/DPB1*105:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 1028 267
HLA-DQA1*01:02/DQB1*06:02 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 850 221
HLA-DPA1*03:01/DPB1*04:02 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1570 409
HLA-DPA1*03:01/DPB1*105:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1570 409
HLA-DQA1*01:02/DQB1*05:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 475 124
HLA-DPA1*03:01/DPB1*04:02 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 1483 388
HLA-DPA1*03:01/DPB1*105:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 1483 388
HLA-DQA1*01:02/DQB1*05:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 706 185
HLA-DPA1*03:01/DPB1*04:02 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 1094 287
HLA-DPA1*03:01/DPB1*105:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 1094 287
HLA-DRB1*08:02 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1536 403
HLA-DPA1*03:01/DPB1*02:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 616 162
HLA-DQA1*01:02/DQB1*06:02 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 1497 394
HLA-DPA1*03:01/DPB1*02:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 615 162
HLA-DQA1*01:02/DQB1*05:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 770 203
HLA-DRB1*11:04 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 794 210
HLA-DPA1*03:01/DPB1*02:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 525 139
HLA-DQA1*01:02/DQB1*06:02 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 1060 281
HLA-DRB1*11:02 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 556 148
HLA-DRB1*13:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 556 148
HLA-DRB1*13:02 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 713 190
HLA-DRB1*11:02 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 634 169
HLA-DRB1*13:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 634 169
HLA-DPA1*03:01/DPB1*02:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 360 96
HLA-DPA1*03:01/DPB1*02:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 371 99
HLA-DPA1*03:01/DPB1*02:01 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 1142 305
HLA-DQA1*01:02/DQB1*05:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 438 117
HLA-DPA1*03:01/DPB1*04:02 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1376 368
HLA-DPA1*03:01/DPB1*105:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1376 368
HLA-DPA1*03:01/DPB1*04:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 781 209
HLA-DRB1*11:02 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1050 281
HLA-DRB1*13:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1050 281
HLA-DRB1*13:02 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 672 180
HLA-DQA1*01:02/DQB1*05:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 637 171
HLA-DQA1*01:02/DQB1*05:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 528 142
HLA-DRB1*11:02 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1606 434
HLA-DRB1*13:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1606 434
HLA-DPA1*03:01/DPB1*04:02 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 1150 311
HLA-DPA1*03:01/DPB1*105:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 1150 311
HLA-DRB1*11:02 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 562 152
HLA-DRB1*13:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 562 152
HLA-DQA1*01:02/DQB1*06:02 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 1209 327
HLA-DPA1*03:01/DPB1*04:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 972 263
HLA-DPA1*03:01/DPB1*01:01 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 874 237
HLA-DRB1*13:02 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 719 195
HLA-DRB1*08:04 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 1788 485
HLA-DRB1*11:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 802 218
HLA-DRB1*10:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 717 195
HLA-DRB1*13:02 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 1066 290
HLA-DQA1*01:02/DQB1*05:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 491 134
HLA-DQA1*01:02/DQB1*06:02 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 1398 382
HLA-DPA1*03:01/DPB1*04:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 1244 340
HLA-DPA1*03:01/DPB1*02:01 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 867 237
HLA-DRB1*04:04 YFASTEKSNIIRGWIFGTT YFASIEKSNIIRGWIFGTT 1783 488
HLA-DQA1*01:02/DQB1*06:02 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1117 306
HLA-DRB1*13:02 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 814 223
HLA-DQA1*01:02/DQB1*05:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 586 161
HLA-DPA1*03:01/DPB1*02:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 429 118
HLA-DRB1*11:04 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 464 128
HLA-DPA1*03:01/DPB1*02:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 612 169
HLA-DPA1*03:01/DPB1*05:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 1396 386
HLA-DPA1*03:01/DPB1*02:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 600 166
HLA-DRB1*11:04 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 715 198
HLA-DRB1*16:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1758 487
HLA-DPA1*03:01/DPB1*04:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 1078 299
HLA-DRB1*11:02 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 555 154
HLA-DRB1*13:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 555 154
HLA-DRB1*11:04 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 1059 294
HLA-DPA1*03:01/DPB1*01:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 658 183
HLA-DRB1*08:04 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 1501 418
HLA-DRB1*13:02 FASTEKSNIIRGWIFGTTLD FASIEKSNIIRGWIFGTTLD 1335 372
HLA-DRB1*13:02 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 645 180
HLA-DPA1*03:01/DPB1*02:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 588 165
HLA-DPA1*03:01/DPB1*01:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 520 146
HLA-DRB1*11:02 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 705 198
HLA-DRB1*13:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 705 198
HLA-DPA1*02:01/DPB1*01:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 1741 489
HLA-DQA1*01:03/DQB1*05:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1121 315
HLA-DQA1*01:02/DQB1*05:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 382 108
HLA-DPA1*03:01/DPB1*01:01 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 710 201
HLA-DPA1*03:01/DPB1*05:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 1340 380
HLA-DPA1*03:01/DPB1*04:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 892 253
HLA-DPA1*03:01/DPB1*02:01 NDGVYFASTEKSNIIRGW NDGVYFASIEKSNIIRGW 1283 365
HLA-DRB1*10:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 615 175
HLA-DRB1*11:02 YFASTEKSNIIRGWIFGTT YFASIEKSNIIRGWIFGTT 1196 341
HLA-DRB1*13:01 YFASTEKSNIIRGWIFGTT YFASIEKSNIIRGWIFGTT 1196 341
HLA-DQA1*01:02/DQB1*05:03 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1315 375
HLA-DRB1*01:02 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1276 364
HLA-DQA1*01:02/DQB1*05:01 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 939 268
HLA-DRB1*11:04 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1037 296
HLA-DPA1*03:01/DPB1*04:02 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 1403 401
HLA-DPA1*03:01/DPB1*105:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 1403 401
HLA-DPA1*03:01/DPB1*04:02 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 738 211
HLA-DPA1*03:01/DPB1*105:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 738 211
HLA-DRB1*08:04 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1530 438
HLA-DRB1*01:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 775 222
HLA-DRB1*11:02 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1176 337
HLA-DRB1*13:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1176 337
HLA-DQA1*01:02/DQB1*06:02 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 802 230
HLA-DRB1*11:04 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 732 210
HLA-DPA1*02:01/DPB1*01:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 1229 353
HLA-DRB1*11:04 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1323 380
HLA-DPA1*03:01/DPB1*02:01 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 870 250
HLA-DQA1*01:02/DQB1*05:03 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 940 271
HLA-DQA1*01:02/DQB1*06:02 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 849 245
HLA-DRB1*11:04 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 786 227
HLA-DQA1*01:02/DQB1*05:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 429 124
HLA-DPA1*03:01/DPB1*04:02 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1612 466
HLA-DPA1*03:01/DPB1*105:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1612 466
HLA-DRB1*01:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 339 98
HLA-DPA1*02:01/DPB1*01:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1409 408
HLA-DQA1*01:02/DQB1*06:02 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 839 243
HLA-DQA1*01:03/DQB1*05:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 1114 323
HLA-DRB1*08:04 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1138 330
HLA-DRB1*11:04 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1593 462
HLA-DRB1*13:02 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1430 415
HLA-DRB1*13:02 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1421 413
HLA-DPA1*01:03/DPB1*01:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1063 309
HLA-DPA1*03:01/DPB1*02:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 313 91
HLA-DPA1*02:01/DPB1*01:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 1166 339
HLA-DPA1*03:01/DPB1*02:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 471 137
HLA-DQA1*01:02/DQB1*05:03 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 1590 464
HLA-DRB1*11:04 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 633 185
HLA-DQA1*01:02/DQB1*06:02 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 612 179
HLA-DPA1*03:01/DPB1*02:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 563 165
HLA-DPA1*03:01/DPB1*02:01 DGVYFASTEKSNIIRGWI DGVYFASIEKSNIIRGWI 1339 393
HLA-DPA1*03:01/DPB1*04:02 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 735 216
HLA-DPA1*03:01/DPB1*105:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 735 216
HLA-DQA1*01:02/DQB1*06:02 DGVYFASTEKSNIIRGWI DGVYFASIEKSNIIRGWI 1344 395
HLA-DQA1*01:02/DQB1*05:03 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 935 275
HLA-DRB1*13:02 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 690 203
HLA-DRB1*01:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 588 173
HLA-DQA1*01:02/DQB1*05:03 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1605 473
HLA-DPA1*03:01/DPB1*02:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 529 156
HLA-DPA1*02:01/DPB1*01:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1203 355
HLA-DPA1*03:01/DPB1*01:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 437 129
HLA-DPA1*03:01/DPB1*04:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 989 292
HLA-DPA1*03:01/DPB1*05:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 989 292
HLA-DQA1*01:02/DQB1*05:03 DGVYFASTEKSNIIRGWI DGVYFASIEKSNIIRGWI 1541 455
HLA-DRB1*11:02 ASTEKSNIIRGWIFGT ASIEKSNIIRGWIFGT 1473 435
HLA-DRB1*13:01 ASTEKSNIIRGWIFGT ASIEKSNIIRGWIFGT 1473 435
HLA-DPA1*03:01/DPB1*04:02 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1540 455
HLA-DPA1*03:01/DPB1*105:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1540 455
HLA-DQA1*01:02/DQB1*05:01 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 917 271
HLA-DPA1*01:03/DPB1*01:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1097 325
HLA-DPA1*03:01/DPB1*02:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 634 188
HLA-DPA1*03:01/DPB1*02:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 576 171
HLA-DRB1*11:02 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 591 176
HLA-DRB1*13:01 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 591 176
HLA-DPA1*03:01/DPB1*04:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 539 161
HLA-DQA1*01:02/DQB1*05:03 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1024 306
HLA-DQA1*01:02/DQB1*05:03 NDGVYFASTEKSNIIRGW NDGVYFASIEKSNIIRGW 1489 445
HLA-DPA1*03:01/DPB1*01:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 692 207
HLA-DPA1*03:01/DPB1*04:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 658 197
HLA-DPA1*03:01/DPB1*01:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 571 171
HLA-DPA1*03:01/DPB1*04:02 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 663 199
HLA-DPA1*03:01/DPB1*105:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 663 199
HLA-DPA1*01:03/DPB1*01:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 1052 316
HLA-DQA1*01:02/DQB1*05:03 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1149 346
HLA-DQA1*01:02/DQB1*05:03 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1079 325
HLA-DQA1*01:03/DQB1*05:01 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 1257 379
HLA-DPA1*03:01/DPB1*04:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 941 284
HLA-DRB1*11:04 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 768 232
HLA-DQA1*01:02/DQB1*06:02 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 890 269
HLA-DPA1*01:03/DPB1*01:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1019 308
HLA-DPA1*03:01/DPB1*04:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 635 192
HLA-DRB1*11:02 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1533 465
HLA-DRB1*13:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1533 465
HLA-DPA1*03:01/DPB1*01:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 364 111
HLA-DPA1*02:01/DPB1*01:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 1304 398
HLA-DPA1*03:01/DPB1*01:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 570 174
HLA-DPA1*02:01/DPB1*01:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 1421 434
HLA-DPA1*03:01/DPB1*02:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 265 81
HLA-DPA1*02:01/DPB1*01:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1278 391
HLA-DPA1*03:01/DPB1*04:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 960 294
HLA-DPA1*02:02/DPB1*01:01 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 1410 432
HLA-DPA1*03:01/DPB1*02:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 545 167
HLA-DPA1*03:01/DPB1*04:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 658 202
HLA-DPA1*03:01/DPB1*01:01 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 775 238
HLA-DQA1*01:02/DQB1*05:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 384 118
HLA-DRB1*08:02 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 937 288
HLA-DQA1*01:02/DQB1*06:02 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 566 174
HLA-DPA1*03:01/DPB1*01:01 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 696 214
HLA-DQA1*01:02/DQB1*06:02 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 813 250
HLA-DPA1*01:03/DPB1*01:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 997 307
HLA-DRB1*16:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 1002 309
HLA-DPA1*03:01/DPB1*02:01 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 874 270
HLA-DPA1*03:01/DPB1*01:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 398 123
HLA-DPA1*03:01/DPB1*02:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 446 138
HLA-DQA1*01:02/DQB1*05:03 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1325 410
HLA-DPA1*03:01/DPB1*04:02 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 588 182
HLA-DPA1*03:01/DPB1*105:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 588 182
HLA-DPA1*03:01/DPB1*05:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1019 316
HLA-DRB1*11:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1138 353
HLA-DPA1*03:01/DPB1*05:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 1105 343
HLA-DPA1*03:01/DPB1*04:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 451 140
HLA-DQA1*01:02/DQB1*05:01 YFASTEKSNIIRGWIFGT YFASIEKSNIIRGWIFGT 795 247
HLA-DQA1*01:03/DQB1*05:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 1399 435
HLA-DPA1*02:01/DPB1*01:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1478 460
HLA-DQA1*01:03/DQB1*05:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 976 304
HLA-DPA1*03:01/DPB1*04:02 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 789 246
HLA-DPA1*03:01/DPB1*105:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 789 246
HLA-DPA1*03:01/DPB1*05:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 942 294
HLA-DPA1*03:01/DPB1*04:01 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 1493 466
HLA-DPA1*01:03/DPB1*01:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 861 269
HLA-DRB1*11:02 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 710 222
HLA-DRB1*13:01 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 710 222
HLA-DPA1*03:01/DPB1*02:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 534 167
HLA-DPA1*03:01/DPB1*04:01 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 1186 371
HLA-DPA1*03:01/DPB1*02:01 GVYFASTEKSNIIRGWIF GVYFASIEKSNIIRGWIF 1223 383
HLA-DPA1*01:03/DPB1*01:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 916 287
HLA-DQA1*01:02/DQB1*05:03 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 673 211
HLA-DPA1*03:01/DPB1*04:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 936 294
HLA-DQA1*01:02/DQB1*06:02 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 627 197
HLA-DPA1*03:01/DPB1*01:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 471 148
HLA-DPA1*03:01/DPB1*01:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 407 128
HLA-DPA1*03:01/DPB1*01:01 NDGVYFASTEKSNIIRGW NDGVYFASIEKSNIIRGW 896 282
HLA-DPA1*02:02/DPB1*01:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 1185 373
HLA-DPA1*03:01/DPB1*01:01 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 797 251
HLA-DPA1*03:01/DPB1*05:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1003 316
HLA-DPA1*03:01/DPB1*04:02 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 1221 385
HLA-DPA1*03:01/DPB1*105:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 1221 385
HLA-DQA1*01:03/DQB1*05:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 1389 438
HLA-DPA1*03:01/DPB1*01:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 428 135
HLA-DPA1*03:01/DPB1*04:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 646 204
HLA-DPA1*02:01/DPB1*01:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 1073 339
HLA-DPA1*03:01/DPB1*04:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 664 210
HLA-DPA1*03:01/DPB1*01:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 480 152
HLA-DPA1*01:03/DPB1*01:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1146 363
HLA-DPA1*02:01/DPB1*01:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1297 411
HLA-DPA1*03:01/DPB1*02:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 331 105
HLA-DQA1*01:02/DQB1*06:02 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 1061 337
HLA-DPA1*03:01/DPB1*02:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 362 115
HLA-DPA1*01:03/DPB1*01:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 1123 357
HLA-DRB1*14:04 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1104 351
HLA-DPA1*03:01/DPB1*04:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 786 250
HLA-DPA1*03:01/DPB1*01:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 503 160
HLA-DQA1*01:03/DQB1*05:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1150 366
HLA-DPA1*01:03/DPB1*01:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 851 271
HLA-DPA1*03:01/DPB1*01:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 395 126
HLA-DPA1*03:01/DPB1*04:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 498 159
HLA-DPA1*03:01/DPB1*04:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 692 221
HLA-DPA1*03:01/DPB1*05:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1052 336
HLA-DPA1*03:01/DPB1*02:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 266 85
HLA-DPA1*03:01/DPB1*04:01 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 1342 429
HLA-DPA1*02:01/DPB1*01:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1173 375
HLA-DQA1*01:02/DQB1*05:03 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1442 461
HLA-DPA1*03:01/DPB1*04:02 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 803 257
HLA-DPA1*03:01/DPB1*105:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 803 257
HLA-DRB1*08:04 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 1281 410
HLA-DRB1*13:02 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1315 421
HLA-DQA1*01:02/DQB1*05:03 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 930 298
HLA-DPA1*03:01/DPB1*05:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 904 290
HLA-DPA1*03:01/DPB1*02:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 526 169
HLA-DPA1*03:01/DPB1*05:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1001 322
HLA-DPA1*02:01/DPB1*01:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1397 450
HLA-DPA1*03:01/DPB1*05:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 931 300
HLA-DPA1*01:03/DPB1*01:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 815 263
HLA-DPA1*01:03/DPB1*01:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 858 277
HLA-DRB1*11:04 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 1245 402
HLA-DPA1*01:03/DPB1*01:01 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 1424 460
HLA-DPA1*03:01/DPB1*04:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 777 251
HLA-DPA1*03:01/DPB1*02:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 229 74
HLA-DPA1*03:01/DPB1*01:01 DGVYFASTEKSNIIRGWI DGVYFASIEKSNIIRGWI 937 303
HLA-DPA1*03:01/DPB1*02:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 541 175
HLA-DRB1*11:02 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 463 150
HLA-DRB1*13:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 463 150
HLA-DQA1*01:02/DQB1*05:03 GVYFASTEKSNIIRGWIF GVYFASIEKSNIIRGWIF 1505 488
HLA-DQA1*01:02/DQB1*05:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 404 131
HLA-DPA1*03:01/DPB1*01:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 345 112
HLA-DQA1*01:02/DQB1*05:03 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 1268 412
HLA-DRB1*14:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 1351 439
HLA-DQA1*01:03/DQB1*05:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 889 289
HLA-DRB1*04:04 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 772 251
HLA-DPA1*04:01/DPB1*04:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 1473 479
HLA-DPA1*03:01/DPB1*05:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 915 298
HLA-DQA1*01:03/DQB1*05:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1003 327
HLA-DPA1*03:01/DPB1*04:01 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 1193 389
HLA-DPA1*01:03/DPB1*01:01 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 1425 465
HLA-DPA1*03:01/DPB1*01:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 576 188
HLA-DPA1*02:01/DPB1*01:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 928 303
HLA-DPA1*03:01/DPB1*04:02 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 594 194
HLA-DPA1*03:01/DPB1*105:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 594 194
HLA-DRB1*01:02 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 817 267
HLA-DPA1*01:03/DPB1*01:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 975 319
HLA-DRB1*14:04 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1460 478
HLA-DPA1*03:01/DPB1*04:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 406 133
HLA-DQA1*01:03/DQB1*05:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1050 344
HLA-DPA1*03:01/DPB1*01:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 469 154
HLA-DRB1*14:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 770 253
HLA-DPA1*03:01/DPB1*04:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 365 120
HLA-DPA1*02:01/DPB1*01:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1289 424
HLA-DPA1*01:03/DPB1*01:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 838 276
HLA-DPA1*03:01/DPB1*05:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1093 360
HLA-DPA1*03:01/DPB1*05:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 786 259
HLA-DRB1*11:04 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 1478 488
HLA-DRB1*08:04 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 902 298
HLA-DPA1*03:01/DPB1*04:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 569 188
HLA-DPA1*03:01/DPB1*01:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 475 157
HLA-DRB1*14:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1158 383
HLA-DPA1*03:01/DPB1*04:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 441 146
HLA-DRB1*11:04 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 782 259
HLA-DPA1*03:01/DPB1*02:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 477 158
HLA-DPA1*01:03/DPB1*01:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 996 330
HLA-DRB1*11:02 FASTEKSNIIRGWIFGTTL FASIEKSNIIRGWIFGTTL 1346 446
HLA-DRB1*13:01 FASTEKSNIIRGWIFGTTL FASIEKSNIIRGWIFGTTL 1346 446
HLA-DPA1*03:01/DPB1*04:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 777 258
HLA-DQA1*01:03/DQB1*05:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 858 285
HLA-DPA1*03:01/DPB1*01:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 596 198
HLA-DPA1*04:01/DPB1*02:01 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 972 323
HLA-DPA1*01:03/DPB1*01:01 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 1363 453
HLA-DQA1*01:02/DQB1*05:03 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 776 258
HLA-DPA1*03:01/DPB1*02:01 PVLPFNDGVYFASTEKSN PVLPFNDGVYFASIEKSN 1030 343
HLA-DPA1*03:01/DPB1*01:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 393 131
HLA-DPA1*03:01/DPB1*05:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 996 332
HLA-DPA1*01:03/DPB1*01:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 893 298
HLA-DPA1*03:01/DPB1*02:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 629 210
HLA-DQA1*01:02/DQB1*05:03 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 1305 436
HLA-DPA1*03:01/DPB1*05:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1025 343
HLA-DRB1*11:02 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 735 246
HLA-DRB1*13:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 735 246
HLA-DPA1*03:01/DPB1*04:01 VLPFNDGVYFASTEK VLPFNDGVYFASIEK 893 299
HLA-DPA1*03:01/DPB1*01:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 370 124
HLA-DQA1*01:03/DQB1*05:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 922 309
HLA-DPA1*03:01/DPB1*04:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 722 242
HLA-DRB1*14:04 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 736 247
HLA-DPA1*02:02/DPB1*01:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 1110 373
HLA-DPA1*03:01/DPB1*02:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 363 122
HLA-DQA1*01:02/DQB1*05:03 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 604 203
HLA-DQA1*01:02/DQB1*05:03 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1163 391
HLA-DPA1*03:01/DPB1*04:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 458 154
HLA-DQA1*01:02/DQB1*06:02 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 642 216
HLA-DQA1*01:03/DQB1*06:02 NDGVYFASTEKSNII NDGVYFASIEKSNII 774 261
HLA-DRB1*11:04 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 962 325
HLA-DRB1*14:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1085 367
HLA-DPA1*03:01/DPB1*04:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 771 261
HLA-DQA1*01:03/DQB1*06:02 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 898 304
HLA-DRB1*04:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1246 422
HLA-DPA1*03:01/DPB1*01:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 487 165
HLA-DPA1*02:01/DPB1*01:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 1145 388
HLA-DPA1*03:01/DPB1*05:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 810 275
HLA-DPA1*03:01/DPB1*01:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 559 190
HLA-DQA1*01:03/DQB1*05:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 743 253
HLA-DRB1*13:02 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 722 246
HLA-DPA1*03:01/DPB1*04:02 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 493 168
HLA-DPA1*03:01/DPB1*105:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 493 168
HLA-DPA1*03:01/DPB1*04:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 337 115
HLA-DQA1*01:02/DQB1*06:02 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 624 213
HLA-DQA1*01:02/DQB1*05:03 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 831 284
HLA-DPA1*03:01/DPB1*05:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1012 346
HLA-DPA1*03:01/DPB1*05:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 927 317
HLA-DPA1*03:01/DPB1*04:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 754 258
HLA-DPA1*03:01/DPB1*01:01 GVYFASTEKSNIIRGWIF GVYFASIEKSNIIRGWIF 900 308
HLA-DRB1*01:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 590 202
HLA-DPA1*03:01/DPB1*05:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1022 350
HLA-DPA1*02:01/DPB1*01:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 946 324
HLA-DPA1*03:01/DPB1*05:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 925 318
HLA-DRB1*01:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 427 147
HLA-DPA1*03:01/DPB1*01:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 482 166
HLA-DPA1*02:02/DPB1*01:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 961 331
HLA-DRB1*13:02 STEKSNIIRGWIFGT SIEKSNIIRGWIFGT 1097 378
HLA-DPA1*03:01/DPB1*01:01 PVLPFNDGVYFASTEKSN PVLPFNDGVYFASIEKSN 979 338
HLA-DPA1*03:01/DPB1*01:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 469 162
HLA-DQA1*01:03/DQB1*05:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 822 284
HLA-DQA1*01:02/DQB1*05:03 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 767 265
HLA-DPA1*03:01/DPB1*04:02 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 819 283
HLA-DPA1*03:01/DPB1*105:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 819 283
HLA-DPA1*01:03/DPB1*01:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 613 212
HLA-DPA1*01:03/DPB1*01:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 688 238
HLA-DPA1*01:03/DPB1*01:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 572 198
HLA-DRB1*11:01 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 936 324
HLA-DRB1*08:04 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 1077 373
HLA-DPA1*03:01/DPB1*04:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 658 228
HLA-DQA1*01:03/DQB1*05:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1070 371
HLA-DPA1*03:01/DPB1*04:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 620 215
HLA-DPA1*04:01/DPB1*05:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1054 366
HLA-DPA1*04:01/DPB1*04:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 1077 374
HLA-DRB1*14:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 817 284
HLA-DRB1*08:02 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1146 399
HLA-DPA1*03:01/DPB1*02:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 201 70
HLA-DRB1*11:02 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 1114 388
HLA-DRB1*13:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 1114 388
HLA-DPA1*03:01/DPB1*05:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 795 277
HLA-DQA1*01:03/DQB1*06:02 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 946 330
HLA-DPA1*03:01/DPB1*01:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 372 130
HLA-DRB1*14:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 949 332
HLA-DPA1*04:01/DPB1*05:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1057 370
HLA-DPA1*03:01/DPB1*04:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 494 173
HLA-DPA1*03:01/DPB1*02:01 NPVLPFNDGVYFASTEKS NPVLPFNDGVYFASIEKS 1001 351
HLA-DQA1*01:02/DQB1*05:01 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 938 329
HLA-DQA1*01:02/DQB1*06:02 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 1097 385
HLA-DQA1*01:03/DQB1*05:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1085 381
HLA-DPA1*01:03/DPB1*01:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1130 397
HLA-DQA1*01:02/DQB1*06:02 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 1154 406
HLA-DQA1*01:03/DQB1*06:02 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 832 293
HLA-DQA1*01:02/DQB1*05:03 NDGVYFASTEKSNII NDGVYFASIEKSNII 1090 384
HLA-DQA1*01:03/DQB1*06:02 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 825 291
HLA-DPA1*01:03/DPB1*01:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 870 307
HLA-DQA1*01:02/DQB1*05:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 221 78
HLA-DRB1*14:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 895 316
HLA-DRB1*08:04 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 773 273
HLA-DPA1*03:01/DPB1*01:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 504 178
HLA-DPA1*02:01/DPB1*01:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 1065 378
HLA-DPA1*01:03/DPB1*01:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 679 241
HLA-DQA1*01:02/DQB1*05:03 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 788 280
HLA-DQA1*01:02/DQB1*06:02 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 925 329
HLA-DPA1*03:01/DPB1*05:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 1007 359
HLA-DPA1*01:03/DPB1*01:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1021 364
HLA-DQA1*01:03/DQB1*06:02 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 1021 364
HLA-DRB1*14:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 847 302
HLA-DQA1*01:02/DQB1*05:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 244 87
HLA-DQA1*01:02/DQB1*05:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 586 209
HLA-DPA1*03:01/DPB1*04:02 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 1256 448
HLA-DPA1*03:01/DPB1*105:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 1256 448
HLA-DQA1*01:02/DQB1*06:02 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 495 177
HLA-DRB1*14:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 945 338
HLA-DRB1*04:04 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 1023 366
HLA-DPA1*04:01/DPB1*05:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1118 400
HLA-DRB1*08:04 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1213 434
HLA-DPA1*01:03/DPB1*02:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 798 286
HLA-DRB1*08:02 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 837 300
HLA-DPA1*01:03/DPB1*01:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 672 241
HLA-DQA1*01:02/DQB1*05:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 585 210
HLA-DQA1*01:03/DQB1*06:02 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 904 325
HLA-DPA1*03:01/DPB1*02:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 356 128
HLA-DQA1*01:03/DQB1*05:01 GVYFASTEKSNIIRGWIF GVYFASIEKSNIIRGWIF 1357 488
HLA-DRB1*10:01 VYFASTEKSNIIRGWIFG VYFASIEKSNIIRGWIFG 1137 409
HLA-DRB1*04:04 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 1180 425
HLA-DPA1*04:01/DPB1*02:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 891 321
HLA-DRB1*14:04 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1065 384
HLA-DRB1*10:01 YFASTEKSNIIRGWIFGTT YFASIEKSNIIRGWIFGTT 707 255
HLA-DPA1*03:01/DPB1*01:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 535 193
HLA-DPA1*03:01/DPB1*01:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 559 202
HLA-DQA1*01:03/DQB1*06:02 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 880 318
HLA-DRB1*14:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 484 175
HLA-DQA1*01:02/DQB1*05:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 224 81
HLA-DPA1*04:01/DPB1*02:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 923 334
HLA-DRB1*10:01 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 787 285
HLA-DPA1*03:01/DPB1*01:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 262 95
HLA-DRB1*16:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 637 231
HLA-DQA1*01:02/DQB1*05:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 386 140
HLA-DPA1*04:01/DPB1*04:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 1020 370
HLA-DPA1*04:01/DPB1*04:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 1264 459
HLA-DPA1*03:01/DPB1*01:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 446 162
HLA-DQA1*01:03/DQB1*06:02 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 820 298
HLA-DPA1*04:01/DPB1*04:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 1274 463
HLA-DPA1*01:03/DPB1*01:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 517 188
HLA-DPA1*04:01/DPB1*04:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1075 391
HLA-DQA1*01:02/DQB1*05:01 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 769 280
HLA-DQA1*01:03/DQB1*06:02 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1115 406
HLA-DPA1*03:01/DPB1*01:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 508 185
HLA-DPA1*02:01/DPB1*05:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 1205 439
HLA-DPA1*04:01/DPB1*04:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 1001 365
HLA-DRB1*14:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 948 346
HLA-DPA1*01:03/DPB1*01:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 1005 367
HLA-DPA1*03:01/DPB1*05:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1180 431
HLA-DRB1*11:02 FASTEKSNIIRGWIFGTTLD FASIEKSNIIRGWIFGTTLD 854 312
HLA-DRB1*13:01 FASTEKSNIIRGWIFGTTLD FASIEKSNIIRGWIFGTTLD 854 312
HLA-DRB1*14:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 583 213
HLA-DQA1*01:02/DQB1*05:01 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 807 295
HLA-DQA1*01:03/DQB1*06:02 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 820 300
HLA-DRB1*08:02 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 910 333
HLA-DPA1*04:01/DPB1*04:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1060 388
HLA-DPA1*04:01/DPB1*05:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 1003 368
HLA-DPA1*03:01/DPB1*02:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 177 65
HLA-DPA1*02:02/DPB1*01:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 980 360
HLA-DPA1*02:02/DPB1*01:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 996 366
HLA-DRB1*14:04 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1110 408
HLA-DQA1*01:02/DQB1*06:09 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 922 339
HLA-DRB1*01:01 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 889 327
HLA-DPA1*03:01/DPB1*04:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 296 109
HLA-DQA1*01:02/DQB1*05:03 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 564 208
HLA-DPA1*01:03/DPB1*02:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1220 450
HLA-DPA1*03:01/DPB1*05:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 463 171
HLA-DQA1*01:02/DQB1*05:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 525 194
HLA-DPA1*03:01/DPB1*04:01 NPVLPFNDGVYFASTEK NPVLPFNDGVYFASIEK 1022 378
HLA-DPA1*04:01/DPB1*05:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1105 409
HLA-DQA1*01:03/DQB1*05:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 416 154
HLA-DRB1*14:04 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 1058 392
HLA-DQA1*01:02/DQB1*06:09 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 1083 402
HLA-DPA1*03:01/DPB1*04:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 792 294
HLA-DRB1*14:04 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1124 418
HLA-DPA1*04:01/DPB1*02:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 836 311
HLA-DQA1*01:02/DQB1*06:02 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 766 285
HLA-DRB1*14:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 857 319
HLA-DRB1*11:04 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 779 290
HLA-DPA1*03:01/DPB1*01:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 368 137
HLA-DRB1*08:02 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 650 242
HLA-DPA1*01:03/DPB1*01:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 470 175
HLA-DQA1*01:02/DQB1*05:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 564 210
HLA-DQA1*01:02/DQB1*05:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 228 85
HLA-DPA1*01:03/DPB1*01:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 995 371
HLA-DPA1*01:03/DPB1*05:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 941 351
HLA-DPA1*02:02/DPB1*01:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 965 360
HLA-DPA1*01:03/DPB1*02:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 1037 387
HLA-DPA1*01:03/DPB1*04:01 VLPFNDGVYFASTEK VLPFNDGVYFASIEK 1302 486
HLA-DQA1*01:02/DQB1*06:09 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 1320 493
HLA-DPA1*01:03/DPB1*01:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 725 271
HLA-DPA1*04:01/DPB1*02:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 564 211
HLA-DPA1*02:01/DPB1*05:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 1152 431
HLA-DPA1*03:01/DPB1*05:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 462 173
HLA-DPA1*03:01/DPB1*04:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 582 218
HLA-DRB1*08:04 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 1190 446
HLA-DQA1*01:03/DQB1*05:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 781 293
HLA-DPA1*04:01/DPB1*01:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 485 182
HLA-DRB1*11:02 NDGVYFASTEKSNII NDGVYFASIEKSNII 618 232
HLA-DRB1*13:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 618 232
HLA-DQA1*01:02/DQB1*05:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 466 175
HLA-DRB1*14:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 591 222
HLA-DPA1*04:01/DPB1*05:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 889 334
HLA-DRB1*14:04 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1038 390
HLA-DPA1*04:01/DPB1*01:01 DGVYFASTEKSNIIRGWI DGVYFASIEKSNIIRGWI 853 321
HLA-DPA1*01:03/DPB1*05:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 914 344
HLA-DQA1*01:03/DQB1*05:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 454 171
HLA-DPA1*02:01/DPB1*05:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 1223 461
HLA-DPA1*04:01/DPB1*01:01 NDGVYFASTEKSNIIRGW NDGVYFASIEKSNIIRGW 833 314
HLA-DPA1*04:01/DPB1*01:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 549 207
HLA-DPA1*02:01/DPB1*05:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 1092 412
HLA-DPA1*02:01/DPB1*01:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 1129 426
HLA-DRB1*11:02 ASTEKSNIIRGWIFGTT ASIEKSNIIRGWIFGTT 967 365
HLA-DRB1*13:01 ASTEKSNIIRGWIFGTT ASIEKSNIIRGWIFGTT 967 365
HLA-DRB1*10:01 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 879 332
HLA-DRB1*14:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 987 373
HLA-DQA1*01:02/DQB1*05:01 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 471 178
HLA-DPA1*03:01/DPB1*01:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 209 79
HLA-DRB1*08:04 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1017 385
HLA-DPA1*03:01/DPB1*05:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1019 386
HLA-DQA1*01:02/DQB1*05:03 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 850 322
HLA-DPA1*04:01/DPB1*04:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1251 474
HLA-DQA1*01:02/DQB1*05:03 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 999 379
HLA-DRB1*11:04 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 1029 391
HLA-DPA1*04:01/DPB1*05:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 976 371
HLA-DRB1*14:04 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 1152 438
HLA-DRB1*14:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 539 205
HLA-DQA1*01:03/DQB1*06:02 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 1049 399
HLA-DPA1*04:01/DPB1*05:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 1303 496
HLA-DRB1*16:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 806 307
HLA-DPA1*01:03/DPB1*05:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 932 355
HLA-DQA1*01:02/DQB1*05:03 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1291 493
HLA-DRB1*14:04 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1029 393
HLA-DQA1*01:03/DQB1*06:02 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 898 343
HLA-DPA1*02:02/DPB1*01:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 759 290
HLA-DPA1*03:01/DPB1*04:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 759 290
HLA-DRB1*14:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 950 363
HLA-DPA1*03:01/DPB1*05:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 442 169
HLA-DQA1*01:02/DQB1*05:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 384 147
HLA-DRB1*16:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 854 327
HLA-DPA1*03:01/DPB1*04:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 833 319
HLA-DPA1*02:01/DPB1*01:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1292 495
HLA-DRB1*16:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 743 285
HLA-DRB1*14:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 597 229
HLA-DPA1*03:01/DPB1*05:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 503 193
HLA-DRB1*16:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1261 484
HLA-DPA1*01:03/DPB1*02:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 1289 495
HLA-DPA1*04:01/DPB1*02:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 963 370
HLA-DPA1*04:01/DPB1*01:01 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 674 259
HLA-DPA1*01:03/DPB1*01:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 1269 488
HLA-DRB1*01:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 156 60
HLA-DPA1*04:01/DPB1*01:01 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 725 279
HLA-DPA1*01:03/DPB1*01:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1294 498
HLA-DPA1*04:01/DPB1*01:01 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 782 301
HLA-DPA1*01:03/DPB1*01:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 413 159
HLA-DRB1*14:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 574 221
HLA-DQA1*01:03/DQB1*06:02 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1085 418
HLA-DRB1*16:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 693 267
HLA-DPA1*04:01/DPB1*02:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 794 306
HLA-DQA1*01:03/DQB1*06:02 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 890 343
HLA-DPA1*02:02/DPB1*01:01 NDGVYFASTEKSNIIRGW NDGVYFASIEKSNIIRGW 1100 424
HLA-DQA1*01:03/DQB1*05:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 441 170
HLA-DPA1*04:01/DPB1*05:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1099 424
HLA-DPA1*03:01/DPB1*05:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 1135 438
HLA-DPA1*01:03/DPB1*01:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 969 374
HLA-DPA1*03:01/DPB1*01:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 259 100
HLA-DPA1*02:02/DPB1*01:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 1054 407
HLA-DRB1*14:04 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 1186 458
HLA-DPA1*03:01/DPB1*01:01 NPVLPFNDGVYFASTEKS NPVLPFNDGVYFASIEKS 1002 387
HLA-DPA1*04:01/DPB1*02:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 975 377
HLA-DRB1*01:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 535 207
HLA-DPA1*03:01/DPB1*05:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1121 434
HLA-DPA1*04:01/DPB1*02:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 656 254
HLA-DRB1*08:02 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 909 352
HLA-DPA1*03:01/DPB1*04:01 PVLPFNDGVYFASTE PVLPFNDGVYFASIE 924 358
HLA-DQA1*01:03/DQB1*06:02 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 949 368
HLA-DPA1*04:01/DPB1*01:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 479 186
HLA-DPA1*04:01/DPB1*02:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 770 299
HLA-DPA1*04:01/DPB1*05:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 945 367
HLA-DPA1*02:02/DPB1*01:01 DGVYFASTEKSNIIRGWI DGVYFASIEKSNIIRGWI 1132 440
HLA-DQA1*01:03/DQB1*06:02 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 921 358
HLA-DPA1*03:01/DPB1*04:01 PVLPFNDGVYFASTEK PVLPFNDGVYFASIEK 908 353
HLA-DQA1*01:03/DQB1*06:02 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 913 355
HLA-DQA1*01:02/DQB1*05:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 216 84
HLA-DQA1*01:02/DQB1*05:03 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 709 276
HLA-DRB1*14:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 996 388
HLA-DRB1*14:04 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1101 429
HLA-DPA1*04:01/DPB1*01:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 485 189
HLA-DPA1*01:03/DPB1*05:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 984 384
HLA-DPA1*03:01/DPB1*05:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 415 162
HLA-DRB1*14:04 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 607 237
HLA-DQA1*01:02/DQB1*05:03 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 627 245
HLA-DPA1*04:01/DPB1*05:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 1230 481
HLA-DQA1*01:02/DQB1*06:09 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 795 311
HLA-DQA1*01:02/DQB1*05:03 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 1201 470
HLA-DRB1*14:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 820 321
HLA-DPA1*04:01/DPB1*05:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1024 401
HLA-DRB1*16:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 1202 471
HLA-DQA1*01:02/DQB1*05:03 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 814 319
HLA-DRB1*14:04 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 1247 489
HLA-DRB1*10:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 408 160
HLA-DPA1*03:01/DPB1*01:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 283 111
HLA-DRB1*16:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 1165 457
HLA-DPA1*04:01/DPB1*04:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 1123 441
HLA-DPA1*02:01/DPB1*01:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 769 302
HLA-DPA1*03:01/DPB1*01:01 VYFASTEKSNIIRGWIFG VYFASIEKSNIIRGWIFG 1072 421
HLA-DRB1*16:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 672 264
HLA-DQA1*01:02/DQB1*05:03 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 1176 462
HLA-DPA1*04:01/DPB1*01:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 458 180
HLA-DRB1*16:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 659 259
HLA-DPA1*04:01/DPB1*04:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 959 377
HLA-DPA1*04:01/DPB1*01:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 468 184
HLA-DQA1*01:02/DQB1*05:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 468 184
HLA-DPA1*03:01/DPB1*02:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 961 378
HLA-DPA1*01:03/DPB1*02:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 1154 454
HLA-DPA1*04:01/DPB1*05:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 526 207
HLA-DQA1*01:02/DQB1*05:03 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 836 329
HLA-DPA1*01:03/DPB1*01:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 503 198
HLA-DQA1*01:03/DQB1*06:02 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 536 211
HLA-DPA1*03:01/DPB1*05:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 508 200
HLA-DPA1*03:01/DPB1*01:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 213 84
HLA-DPA1*04:01/DPB1*05:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 512 202
HLA-DPA1*04:01/DPB1*04:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 1039 410
HLA-DQA1*01:02/DQB1*06:09 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 922 364
HLA-DRB1*08:04 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 1109 438
HLA-DPA1*04:01/DPB1*04:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 1063 420
HLA-DQA1*01:02/DQB1*05:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 453 179
HLA-DPA1*04:01/DPB1*04:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1242 491
HLA-DPA1*04:01/DPB1*02:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 543 215
HLA-DRB1*16:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1222 484
HLA-DQA1*01:03/DQB1*05:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 840 333
HLA-DRB1*14:04 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 729 289
HLA-DRB1*10:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 295 117
HLA-DPA1*01:03/DPB1*04:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 1124 446
HLA-DQA1*01:02/DQB1*06:02 GVYFASTEKSNIIRGWIF GVYFASIEKSNIIRGWIF 1242 493
HLA-DPA1*04:01/DPB1*05:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 1058 420
HLA-DPA1*04:01/DPB1*01:01 GVYFASTEKSNIIRGWIF GVYFASIEKSNIIRGWIF 841 334
HLA-DQA1*01:02/DQB1*06:09 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 886 352
HLA-DRB1*14:04 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 745 296
HLA-DPA1*04:01/DPB1*04:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1102 438
HLA-DPA1*03:01/DPB1*04:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 712 283
HLA-DPA1*02:02/DPB1*01:01 FNDGVYFASTEKSNIIRG FNDGVYFASIEKSNIIRG 1034 411
HLA-DRB1*14:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 704 280
HLA-DPA1*01:03/DPB1*02:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 731 291
HLA-DQA1*01:02/DQB1*05:03 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 530 211
HLA-DRB1*11:02 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 982 391
HLA-DRB1*13:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 982 391
HLA-DPA1*04:01/DPB1*02:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 698 278
HLA-DRB1*08:02 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 1180 470
HLA-DPA1*04:01/DPB1*04:02 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 1092 435
HLA-DPA1*04:01/DPB1*105:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 1092 435
HLA-DPA1*02:01/DPB1*01:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 640 255
HLA-DRB1*16:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 890 355
HLA-DQA1*01:03/DQB1*06:02 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 787 314
HLA-DPA1*04:01/DPB1*02:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 879 351
HLA-DPA1*01:03/DPB1*02:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 954 381
HLA-DPA1*03:01/DPB1*05:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 408 163
HLA-DRB1*14:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 828 331
HLA-DPA1*03:01/DPB1*01:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 230 92
HLA-DRB1*16:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 645 258
HLA-DPA1*04:01/DPB1*01:01 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 690 276
HLA-DQA1*01:03/DQB1*06:02 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 865 346
HLA-DRB1*15:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 972 389
HLA-DPA1*04:01/DPB1*05:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 962 385
HLA-DQA1*01:03/DQB1*05:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 1044 418
HLA-DRB1*14:04 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 699 280
HLA-DRB1*16:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 649 260
HLA-DRB1*14:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 836 335
HLA-DPA1*03:01/DPB1*01:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 187 75
HLA-DPA1*02:01/DPB1*01:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 730 293
HLA-DRB1*08:02 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 837 336
HLA-DRB1*16:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1193 479
HLA-DQA1*01:02/DQB1*06:09 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 809 325
HLA-DPA1*04:01/DPB1*02:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 731 294
HLA-DQA1*01:03/DQB1*06:02 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 1205 485
HLA-DPA1*01:03/DPB1*05:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 862 347
HLA-DQA1*01:02/DQB1*05:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 544 219
HLA-DRB1*14:04 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 996 401
HLA-DPA1*04:01/DPB1*01:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 419 169
HLA-DRB1*14:04 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 1098 443
HLA-DPA1*03:01/DPB1*02:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 359 145
HLA-DPA1*04:01/DPB1*02:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 656 265
HLA-DPA1*04:01/DPB1*02:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 641 259
HLA-DPA1*01:03/DPB1*01:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 433 175
HLA-DRB1*15:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 915 370
HLA-DRB1*01:02 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 806 326
HLA-DRB1*14:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 719 291
HLA-DPA1*01:03/DPB1*01:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 872 353
HLA-DPA1*01:03/DPB1*04:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 1084 439
HLA-DQA1*01:03/DQB1*06:02 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 696 282
HLA-DQA1*01:03/DQB1*05:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 481 195
HLA-DPA1*04:01/DPB1*05:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1021 414
HLA-DRB1*04:04 FASTEKSNIIRGWIFGTTLD FASIEKSNIIRGWIFGTTLD 1164 472
HLA-DPA1*04:01/DPB1*01:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 397 161
HLA-DPA1*02:01/DPB1*01:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 801 325
HLA-DQA1*01:03/DQB1*06:02 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 828 336
HLA-DQA1*01:03/DQB1*06:02 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 611 248
HLA-DPA1*04:01/DPB1*05:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 569 231
HLA-DRB1*14:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 963 391
HLA-DPA1*02:02/DPB1*01:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 628 255
HLA-DRB1*16:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 682 277
HLA-DRB1*16:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1194 485
HLA-DPA1*04:01/DPB1*05:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 935 380
HLA-DPA1*04:01/DPB1*04:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 1043 424
HLA-DPA1*01:03/DPB1*02:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 888 361
HLA-DQA1*01:02/DQB1*05:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 364 148
HLA-DPA1*01:03/DPB1*01:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 637 259
HLA-DPA1*03:01/DPB1*02:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 632 257
HLA-DPA1*02:02/DPB1*01:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 718 292
HLA-DPA1*04:01/DPB1*04:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 934 380
HLA-DPA1*01:03/DPB1*01:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 698 284
HLA-DQA1*01:02/DQB1*06:09 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 904 368
HLA-DPA1*03:01/DPB1*05:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 368 150
HLA-DRB1*14:04 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 520 212
HLA-DPA1*04:01/DPB1*04:02 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 1108 452
HLA-DPA1*04:01/DPB1*105:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 1108 452
HLA-DPA1*02:01/DPB1*05:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 990 404
HLA-DPA1*02:01/DPB1*01:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 838 342
HLA-DPA1*03:01/DPB1*05:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 512 209
HLA-DPA1*04:01/DPB1*05:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 497 203
HLA-DQA1*01:02/DQB1*05:03 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 852 348
HLA-DPA1*04:01/DPB1*01:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 399 163
HLA-DPA1*04:01/DPB1*04:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 1057 432
HLA-DPA1*02:02/DPB1*01:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 619 253
HLA-DPA1*04:01/DPB1*05:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 954 390
HLA-DRB1*13:02 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 565 231
HLA-DPA1*04:01/DPB1*01:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 516 211
HLA-DRB1*16:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 1032 422
HLA-DRB1*14:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 582 238
HLA-DPA1*02:02/DPB1*01:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 599 245
HLA-DPA1*04:01/DPB1*04:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 867 355
HLA-DQA1*01:02/DQB1*06:02 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 613 251
HLA-DQA1*01:03/DQB1*05:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 1155 473
HLA-DPA1*01:03/DPB1*01:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 952 390
HLA-DRB1*14:04 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 1130 463
HLA-DRB1*14:04 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 717 294
HLA-DPA1*02:02/DPB1*01:01 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 951 390
HLA-DQA1*01:02/DQB1*06:09 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 951 390
HLA-DRB1*14:04 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 1014 416
HLA-DQA1*01:02/DQB1*05:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 509 209
HLA-DPA1*01:03/DPB1*02:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 1007 414
HLA-DPA1*03:01/DPB1*04:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 501 206
HLA-DPA1*01:03/DPB1*04:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 946 389
HLA-DPA1*01:03/DPB1*01:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 851 350
HLA-DPA1*04:01/DPB1*01:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 571 235
HLA-DPA1*04:01/DPB1*01:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 515 212
HLA-DPA1*04:01/DPB1*01:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 451 186
HLA-DQA1*01:03/DQB1*05:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 979 404
HLA-DPA1*04:01/DPB1*02:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 690 285
HLA-DPA1*03:01/DPB1*01:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 317 131
HLA-DPA1*03:01/DPB1*02:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 626 259
HLA-DPA1*03:01/DPB1*01:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 567 235
HLA-DRB1*14:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 499 207
HLA-DQA1*01:03/DQB1*05:01 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 969 402
HLA-DRB1*14:04 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 887 368
HLA-DPA1*03:01/DPB1*02:01 NPVLPFNDGVYFASTEK NPVLPFNDGVYFASIEK 564 234
HLA-DPA1*04:01/DPB1*04:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 735 305
HLA-DPA1*02:02/DPB1*01:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 554 230
HLA-DPA1*01:03/DPB1*01:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 893 371
HLA-DRB1*16:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 1018 423
HLA-DRB1*14:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 450 187
HLA-DQA1*01:02/DQB1*05:01 ASTEKSNIIRGWIFGT ASIEKSNIIRGWIFGT 409 170
HLA-DRB1*11:04 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 796 331
HLA-DRB1*04:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 159 382
HLA-DPA1*02:02/DPB1*01:01 GVYFASTEKSNIIRGWIF GVYFASIEKSNIIRGWIF 1065 444
HLA-DQA1*01:02/DQB1*05:03 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 1053 439
HLA-DRB1*08:04 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 602 251
HLA-DQA1*01:02/DQB1*05:01 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 635 265
HLA-DRB1*10:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 261 109
HLA-DQA1*01:03/DQB1*05:03 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 1029 430
HLA-DPA1*02:01/DPB1*01:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 612 256
HLA-DQA1*01:02/DQB1*05:03 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 760 318
HLA-DPA1*02:02/DPB1*05:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 1125 471
HLA-DQA1*01:02/DQB1*06:09 NDGVYFASTEKSNII NDGVYFASIEKSNII 807 338
HLA-DRB1*11:04 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 666 279
HLA-DPA1*04:01/DPB1*02:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1019 427
HLA-DPA1*01:03/DPB1*01:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 680 285
HLA-DRB1*01:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 260 109
HLA-DRB1*14:04 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 873 366
HLA-DPA1*04:01/DPB1*04:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 1068 448
HLA-DQA1*01:03/DQB1*06:02 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 472 198
HLA-DPA1*02:02/DPB1*01:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 541 227
HLA-DRB1*14:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 424 178
HLA-DQA1*01:03/DQB1*05:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 1012 425
HLA-DRB1*14:04 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 995 418
HLA-DRB1*14:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 376 158
HLA-DPA1*02:02/DPB1*01:01 PFNDGVYFASTEKSNIIR PFNDGVYFASIEKSNIIR 880 370
HLA-DPA1*02:02/DPB1*05:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 699 294
HLA-DPA1*04:01/DPB1*01:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 397 167
HLA-DQA1*01:02/DQB1*06:09 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 1065 449
HLA-DPA1*03:01/DPB1*02:01 VLPFNDGVYFASTEK VLPFNDGVYFASIEK 396 167
HLA-DQA1*01:03/DQB1*05:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 751 317
HLA-DPA1*04:01/DPB1*05:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 938 396
HLA-DRB1*14:04 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 753 318
HLA-DPA1*04:01/DPB1*01:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 407 172
HLA-DQA1*01:02/DQB1*05:03 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 695 294
HLA-DPA1*04:01/DPB1*01:01 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 742 314
HLA-DPA1*03:01/DPB1*05:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 756 320
HLA-DPA1*03:01/DPB1*02:01 FDNPVLPFNDGVYFASTEK FDNPVLPFNDGVYFASIEK 574 243
HLA-DPA1*04:01/DPB1*01:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 444 188
HLA-DPA1*01:03/DPB1*05:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 758 321
HLA-DQA1*01:03/DQB1*06:02 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 528 224
HLA-DRB1*14:04 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 714 303
HLA-DPA1*04:01/DPB1*01:01 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 417 177
HLA-DPA1*01:03/DPB1*02:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 935 397
HLA-DQA1*01:02/DQB1*06:09 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 786 334
HLA-DRB1*11:04 NDGVYFASTEKSNII NDGVYFASIEKSNII 508 216
HLA-DRB1*16:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 783 333
HLA-DPA1*01:03/DPB1*05:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 957 407
HLA-DQA1*01:02/DQB1*06:09 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 804 342
HLA-DRB1*16:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 1074 457
HLA-DQA1*01:03/DQB1*05:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 759 323
HLA-DPA1*04:01/DPB1*04:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 712 303
HLA-DPA1*02:02/DPB1*01:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 679 289
HLA-DQA1*01:02/DQB1*06:09 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 754 321
HLA-DPA1*04:01/DPB1*04:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 714 304
HLA-DPA1*03:01/DPB1*04:01 FDNPVLPFNDGVYFASTEK FDNPVLPFNDGVYFASIEK 984 419
HLA-DRB1*14:04 NDGVYFASTEKSNII NDGVYFASIEKSNII 554 236
HLA-DRB1*14:04 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 1028 438
HLA-DPA1*02:02/DPB1*05:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 671 286
HLA-DPA1*04:01/DPB1*02:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 739 315
HLA-DRB1*11:02 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 701 299
HLA-DRB1*13:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 701 299
HLA-DPA1*02:02/DPB1*01:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 504 215
HLA-DPA1*04:01/DPB1*02:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 436 186
HLA-DRB1*16:01 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 885 378
HLA-DPA1*01:03/DPB1*02:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 913 390
HLA-DRB1*14:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 798 341
HLA-DPA1*03:01/DPB1*02:01 PVLPFNDGVYFASTEK PVLPFNDGVYFASIEK 475 203
HLA-DRB1*13:02 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 729 312
HLA-DPA1*03:01/DPB1*04:01 NPVLPFNDGVYFAST NPVLPFNDGVYFASI 925 396
HLA-DPA1*03:01/DPB1*01:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 574 246
HLA-DPA1*02:02/DPB1*05:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 674 289
HLA-DRB1*08:04 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 611 262
HLA-DQA1*01:03/DQB1*05:03 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 1124 482
HLA-DQA1*01:02/DQB1*05:01 FASTEKSNIIRGWIFGTT FASIEKSNIIRGWIFGTT 520 223
HLA-DRB1*08:02 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 499 214
HLA-DQA1*01:02/DQB1*06:09 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 788 338
HLA-DPA1*04:01/DPB1*02:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 944 405
HLA-DRB1*15:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 937 402
HLA-DPA1*04:01/DPB1*02:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 620 266
HLA-DQA1*01:03/DQB1*05:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 466 200
HLA-DRB1*01:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 419 180
HLA-DPA1*02:02/DPB1*05:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 747 321
HLA-DPA1*04:01/DPB1*04:02 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 961 413
HLA-DPA1*04:01/DPB1*105:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 961 413
HLA-DPA1*02:02/DPB1*01:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 549 236
HLA-DPA1*02:02/DPB1*01:01 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 1074 462
HLA-DPA1*02:02/DPB1*01:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 588 253
HLA-DPA1*02:01/DPB1*01:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 1152 496
HLA-DQA1*01:03/DQB1*05:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 875 377
HLA-DQA1*01:02/DQB1*06:09 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 786 339
HLA-DRB1*11:02 STEKSNIIRGWIFGT SIEKSNIIRGWIFGT 517 223
HLA-DRB1*13:01 STEKSNIIRGWIFGT SIEKSNIIRGWIFGT 517 223
HLA-DPA1*04:01/DPB1*01:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 306 132
HLA-DPA1*02:02/DPB1*01:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 459 198
HLA-DQA1*01:03/DQB1*05:01 LPFNDGVYFASTEKSNI LPFNDGVYFASIEKSNI 1020 440
HLA-DPA1*04:01/DPB1*01:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 535 231
HLA-DQA1*01:03/DQB1*05:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 880 380
HLA-DPA1*04:01/DPB1*01:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 414 179
HLA-DPA1*04:01/DPB1*01:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 481 208
HLA-DQA1*01:03/DQB1*06:02 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 749 324
HLA-DRB1*14:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 929 402
HLA-DPA1*02:02/DPB1*01:01 PFNDGVYFASTEKSNII PFNDGVYFASIEKSNII 529 229
HLA-DPA1*04:01/DPB1*04:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 709 307
HLA-DQA1*01:02/DQB1*05:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 224 97
HLA-DPA1*01:03/DPB1*04:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 845 366
HLA-DPA1*02:01/DPB1*01:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 531 230
HLA-DPA1*01:03/DPB1*02:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 994 431
HLA-DQA1*01:02/DQB1*06:09 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 740 321
HLA-DRB1*14:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 968 420
HLA-DQA1*01:02/DQB1*06:09 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 1023 444
HLA-DPA1*04:01/DPB1*02:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 910 395
HLA-DPA1*04:01/DPB1*05:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 891 387
HLA-DQA1*01:03/DQB1*05:01 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 843 367
HLA-DRB1*08:02 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 693 302
HLA-DRB1*04:04 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 129 296
HLA-DPA1*03:01/DPB1*02:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 1108 483
HLA-DRB1*01:01 YFASTEKSNIIRGWIFGTT YFASIEKSNIIRGWIFGTT 640 279
HLA-DPA1*04:01/DPB1*02:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 564 246
HLA-DQA1*01:03/DQB1*05:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 852 372
HLA-DRB1*01:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 359 157
HLA-DPA1*04:01/DPB1*01:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 528 231
HLA-DRB1*14:04 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 626 274
HLA-DPA1*01:03/DPB1*05:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 861 377
HLA-DQA1*01:02/DQB1*06:09 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 845 370
HLA-DPA1*02:01/DPB1*01:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 895 392
HLA-DPA1*01:03/DPB1*01:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 945 414
HLA-DPA1*01:03/DPB1*05:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 1058 464
HLA-DPA1*04:01/DPB1*01:01 VLPFNDGVYFASTEKSN VLPFNDGVYFASIEKSN 515 226
HLA-DPA1*04:01/DPB1*02:01 LPFNDGVYFASTEKSNII LPFNDGVYFASIEKSNII 1055 463
HLA-DPA1*04:01/DPB1*05:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 450 198
HLA-DPA1*03:01/DPB1*01:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 527 232
HLA-DPA1*04:01/DPB1*04:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 595 262
HLA-DRB1*14:04 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 840 370
HLA-DPA1*01:03/DPB1*02:01 VLPFNDGVYFASTEK VLPFNDGVYFASIEK 551 243
HLA-DRB1*14:04 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1122 495
HLA-DPA1*04:01/DPB1*01:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 310 137
HLA-DRB1*01:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 319 141
HLA-DPA1*03:01/DPB1*04:01 NPVLPFNDGVYFASTE NPVLPFNDGVYFASIE 1031 456
HLA-DPA1*03:01/DPB1*02:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 1060 469
HLA-DQA1*01:02/DQB1*05:03 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 1105 489
HLA-DQA1*01:03/DQB1*05:03 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 1023 453
HLA-DPA1*04:01/DPB1*05:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 982 435
HLA-DRB1*15:01 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 1061 470
HLA-DPA1*04:01/DPB1*01:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 343 152
HLA-DPA1*04:01/DPB1*05:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 555 246
HLA-DPA1*04:01/DPB1*01:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 442 196
HLA-DPA1*01:03/DPB1*02:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 975 433
HLA-DPA1*04:01/DPB1*04:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 936 416
HLA-DPA1*03:01/DPB1*05:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 831 370
HLA-DPA1*04:01/DPB1*01:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 458 204
HLA-DPA1*04:01/DPB1*01:01 PFNDGVYFASTEKSNIIRG PFNDGVYFASIEKSNIIRG 386 172
HLA-DPA1*04:01/DPB1*17:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 1077 480
HLA-DPA1*03:01/DPB1*01:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 563 251
HLA-DPA1*04:01/DPB1*02:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 511 228
HLA-DPA1*02:02/DPB1*05:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 1120 500
HLA-DPA1*01:03/DPB1*02:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 684 306
HLA-DQA1*01:03/DQB1*06:02 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 603 270
HLA-DQA1*04:01/DQB1*03:03 PFNDGVYFASTEKSNI PFNDGVYFASIEKSNI 996 446
HLA-DPA1*03:01/DPB1*02:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 570 256
HLA-DPA1*02:02/DPB1*05:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 638 287
HLA-DPA1*04:01/DPB1*04:01 VLPFNDGVYFASTEK VLPFNDGVYFASIEK 798 359
HLA-DPA1*04:01/DPB1*04:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 720 324
HLA-DPA1*04:01/DPB1*01:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 551 248
HLA-DPA1*02:02/DPB1*01:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 544 245
HLA-DQA1*01:02/DQB1*06:09 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 635 286
HLA-DPA1*03:01/DPB1*02:01 DNPVLPFNDGVYFASTEK DNPVLPFNDGVYFASIEK 1078 486
HLA-DPA1*02:02/DPB1*01:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 641 289
HLA-DQA1*01:02/DQB1*06:09 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 799 361
HLA-DQA1*01:02/DQB1*06:09 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 615 278
HLA-DPA1*01:03/DPB1*02:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 836 378
HLA-DQA1*04:01/DQB1*03:03 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 878 397
HLA-DRB1*04:04 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 123 272
HLA-DQA1*01:02/DQB1*06:02 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 942 426
HLA-DQA1*01:03/DQB1*06:02 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 953 431
HLA-DPA1*04:01/DPB1*04:02 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 864 391
HLA-DPA1*04:01/DPB1*105:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 864 391
HLA-DRB1*01:01 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 393 178
HLA-DQA1*01:02/DQB1*06:09 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 907 411
HLA-DPA1*03:01/DPB1*04:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 783 355
HLA-DPA1*04:01/DPB1*01:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 483 219
HLA-DPA1*03:01/DPB1*02:01 DNPVLPFNDGVYFASTE DNPVLPFNDGVYFASIE 741 336
HLA-DPA1*03:01/DPB1*02:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 630 286
HLA-DQA1*04:01/DQB1*03:03 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 956 434
HLA-DQA1*01:03/DQB1*06:02 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 645 293
HLA-DQA1*01:02/DQB1*06:09 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 680 309
HLA-DPA1*02:02/DPB1*01:01 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 578 263
HLA-DPA1*04:01/DPB1*02:01 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 580 264
HLA-DQA1*01:02/DQB1*06:02 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 940 428
HLA-DQA1*01:03/DQB1*05:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 399 182
HLA-DQA1*01:02/DQB1*06:09 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 631 288
HLA-DQA1*01:03/DQB1*06:02 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 565 258
HLA-DPA1*04:01/DPB1*04:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 497 227
HLA-DRB1*16:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1070 489
HLA-DRB1*14:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 617 282
HLA-DPA1*04:01/DPB1*02:01 GVYFASTEKSNIIRG GVYFASIEKSNIIRG 827 378
HLA-DPA1*04:01/DPB1*01:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 339 155
HLA-DPA1*03:01/DPB1*04:01 RFDNPVLPFNDGVYFASTEK RFDNPVLPFNDGVYFASIEK 697 319
HLA-DPA1*04:01/DPB1*04:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 723 331
HLA-DPA1*04:01/DPB1*05:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 1017 466
HLA-DPA1*03:01/DPB1*02:01 PVLPFNDGVYFASTE PVLPFNDGVYFASIE 443 203
HLA-DPA1*02:02/DPB1*05:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 744 341
HLA-DRB1*15:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 800 367
HLA-DRB1*14:01 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 636 292
HLA-DRB1*04:01 VYFASTEKSNIIRGW VYFASIEKSNIIRGW 614 282
HLA-DRB1*10:01 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 407 187
HLA-DQA1*01:02/DQB1*06:09 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 1004 462
HLA-DRB1*14:01 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 954 439
HLA-DPA1*02:02/DPB1*01:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 517 238
HLA-DPA1*04:01/DPB1*01:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 328 151
HLA-DQA1*01:03/DQB1*06:02 DGVYFASTEKSNIIRGWIF DGVYFASIEKSNIIRGWIF 747 344
HLA-DPA1*04:01/DPB1*02:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 525 242
HLA-DPA1*01:03/DPB1*02:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 577 266
HLA-DRB1*01:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 308 142
HLA-DRB1*01:01 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 258 119
HLA-DRB1*08:04 FNDGVYFASTEKSNIIRGW FNDGVYFASIEKSNIIRGW 1081 499
HLA-DRB1*08:02 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 734 339
HLA-DPA1*04:01/DPB1*04:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 565 261
HLA-DPA1*02:02/DPB1*01:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 727 336
HLA-DRB1*07:01 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 889 411
HLA-DPA1*04:01/DPB1*01:01 NPVLPFNDGVYFASTEKS NPVLPFNDGVYFASIEKS 958 443
HLA-DPA1*03:01/DPB1*01:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 333 154
HLA-DPA1*04:01/DPB1*06:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 1072 496
HLA-DRB1*15:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 953 441
HLA-DPA1*03:01/DPB1*04:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 834 386
HLA-DQA1*01:03/DQB1*06:09 FNDGVYFASTEKSNI FNDGVYFASIEKSNI 743 344
HLA-DRB1*08:04 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 567 263
HLA-DPA1*02:02/DPB1*01:01 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 457 212
HLA-DPA1*02:02/DPB1*01:01 FNDGVYFASTEKSNIIR FNDGVYFASIEKSNIIR 446 207
HLA-DPA1*04:01/DPB1*01:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 506 235
HLA-DRB1*07:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 510 237
HLA-DQA1*01:02/DQB1*06:09 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 585 272
HLA-DRB1*14:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 1056 491
HLA-DPA1*04:01/DPB1*02:01 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 619 288
HLA-DPA1*04:01/DPB1*01:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 348 162
HLA-DQA1*01:03/DQB1*06:09 LPFNDGVYFASTEKS LPFNDGVYFASIEKS 844 393
HLA-DPA1*02:02/DPB1*01:01 NDGVYFASTEKSNII NDGVYFASIEKSNII 539 251
HLA-DRB1*15:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 822 383
HLA-DPA1*01:03/DPB1*02:01 PVLPFNDGVYFASTE PVLPFNDGVYFASIE 750 350
HLA-DPA1*04:01/DPB1*13:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 1041 486
HLA-DRB1*07:01 YFASTEKSNIIRGWI YFASIEKSNIIRGWI 317 148
HLA-DPA1*04:01/DPB1*06:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 1061 496
HLA-DRB1*01:02 ASTEKSNIIRGWIFG ASIEKSNIIRGWIFG 815 381
HLA-DQA1*01:02/DQB1*06:09 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 1045 489
HLA-DPA1*04:01/DPB1*02:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 470 220
HLA-DPA1*01:03/DPB1*02:01 NPVLPFNDGVYFASTEK NPVLPFNDGVYFASIEK 925 433
HLA-DPA1*04:01/DPB1*02:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 615 288
HLA-DQA1*01:02/DQB1*06:09 PVLPFNDGVYFASTEKS PVLPFNDGVYFASIEKS 824 386
HLA-DPA1*04:01/DPB1*01:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 273 128
HLA-DPA1*04:01/DPB1*04:01 NPVLPFNDGVYFASTEK NPVLPFNDGVYFASIEK 1047 491
HLA-DPA1*01:03/DPB1*02:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 518 243
HLA-DPA1*02:02/DPB1*01:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 537 252
HLA-DPA1*04:01/DPB1*04:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 799 375
HLA-DQA1*01:02/DQB1*06:09 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 694 326
HLA-DRB1*04:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 233 496
HLA-DRB1*10:01 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 249 117
HLA-DRB1*11:02 ASTEKSNIIRGWIFGTTLDS ASIEKSNIIRGWIFGTTLDS 934 439
HLA-DRB1*13:01 ASTEKSNIIRGWIFGTTLDS ASIEKSNIIRGWIFGTTLDS 934 439
HLA-DRB1*07:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 404 190
HLA-DPA1*04:01/DPB1*02:01 DGVYFASTEKSNIIR DGVYFASIEKSNIIR 682 321
HLA-DPA1*03:01/DPB1*02:01 RFDNPVLPFNDGVYFASTE RFDNPVLPFNDGVYFASIE 722 340
HLA-DPA1*02:02/DPB1*01:01 VLPFNDGVYFASTEK VLPFNDGVYFASIEK 991 467
HLA-DPA1*03:01/DPB1*02:01 NPVLPFNDGVYFASTE NPVLPFNDGVYFASIE 592 279
HLA-DRB1*07:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 524 247
HLA-DPA1*01:03/DPB1*02:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 668 315
HLA-DPA1*04:01/DPB1*01:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 267 126
HLA-DPA1*04:01/DPB1*02:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 339 160
HLA-DRB1*14:04 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 716 338
HLA-DQA1*01:03/DQB1*06:02 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 521 246
HLA-DQA1*01:02/DQB1*06:09 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 960 454
HLA-DPA1*04:01/DPB1*05:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 737 349
HLA-DPA1*04:01/DPB1*06:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 724 343
HLA-DQA1*01:03/DQB1*05:01 LPFNDGVYFASTEKSN LPFNDGVYFASIEKSN 992 470
HLA-DQA1*01:02/DQB1*06:09 NDGVYFASTEKSNIIR NDGVYFASIEKSNIIR 711 337
HLA-DQA1*01:02/DQB1*05:03 VYFASTEKSNIIRGWIFGTT VYFASIEKSNIIRGWIFGTT 738 350
HLA-DRB1*16:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 810 385
HLA-DRB1*15:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 811 386
HLA-DPA1*04:01/DPB1*04:01 PVLPFNDGVYFASTEK PVLPFNDGVYFASIEK 918 437
HLA-DRB1*15:01 FASTEKSNIIRGWIF FASIEKSNIIRGWIF 820 391
HLA-DPA1*02:02/DPB1*01:01 GVYFASTEKSNIIRGWI GVYFASIEKSNIIRGWI 566 270
HLA-DQA1*01:02/DQB1*06:09 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 679 324
HLA-DPA1*03:01/DPB1*01:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 886 423
HLA-DPA1*02:01/DPB1*01:01 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 934 446
HLA-DPA1*02:02/DPB1*01:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 404 193
HLA-DPA1*04:01/DPB1*01:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 249 119
HLA-DPA1*03:01/DPB1*13:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 998 477
HLA-DPA1*04:01/DPB1*85:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 1000 478
HLA-DQA1*01:03/DQB1*06:09 PFNDGVYFASTEKSN PFNDGVYFASIEKSN 903 432
HLA-DPA1*04:01/DPB1*01:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 232 111
HLA-DPA1*04:01/DPB1*02:01 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 1024 490
HLA-DPA1*04:01/DPB1*11:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 1024 490
HLA-DPA1*04:01/DPB1*01:01 PVLPFNDGVYFASTEKSN PVLPFNDGVYFASIEKSN 889 426
HLA-DRB1*11:04 YFASTEKSNIIRGWIFGTTL YFASIEKSNIIRGWIFGTTL 841 403
HLA-DQA1*01:03/DQB1*06:02 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 719 345
HLA-DPA1*04:01/DPB1*05:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 767 369
HLA-DPA1*04:01/DPB1*11:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 617 297
HLA-DPA1*04:01/DPB1*02:01 VLPFNDGVYFASTEKS VLPFNDGVYFASIEKS 521 251
HLA-DPA1*04:01/DPB1*11:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 799 385
HLA-DPA1*04:01/DPB1*13:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 944 455
HLA-DPA1*04:01/DPB1*05:01 NPVLPFNDGVYFASTEKSNI NPVLPFNDGVYFASIEKSNI 500 241
HLA-DQA1*01:03/DQB1*06:09 FASTEKSNIIRGWIFG FASIEKSNIIRGWIFG 898 433
HLA-DPA1*01:03/DPB1*02:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 518 250
HLA-DQA1*01:02/DQB1*05:01 YFASTEKSNIIRGWIFGTT YFASIEKSNIIRGWIFGTT 317 153
HLA-DPA1*02:02/DPB1*01:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 667 322
HLA-DPA1*04:01/DPB1*02:01 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 977 472
HLA-DQA1*01:02/DQB1*05:03 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 405 196
HLA-DPA1*04:01/DPB1*06:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 686 332
HLA-DQA1*01:02/DQB1*06:09 GVYFASTEKSNIIRGW GVYFASIEKSNIIRGW 830 402
HLA-DPA1*04:01/DPB1*17:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 986 478
HLA-DPA1*04:01/DPB1*01:01 VYFASTEKSNIIRGWI VYFASIEKSNIIRGWI 600 291
HLA-DQA1*01:02/DQB1*06:09 NPVLPFNDGVYFASTEKSN NPVLPFNDGVYFASIEKSN 738 358
HLA-DPA1*01:03/DPB1*02:01 FDNPVLPFNDGVYFASTEK FDNPVLPFNDGVYFASIEK 1015 493
HLA-DPA1*04:01/DPB1*02:01 DNPVLPFNDGVYFASTEKS DNPVLPFNDGVYFASIEKS 601 292
HLA-DRB1*04:04 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 227 467
HLA-DPA1*04:01/DPB1*13:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 867 422
HLA-DPA1*04:01/DPB1*05:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 384 187
HLA-DRB1*04:04 NDGVYFASTEKSNII NDGVYFASIEKSNII 94 193
HLA-DPA1*02:02/DPB1*01:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 903 440
HLA-DPA1*03:01/DPB1*02:01 FDNPVLPFNDGVYFAST FDNPVLPFNDGVYFASI 794 387
HLA-DPA1*04:01/DPB1*11:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 586 286
HLA-DQA1*01:02/DQB1*06:09 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 596 291
HLA-DRB1*04:04 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 727 355
HLA-DRB1*04:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 150 307
HLA-DPA1*04:01/DPB1*85:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 976 477
HLA-DPA1*04:01/DPB1*04:01 PVLPFNDGVYFASTE PVLPFNDGVYFASIE 941 460
HLA-DQA1*01:03/DQB1*06:02 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 797 390
HLA-DPA1*02:02/DPB1*05:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 568 278
HLA-DPA1*04:01/DPB1*05:01 PVLPFNDGVYFASTEKSNI PVLPFNDGVYFASIEKSNI 892 437
HLA-DQA1*01:03/DQB1*06:02 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 765 375
HLA-DQA1*01:03/DQB1*06:02 GVYFASTEKSNIIRGWIFG GVYFASIEKSNIIRGWIFG 822 403
HLA-DPA1*04:01/DPB1*05:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 422 207
HLA-DQA1*01:02/DQB1*06:02 GVYFASTEKSNIIRGWIFGT GVYFASIEKSNIIRGWIFGT 721 354
HLA-DRB1*07:01 DGVYFASTEKSNIIRGW DGVYFASIEKSNIIRGW 393 193
HLA-DQA1*01:02/DQB1*06:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 413 203
HLA-DPA1*04:01/DPB1*01:01 FDNPVLPFNDGVYFASTEKS FDNPVLPFNDGVYFASIEKS 362 178
HLA-DPA1*04:01/DPB1*85:01 LPFNDGVYFASTEKSNIIRG LPFNDGVYFASIEKSNIIRG 947 466
HLA-DPA1*04:01/DPB1*04:02 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 821 404
HLA-DPA1*04:01/DPB1*105:01 PVLPFNDGVYFASTEKSNII PVLPFNDGVYFASIEKSNII 821 404
HLA-DPA1*01:03/DPB1*02:01 PVLPFNDGVYFASTEK PVLPFNDGVYFASIEK 794 391
HLA-DRB1*15:02 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 1001 493
HLA-DRB1*07:01 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 552 272
HLA-DRB1*01:01 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 351 173
HLA-DPA1*04:01/DPB1*85:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 991 489
HLA-DQA1*01:02/DQB1*05:03 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 853 421
HLA-DRB1*01:01 FASTEKSNIIRGWIFGT FASIEKSNIIRGWIFGT 553 273
HLA-DRB1*08:02 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 688 340
HLA-DQA1*05:01/DQB1*02:01 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 947 468
HLA-DQA1*05:01/DQB1*02:02 FNDGVYFASTEKSNII FNDGVYFASIEKSNII 947 468
HLA-DRB1*04:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 263 532
HLA-DPA1*03:01/DPB1*02:01 RFDNPVLPFNDGVYFASTEK RFDNPVLPFNDGVYFASIEK 372 184
HLA-DPA1*03:01/DPB1*01:01 YFASTEKSNIIRGWIFG YFASIEKSNIIRGWIFG 982 486
HLA-DQA1*04:01/DQB1*03:01 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 802 397
HLA-DQA1*04:01/DQB1*03:19 NDGVYFASTEKSNIIRG NDGVYFASIEKSNIIRG 802 397
HLA-DPA1*04:01/DPB1*11:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 642 318
HLA-DPA1*04:01/DPB1*06:01 PFNDGVYFASTEKSNIIRGW PFNDGVYFASIEKSNIIRGW 658 326
HLA-DQA1*01:02/DQB1*05:01 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 222 110
HLA-DRB1*01:01 DGVYFASTEKSNIIRG DGVYFASIEKSNIIRG 343 170
HLA-DPA1*03:01/DPB1*02:01 NPVLPFNDGVYFAST NPVLPFNDGVYFASI 441 219
HLA-DPA1*04:01/DPB1*06:01 DGVYFASTEKSNIIRGWIFG DGVYFASIEKSNIIRGWIFG 781 388
HLA-DQA1*01:02/DQB1*05:01 VLPFNDGVYFASTEKSNI VLPFNDGVYFASIEKSNI 471 234
HLA-DPA1*02:02/DPB1*01:01 FNDGVYFASTEKSNIIRGWI FNDGVYFASIEKSNIIRGWI 334 166
HLA-DPA1*04:01/DPB1*05:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 674 335
HLA-DPA1*04:01/DPB1*11:01 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 694 345
HLA-DRB1*07:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 350 174
HLA-DPA1*04:01/DPB1*01:01 VYFASTEKSNIIRGWIF VYFASIEKSNIIRGWIF 589 293
HLA-DPA1*04:01/DPB1*02:01 DNPVLPFNDGVYFASTEKSN DNPVLPFNDGVYFASIEKSN 412 205
HLA-DQA1*01:03/DQB1*05:01 LPFNDGVYFASTEKSNIIR LPFNDGVYFASIEKSNIIR 744 371
HLA-DPA1*01:03/DPB1*01:01 VLPFNDGVYFASTEK VLPFNDGVYFASIEK 816 407
HLA-DQA1*01:03/DQB1*06:09 NDGVYFASTEKSNIIRGWI NDGVYFASIEKSNIIRGWI 697 348
HLA-DPA1*04:01/DPB1*01:01 VLPFNDGVYFASTEKSNIIR VLPFNDGVYFASIEKSNIIR 216 108
HLA-DQA1*01:02/DQB1*05:03 VLPFNDGVYFASTEKSNII VLPFNDGVYFASIEKSNII 490 245
HLA-DQA1*01:02/DQB1*06:09 NDGVYFASTEKSNIIRGWIF NDGVYFASIEKSNIIRGWIF 636 318
HLA-DQA1*01:03/DQB1*06:09 YFASTEKSNIIRGWIF YFASIEKSNIIRGWIF 708 354
HLA-DPA1*02:02/DPB1*01:01 VYFASTEKSNIIRGWIFGT VYFASIEKSNIIRGWIFGT 710 355

G142D

Reference  LLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    LLIVNNATNVVIKVCEFQFCNDPFLDVYYHKNNKSWMKSEFRVYSSANNCT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*01:03/DPB1*04:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 351 1366
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 92 353
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 104 384
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 282 1039
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 171 609
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 334 1180
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 291 1026
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 266 931
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 253 878
HLA-DQA1*01:01/DQB1*05:01 FQFCNDPFLGVYYHK FQFCNDPFLDVYYHK 1714 494
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 145 500
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 432 1470
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 87 296
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 265 886
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLDVYYHKNNKSWMKSEF 228 755
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 490 1621
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 354 1167
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 141 461
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 81 264
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 178 580
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 381 1224
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 122 391
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 78 249
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 385 1225
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 75 236
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 434 1346
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 376 1166
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 376 1166
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 401 1230
HLA-DQA1*01:01/DQB1*05:01 FQFCNDPFLGVYYHKN FQFCNDPFLDVYYHKN 1345 445
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 122 367
HLA-DPA1*02:01/DPB1*02:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 495 1485
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 113 337
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 409 1208
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 76 224
HLA-DPA1*03:01/DPB1*04:02 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 387 1140
HLA-DPA1*03:01/DPB1*105:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 387 1140
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 389 1142
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 389 1142
HLA-DRB1*10:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 417 1219
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 104 300
HLA-DPA1*02:02/DPB1*02:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 325 937
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 101 289
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 218 622
HLA-DPA1*03:01/DPB1*04:02 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 416 1186
HLA-DPA1*03:01/DPB1*105:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 416 1186
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 102 290
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 441 1249
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 441 1249
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 67 189
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 321 896
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 336 931
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 364 994
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 244 666
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 461 1252
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 461 1252
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 213 578
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 255 691
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 428 1158
HLA-DPA1*04:01/DPB1*04:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 315 850
HLA-DPA1*02:02/DPB1*02:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 363 979
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 244 657
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 418 1123
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 117 313
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 329 879
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNN FCNDPFLDVYYHKNN 73 195
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 99 263
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 372 985
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESE PFLDVYYHKNNKSWMKSE 451 1194
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 300 793
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 365 964
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 313 826
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 290 760
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 290 760
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 336 876
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 392 1020
HLA-DQA1*01:01/DQB1*05:01 EFQFCNDPFLGVYYH EFQFCNDPFLDVYYH 868 334
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 314 812
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 314 812
HLA-DPA1*02:01/DPB1*01:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 478 1231
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 442 1134
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 92 236
HLA-DPA1*02:02/DPB1*02:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 423 1081
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 248 633
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 111 283
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 87 221
HLA-DQA1*01:02/DQB1*05:02 EFQFCNDPFLGVYYH EFQFCNDPFLDVYYH 1241 489
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 169 428
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 307 776
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 436 1100
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 436 1100
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 90 227
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 114 287
HLA-DPA1*03:01/DPB1*04:02 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 493 1238
HLA-DPA1*03:01/DPB1*105:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 493 1238
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 220 550
HLA-DPA1*03:01/DPB1*04:02 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 346 864
HLA-DPA1*03:01/DPB1*105:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 346 864
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 461 1151
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 461 1151
HLA-DPA1*02:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 495 1235
HLA-DPA1*02:02/DPB1*02:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 417 1040
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 377 936
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 319 791
HLA-DQA1*01:02/DQB1*05:02 EFQFCNDPFLGVYYHK EFQFCNDPFLDVYYHK 1123 453
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 186 461
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 299 741
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMES DPFLDVYYHKNNKSWMKS 274 676
HLA-DQA1*01:01/DQB1*05:01 EFQFCNDPFLGVYYHK EFQFCNDPFLDVYYHK 713 289
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 122 300
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 119 292
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 252 618
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 277 677
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 424 1034
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 89 217
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLDVYYHKNNKSWMKSEF 218 528
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 489 1184
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 489 1184
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 223 539
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 237 572
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 146 350
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 81 193
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 81 192
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLDVYYHKNNKSWMKSEF 179 424
HLA-DPA1*02:02/DPB1*02:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 466 1103
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 326 766
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 258 605
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 140 328
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 325 761
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 85 199
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWM CNDPFLDVYYHKNNKSWM 193 451
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 98 229
HLA-DPA1*04:01/DPB1*04:02 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 465 1086
HLA-DPA1*04:01/DPB1*105:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 465 1086
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 84 196
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 237 551
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 430 995
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 355 821
HLA-DPA1*04:01/DPB1*04:02 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 487 1126
HLA-DPA1*04:01/DPB1*105:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 487 1126
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWME NDPFLDVYYHKNNKSWMK 210 485
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 152 351
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 150 346
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 158 364
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 168 386
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 343 787
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 150 344
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 373 855
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 132 302
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 91 207
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 143 325
HLA-DQA1*01:01/DQB1*05:01 CEFQFCNDPFLGVYY CEFQFCNDPFLDVYY 799 352
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 445 1010
HLA-DPA1*02:02/DPB1*01:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 294 667
HLA-DPA1*02:02/DPB1*02:01 PFLGVYYHKNNKSWM PFLDVYYHKNNKSWM 432 980
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 109 247
HLA-DQA1*01:01/DQB1*05:01 EFQFCNDPFLGVYYHKNNK EFQFCNDPFLDVYYHKNNK 1012 447
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 244 552
HLA-DPA1*01:03/DPB1*01:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 372 840
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 466 1051
HLA-DPA1*02:02/DPB1*02:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 295 665
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 78 175
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 411 921
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 225 504
HLA-DQA1*01:01/DQB1*05:01 CEFQFCNDPFLGVYYH CEFQFCNDPFLDVYYH 640 286
HLA-DPA1*02:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 383 857
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 421 941
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 291 650
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 392 875
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 87 194
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 338 751
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 339 753
HLA-DPA1*01:03/DPB1*02:01 FLGVYYHKNNKSWME FLDVYYHKNNKSWMK 452 1004
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 360 799
HLA-DQA1*01:02/DQB1*05:02 CEFQFCNDPFLGVYYH CEFQFCNDPFLDVYYH 993 448
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 111 246
HLA-DQA1*01:01/DQB1*05:01 EFQFCNDPFLGVYYHKN EFQFCNDPFLDVYYHKN 1043 471
HLA-DQA1*01:01/DQB1*05:01 CEFQFCNDPFLGVYYHK CEFQFCNDPFLDVYYHK 985 445
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 380 841
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 279 616
HLA-DPA1*04:01/DPB1*01:01 CNDPFLGVYYHKNNK CNDPFLDVYYHKNNK 315 694
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 361 794
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 337 741
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESE PFLDVYYHKNNKSWMKSE 420 923
HLA-DPA1*03:01/DPB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 238 523
HLA-DPA1*03:01/DPB1*105:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 238 523
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 112 246
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 133 292
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 398 864
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 326 707
HLA-DQA1*01:01/DQB1*05:01 CEFQFCNDPFLGVYYHKNN CEFQFCNDPFLDVYYHKNN 904 417
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 253 548
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 315 682
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSW FCNDPFLDVYYHKNNKSW 160 346
HLA-DPA1*03:01/DPB1*04:02 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 313 674
HLA-DPA1*03:01/DPB1*105:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 313 674
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNN FCNDPFLDVYYHKNN 92 198
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNK FCNDPFLDVYYHKNNK 80 172
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 299 642
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 316 678
HLA-DPA1*04:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 200 429
HLA-DPA1*02:01/DPB1*02:01 FCNDPFLGVYYHKNN FCNDPFLDVYYHKNN 485 1037
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 141 301
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 268 572
HLA-DPA1*02:02/DPB1*01:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 390 830
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 260 553
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 134 285
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 481 1023
HLA-DPA1*02:02/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 496 1052
HLA-DPA1*02:02/DPB1*02:01 FCNDPFLGVYYHKNNK FCNDPFLDVYYHKNNK 341 722
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNN FCNDPFLDVYYHKNN 77 163
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 141 298
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 98 207
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 135 285
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 73 154
HLA-DPA1*01:03/DPB1*02:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFLDVYYHKNNKSWM 55 116
HLA-DQA1*01:02/DQB1*05:01 QFCNDPFLGVYYHKN QFCNDPFLDVYYHKN 763 362
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMES DPFLDVYYHKNNKSWMKS 279 585
HLA-DRB1*11:04 GVYYHKNNKSWMESEFRVYS DVYYHKNNKSWMKSEFRVYS 639 305
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 130 272
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 254 531
HLA-DPA1*03:01/DPB1*04:02 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 492 1026
HLA-DPA1*03:01/DPB1*105:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 492 1026
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWM NDPFLDVYYHKNNKSWM 262 546
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 120 250
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 206 429
HLA-DPA1*04:01/DPB1*04:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 450 937
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 224 466
HLA-DPA1*04:01/DPB1*01:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 270 561
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 93 193
HLA-DPA1*01:03/DPB1*01:01 NDPFLGVYYHKNNKS NDPFLDVYYHKNNKS 360 747
HLA-DQA1*01:02/DQB1*05:01 FCNDPFLGVYYHKNN FCNDPFLDVYYHKNN 1028 496
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMESEF PFLDVYYHKNNKSWMKSEF 496 1028
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 99 205
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 133 275
HLA-DPA1*04:01/DPB1*04:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 477 985
HLA-DPA1*02:02/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 348 717
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 101 208
HLA-DPA1*02:02/DPB1*02:01 FCNDPFLGVYYHKNN FCNDPFLDVYYHKNN 306 630
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 335 689
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 332 682
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 296 607
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWM CNDPFLDVYYHKNNKSWM 200 409
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 112 229
HLA-DPA1*01:03/DPB1*01:01 DPFLGVYYHKNNKSW DPFLDVYYHKNNKSW 371 757
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 356 726
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 106 216
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 357 726
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWM CNDPFLDVYYHKNNKSWM 245 498
HLA-DPA1*03:01/DPB1*04:02 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 372 756
HLA-DPA1*03:01/DPB1*105:01 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 372 756
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESE PFLDVYYHKNNKSWMKSE 374 760
HLA-DPA1*01:03/DPB1*01:01 CNDPFLGVYYHKNNKSW CNDPFLDVYYHKNNKSW 425 862
HLA-DPA1*02:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFLDVYYHKNNKSWM 268 543
HLA-DPA1*01:03/DPB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 498 1009
HLA-DPA1*01:03/DPB1*105:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 498 1009
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKS CNDPFLDVYYHKNNKS 260 525
HLA-DPA1*03:01/DPB1*04:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 216 436
HLA-DPA1*04:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWM FCNDPFLDVYYHKNNKSWM 270 545
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNN FCNDPFLDVYYHKNN 269 542
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWM DPFLDVYYHKNNKSWM 282 568
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 71 143
HLA-DPA1*04:01/DPB1*04:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 236 475
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 275 552
HLA-DQA1*01:01/DQB1*05:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFLDVYYHKNNKS 928 463
HLA-DPA1*03:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 174 348
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNN FCNDPFLDVYYHKNN 201 402
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSW NDPFLDVYYHKNNKSW 261 522
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 293 586
HLA-DPA1*02:02/DPB1*04:01 FCNDPFLGVYYHKNNKS FCNDPFLDVYYHKNNKS 466 932

E154K

Reference  KVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDL
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    KVCEFQFCNDPFLDVYYHKNNKSWMKSEFRVYSSANNCTFEYVSQPFLMDL

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:04 NNKSWMESEFRVYSSA NNKSWMKSEFRVYSSA 795 115
HLA-DRB1*11:04 NNKSWMESEFRVYSSAN NNKSWMKSEFRVYSSAN 583 85
HLA-DRB1*11:01 KNNKSWMESEFRVYSSA KNNKSWMKSEFRVYSSA 1010 150
HLA-DRB1*11:04 HKNNKSWMESEFRVYSSAN HKNNKSWMKSEFRVYSSAN 1032 154
HLA-DRB1*11:01 NNKSWMESEFRVYSSAN NNKSWMKSEFRVYSSAN 851 128
HLA-DRB1*11:04 KNNKSWMESEFRVYSSA KNNKSWMKSEFRVYSSA 631 95
HLA-DRB1*11:04 NKSWMESEFRVYSSAN NKSWMKSEFRVYSSAN 715 109
HLA-DRB1*11:04 KNNKSWMESEFRVYSS KNNKSWMKSEFRVYSS 1184 182
HLA-DRB1*11:04 NNKSWMESEFRVYSSANNC NNKSWMKSEFRVYSSANNC 982 152
HLA-DRB1*11:04 KNNKSWMESEFRVYSSANN KNNKSWMKSEFRVYSSANN 946 147
HLA-DRB1*11:01 HKNNKSWMESEFRVYSS HKNNKSWMKSEFRVYSS 1737 276
HLA-DRB1*11:04 NKSWMESEFRVYSSANN NKSWMKSEFRVYSSANN 553 88
HLA-DRB1*11:01 HKNNKSWMESEFRVYSSAN HKNNKSWMKSEFRVYSSAN 1538 245
HLA-DRB1*11:04 HKNNKSWMESEFRVYSS HKNNKSWMKSEFRVYSS 1023 163
HLA-DRB1*11:04 YHKNNKSWMESEFRVYSSA YHKNNKSWMKSEFRVYSSA 1213 194
HLA-DRB1*11:04 KSWMESEFRVYSSANN KSWMKSEFRVYSSANN 719 115
HLA-DRB1*11:01 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 862 138
HLA-DRB1*11:04 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 578 93
HLA-DRB1*11:01 NNKSWMESEFRVYSSA NNKSWMKSEFRVYSSA 1086 176
HLA-DRB1*11:04 KSWMESEFRVYSSANNC KSWMKSEFRVYSSANNC 588 97
HLA-DRB1*11:04 NNKSWMESEFRVYSS NNKSWMKSEFRVYSS 427 71
HLA-DRB1*11:01 NKSWMESEFRVYSSANN NKSWMKSEFRVYSSANN 758 128
HLA-DRB1*11:01 KNNKSWMESEFRVYSS KNNKSWMKSEFRVYSS 1809 307
HLA-DRB1*11:04 HKNNKSWMESEFRVYSSANN HKNNKSWMKSEFRVYSSANN 521 89
HLA-DRB1*11:04 NKSWMESEFRVYSSANNCT NKSWMKSEFRVYSSANNCT 967 166
HLA-DRB1*11:01 NKSWMESEFRVYSSAN NKSWMKSEFRVYSSAN 895 156
HLA-DRB1*11:04 KNNKSWMESEFRVYSSANNC KNNKSWMKSEFRVYSSANNC 513 90
HLA-DRB1*11:01 NNKSWMESEFRVYSS NNKSWMKSEFRVYSS 789 139
HLA-DRB1*11:01 YHKNNKSWMESEFRVYSSA YHKNNKSWMKSEFRVYSSA 1831 324
HLA-DRB1*11:04 SWMESEFRVYSSANN SWMKSEFRVYSSANN 476 85
HLA-DRB1*11:04 HKNNKSWMESEFRVYSSA HKNNKSWMKSEFRVYSSA 2598 471
HLA-DRB1*11:04 NKSWMESEFRVYSSA NKSWMKSEFRVYSSA 259 47
HLA-DRB1*11:04 YYHKNNKSWMESEFRVYSSA YYHKNNKSWMKSEFRVYSSA 691 126
HLA-DRB1*11:01 KNNKSWMESEFRVYSSANN KNNKSWMKSEFRVYSSANN 1261 233
HLA-DRB1*11:04 KSWMESEFRVYSSAN KSWMKSEFRVYSSAN 243 45
HLA-DRB1*11:04 SWMESEFRVYSSANNC SWMKSEFRVYSSANNC 1339 248
HLA-DRB1*11:04 KNNKSWMESEFRVYS KNNKSWMKSEFRVYS 901 167
HLA-DRB1*11:01 KSWMESEFRVYSSANNC KSWMKSEFRVYSSANNC 766 142
HLA-DRB1*11:04 KNNKSWMESEFRVYSSAN KNNKSWMKSEFRVYSSAN 2229 419
HLA-DRB1*11:01 HKNNKSWMESEFRVYSSANN HKNNKSWMKSEFRVYSSANN 674 127
HLA-DRB1*11:01 NKSWMESEFRVYSSA NKSWMKSEFRVYSSA 435 82
HLA-DRB1*11:04 HKNNKSWMESEFRVYS HKNNKSWMKSEFRVYS 2305 437
HLA-DRB1*11:01 KSWMESEFRVYSSANN KSWMKSEFRVYSSANN 860 165
HLA-DRB1*11:04 NNKSWMESEFRVYSSANNCT NNKSWMKSEFRVYSSANNCT 502 97
HLA-DRB1*11:04 NNKSWMESEFRVYSSANN NNKSWMKSEFRVYSSANN 2221 433
HLA-DRB1*11:01 NNKSWMESEFRVYSSANNC NNKSWMKSEFRVYSSANNC 1194 236
HLA-DRB1*08:04 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 1394 276
HLA-DRB1*11:04 KSWMESEFRVYSSANNCTF KSWMKSEFRVYSSANNCTF 954 191
HLA-DRB1*11:04 NKSWMESEFRVYSSANNC NKSWMKSEFRVYSSANNC 2306 463
HLA-DRB1*11:04 YYHKNNKSWMESEFRVYSS YYHKNNKSWMKSEFRVYSS 1576 318
HLA-DRB1*11:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSWMKSEFRVYSSA 860 175
HLA-DRB1*11:02 HKNNKSWMESEFRVY HKNNKSWMKSEFRVY 1936 394
HLA-DRB1*13:01 HKNNKSWMESEFRVY HKNNKSWMKSEFRVY 1936 394
HLA-DRB1*11:01 KSWMESEFRVYSSAN KSWMKSEFRVYSSAN 383 78
HLA-DRB1*11:04 YHKNNKSWMESEFRVYS YHKNNKSWMKSEFRVYS 1784 364
HLA-DRB1*11:01 KNNKSWMESEFRVYSSANNC KNNKSWMKSEFRVYSSANNC 606 127
HLA-DRB1*11:01 KNNKSWMESEFRVYS KNNKSWMKSEFRVYS 1713 361
HLA-DRB1*11:01 SWMESEFRVYSSANN SWMKSEFRVYSSANN 716 153
HLA-DRB1*11:02 KNNKSWMESEFRVYS KNNKSWMKSEFRVYS 1276 274
HLA-DRB1*13:01 KNNKSWMESEFRVYS KNNKSWMKSEFRVYS 1276 274
HLA-DRB1*11:04 NKSWMESEFRVYSSANNCTF NKSWMKSEFRVYSSANNCTF 498 107
HLA-DRB1*11:04 SWMESEFRVYSSANNCT SWMKSEFRVYSSANNCT 976 210
HLA-DRB1*11:01 NKSWMESEFRVYSSANNCT NKSWMKSEFRVYSSANNCT 1142 247
HLA-DRB1*08:04 HKNNKSWMESEFRVYSSAN HKNNKSWMKSEFRVYSSAN 2239 496
HLA-DRB1*08:04 YYHKNNKSWMESEFRVYSSA YYHKNNKSWMKSEFRVYSSA 1503 333
HLA-DRB1*08:04 NNKSWMESEFRVYSSAN NNKSWMKSEFRVYSSAN 1511 340
HLA-DRB1*08:04 KNNKSWMESEFRVYSSA KNNKSWMKSEFRVYSSA 1643 370
HLA-DRB1*11:04 WMESEFRVYSSANNC WMKSEFRVYSSANNC 783 177
HLA-DRB1*11:02 NNKSWMESEFRVYSS NNKSWMKSEFRVYSS 979 222
HLA-DRB1*13:01 NNKSWMESEFRVYSS NNKSWMKSEFRVYSS 979 222
HLA-DRB1*08:04 NKSWMESEFRVYSSA NKSWMKSEFRVYSSA 844 195
HLA-DRB1*11:02 HKNNKSWMESEFRVYSS HKNNKSWMKSEFRVYSS 1993 462
HLA-DRB1*13:01 HKNNKSWMESEFRVYSS HKNNKSWMKSEFRVYSS 1993 462
HLA-DRB1*08:04 NNKSWMESEFRVYSS NNKSWMKSEFRVYSS 1280 297
HLA-DRB1*11:02 KNNKSWMESEFRVYSSA KNNKSWMKSEFRVYSSA 1639 384
HLA-DRB1*13:01 KNNKSWMESEFRVYSSA KNNKSWMKSEFRVYSSA 1639 384
HLA-DRB1*11:04 HKNNKSWMESEFRVY HKNNKSWMKSEFRVY 2054 483
HLA-DRB1*08:04 KSWMESEFRVYSSAN KSWMKSEFRVYSSAN 780 184
HLA-DRB1*11:01 NNKSWMESEFRVYSSANNCT NNKSWMKSEFRVYSSANNCT 555 132
HLA-DRB1*08:04 NNKSWMESEFRVYSSA NNKSWMKSEFRVYSSA 1696 406
HLA-DRB1*11:04 KSWMESEFRVYSSANNCTFE KSWMKSEFRVYSSANNCTFE 547 131
HLA-DRB1*11:02 NKSWMESEFRVYSSA NKSWMKSEFRVYSSA 729 175
HLA-DRB1*13:01 NKSWMESEFRVYSSA NKSWMKSEFRVYSSA 729 175
HLA-DRB1*08:04 NKSWMESEFRVYSSAN NKSWMKSEFRVYSSAN 1489 363
HLA-DRB1*11:02 NNKSWMESEFRVYSSAN NNKSWMKSEFRVYSSAN 1634 407
HLA-DRB1*13:01 NNKSWMESEFRVYSSAN NNKSWMKSEFRVYSSAN 1634 407
HLA-DRB1*11:01 SWMESEFRVYSSANNC SWMKSEFRVYSSANNC 1415 353
HLA-DRB1*11:02 KSWMESEFRVYSSAN KSWMKSEFRVYSSAN 726 186
HLA-DRB1*13:01 KSWMESEFRVYSSAN KSWMKSEFRVYSSAN 726 186
HLA-DRB1*11:02 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 1263 324
HLA-DRB1*13:01 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 1263 324
HLA-DRB1*11:04 VYYHKNNKSWMESEFRVYSS VYYHKNNKSWMKSEFRVYSS 738 192
HLA-DRB1*08:04 HKNNKSWMESEFRVYSSANN HKNNKSWMKSEFRVYSSANN 806 210
HLA-DRB1*11:01 KSWMESEFRVYSSANNCTF KSWMKSEFRVYSSANNCTF 1028 271
HLA-DRB1*11:01 YYHKNNKSWMESEFRVYSS YYHKNNKSWMKSEFRVYSS 1827 486
HLA-DRB1*11:04 WMESEFRVYSSANNCT WMKSEFRVYSSANNCT 1767 478
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 104 384
HLA-DRB1*08:04 NKSWMESEFRVYSSANN NKSWMKSEFRVYSSANN 1026 279
HLA-DRB1*08:04 KNNKSWMESEFRVYSSANNC KNNKSWMKSEFRVYSSANNC 734 203
HLA-DRB1*08:04 KNNKSWMESEFRVYSSANN KNNKSWMKSEFRVYSSANN 1492 415
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 171 609
HLA-DRB1*11:01 NKSWMESEFRVYSSANNCTF NKSWMKSEFRVYSSANNCTF 491 138
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 334 1180
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 291 1026
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 266 931
HLA-DRB1*08:04 KSWMESEFRVYSSANN KSWMKSEFRVYSSANN 1118 322
HLA-DRB1*11:02 NKSWMESEFRVYSSANN NKSWMKSEFRVYSSANN 1332 384
HLA-DRB1*13:01 NKSWMESEFRVYSSANN NKSWMKSEFRVYSSANN 1332 384
HLA-DRB1*11:01 SWMESEFRVYSSANNCT SWMKSEFRVYSSANNCT 1060 306
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 145 500
HLA-DRB1*11:04 SWMESEFRVYSSANNCTFE SWMKSEFRVYSSANNCTFE 1536 449
HLA-DRB1*08:04 NNKSWMESEFRVYSSANNC NNKSWMKSEFRVYSSANNC 1405 412
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 432 1470
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 87 296
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLDVYYHKNNKSWMKSEF 228 755
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 490 1621
HLA-DRB1*11:02 HKNNKSWMESEFRVYSSANN HKNNKSWMKSEFRVYSSANN 960 292
HLA-DRB1*13:01 HKNNKSWMESEFRVYSSANN HKNNKSWMKSEFRVYSSANN 960 292
HLA-DRB1*08:04 VYYHKNNKSWMESEFRVYSS VYYHKNNKSWMKSEFRVYSS 1334 407
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 141 461
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 81 264
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 178 580
HLA-DRB1*11:02 YYHKNNKSWMESEFRVYSSA YYHKNNKSWMKSEFRVYSSA 941 291
HLA-DRB1*13:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSWMKSEFRVYSSA 941 291
HLA-DRB1*08:04 SWMESEFRVYSSANN SWMKSEFRVYSSANN 857 266
HLA-DRB1*08:04 KSWMESEFRVYSSANNC KSWMKSEFRVYSSANNC 899 280
HLA-DRB1*08:02 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 1521 474
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 122 391
HLA-DRB1*11:01 KSWMESEFRVYSSANNCTFE KSWMKSEFRVYSSANNCTFE 518 162
HLA-DRB1*15:01 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 1398 439
HLA-DRB1*11:02 KSWMESEFRVYSSANNC KSWMKSEFRVYSSANNC 1310 412
HLA-DRB1*13:01 KSWMESEFRVYSSANNC KSWMKSEFRVYSSANNC 1310 412
HLA-DRB1*11:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSWMKSEFRVYSS 677 213
HLA-DRB1*15:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSWMKSEFRVYSSA 1374 436
HLA-DRB1*11:02 KNNKSWMESEFRVYSSANNC KNNKSWMKSEFRVYSSANNC 912 293
HLA-DRB1*13:01 KNNKSWMESEFRVYSSANNC KNNKSWMKSEFRVYSSANNC 912 293
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 434 1346
HLA-DRB1*08:04 NNKSWMESEFRVYSSANNCT NNKSWMKSEFRVYSSANNCT 614 198
HLA-DRB1*11:02 SWMESEFRVYSSANN SWMKSEFRVYSSANN 906 293
HLA-DRB1*13:01 SWMESEFRVYSSANN SWMKSEFRVYSSANN 906 293
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 401 1230
HLA-DRB1*08:04 NKSWMESEFRVYSSANNCT NKSWMKSEFRVYSSANNCT 1216 399
HLA-DRB1*11:04 WMESEFRVYSSANNCTF WMKSEFRVYSSANNCTF 1093 360
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 122 367
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 113 337
HLA-DRB1*11:04 SWMESEFRVYSSANNCTFEY SWMKSEFRVYSSANNCTFEY 845 284
HLA-DRB1*11:02 KSWMESEFRVYSSANN KSWMKSEFRVYSSANN 1432 488
HLA-DRB1*13:01 KSWMESEFRVYSSANN KSWMKSEFRVYSSANN 1432 488
HLA-DRB1*11:01 WMESEFRVYSSANNC WMKSEFRVYSSANNC 848 293
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 67 189
HLA-DRB1*08:02 NKSWMESEFRVYSSA NKSWMKSEFRVYSSA 1266 460
HLA-DRB1*08:02 KSWMESEFRVYSSAN KSWMKSEFRVYSSAN 1133 415
HLA-DQA1*01:02/DQB1*06:09 VYYHKNNKSWMESEFRVYSS VYYHKNNKSWMKSEFRVYSS 495 1336
HLA-DRB1*11:02 YYHKNNKSWMESEFR YYHKNNKSWMKSEFR 1185 441
HLA-DRB1*13:01 YYHKNNKSWMESEFR YYHKNNKSWMKSEFR 1185 441
HLA-DRB1*08:04 SWMESEFRVYSSANNC SWMKSEFRVYSSANNC 1273 478
HLA-DQA1*01:02/DQB1*06:09 YYHKNNKSWMESEFRVYSSA YYHKNNKSWMKSEFRVYSSA 492 1308
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESE PFLDVYYHKNNKSWMKSE 451 1194
HLA-DRB1*11:02 VYYHKNNKSWMESEFRVYSS VYYHKNNKSWMKSEFRVYSS 613 232
HLA-DRB1*13:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSWMKSEFRVYSS 613 232
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 290 760
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 290 760
HLA-DRB1*08:04 NKSWMESEFRVYSSANNCTF NKSWMKSEFRVYSSANNCTF 494 189
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 336 876
HLA-DRB1*11:02 VYYHKNNKSWMESEFRVYS VYYHKNNKSWMKSEFRVYS 1158 446
HLA-DRB1*13:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSWMKSEFRVYS 1158 446
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 314 812
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 314 812
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 442 1134
HLA-DRB1*08:04 KSWMESEFRVYSSANNCTF KSWMKSEFRVYSSANNCTF 976 381
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 111 283
HLA-DRB1*11:02 NNKSWMESEFRVYSSANNCT NNKSWMKSEFRVYSSANNCT 732 289
HLA-DRB1*13:01 NNKSWMESEFRVYSSANNCT NNKSWMKSEFRVYSSANNCT 732 289
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 169 428
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 220 550
HLA-DPA1*03:01/DPB1*04:02 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 346 864
HLA-DPA1*03:01/DPB1*105:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 346 864
HLA-DPA1*02:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 495 1235
HLA-DQA1*01:02/DQB1*06:09 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 499 1243
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 377 936
HLA-DRB1*15:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSWMKSEFRVYSS 891 359
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 186 461
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMES DPFLDVYYHKNNKSWMKS 274 676
HLA-DRB1*08:02 HKNNKSWMESEFRVYSSANN HKNNKSWMKSEFRVYSSANN 724 294
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 252 618
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 277 677
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 424 1034
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 89 217
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLDVYYHKNNKSWMKSEF 218 528
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 489 1184
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 489 1184
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 223 539
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 237 572
HLA-DRB1*08:02 NKSWMESEFRVYSSANN NKSWMKSEFRVYSSANN 1047 436
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 146 350
HLA-DRB1*08:04 WMESEFRVYSSANNC WMKSEFRVYSSANNC 857 358
HLA-DRB1*08:04 KSWMESEFRVYSSANNCTFE KSWMKSEFRVYSSANNCTFE 481 201
HLA-DRB1*11:02 VYYHKNNKSWMESEFRV VYYHKNNKSWMKSEFRV 881 370
HLA-DRB1*13:01 VYYHKNNKSWMESEFRV VYYHKNNKSWMKSEFRV 881 370
HLA-DRB1*11:02 WMESEFRVYSSANNC WMKSEFRVYSSANNC 1007 423
HLA-DRB1*13:01 WMESEFRVYSSANNC WMKSEFRVYSSANNC 1007 423
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLDVYYHKNNKSWMKSEF 179 424
HLA-DRB1*08:04 SWMESEFRVYSSANNCT SWMKSEFRVYSSANNCT 907 383
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 326 766
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 258 605
HLA-DRB1*08:02 KSWMESEFRVYSSANN KSWMKSEFRVYSSANN 1014 433
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 325 761
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 98 229
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 84 196
HLA-DRB1*01:01 NNKSWMESEFRVYSS NNKSWMKSEFRVYSS 697 299
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 430 995
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 355 821
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWME NDPFLDVYYHKNNKSWMK 210 485
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 152 351
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 150 346
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 158 364
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 168 386
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 343 787
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 150 344
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 373 855
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 132 302
HLA-DRB1*01:01 NKSWMESEFRVYSSA NKSWMKSEFRVYSSA 612 268
HLA-DRB1*11:04 MESEFRVYSSANNCT MKSEFRVYSSANNCT 1059 464
HLA-DRB1*07:01 NKSWMESEFRVYSSA NKSWMKSEFRVYSSA 994 436
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 91 207
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 445 1010
HLA-DRB1*07:01 NNKSWMESEFRVYSS NNKSWMKSEFRVYSS 1076 475
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 466 1051
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 411 921
HLA-DPA1*02:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 383 857
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 392 875
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 87 194
HLA-DRB1*07:01 KNNKSWMESEFRVYS KNNKSWMKSEFRVYS 1056 475
HLA-DPA1*01:03/DPB1*02:01 FLGVYYHKNNKSWME FLDVYYHKNNKSWMK 452 1004
HLA-DRB1*10:01 HKNNKSWMESEFRVYSS HKNNKSWMKSEFRVYSS 1009 455
HLA-DRB1*08:02 KSWMESEFRVYSSANNC KSWMKSEFRVYSSANNC 820 372
HLA-DRB1*10:01 KNNKSWMESEFRVYSSA KNNKSWMKSEFRVYSSA 791 359
HLA-DRB1*07:01 KSWMESEFRVYSSAN KSWMKSEFRVYSSAN 1067 485
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 361 794
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 337 741
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESE PFLDVYYHKNNKSWMKSE 420 923
HLA-DPA1*03:01/DPB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 238 523
HLA-DPA1*03:01/DPB1*105:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 238 523
HLA-DRB1*11:04 WMESEFRVYSSANNCTFEYV WMKSEFRVYSSANNCTFEYV 1014 462
HLA-DRB1*10:01 NNKSWMESEFRVYSSAN NNKSWMKSEFRVYSSAN 782 357
HLA-DRB1*08:02 KNNKSWMESEFRVYSSANNC KNNKSWMKSEFRVYSSANNC 564 258
HLA-DRB1*01:01 KNNKSWMESEFRVYS KNNKSWMKSEFRVYS 736 337
HLA-DRB1*01:01 KSWMESEFRVYSSAN KSWMKSEFRVYSSAN 653 299
HLA-DRB1*10:01 NNKSWMESEFRVYSSA NNKSWMKSEFRVYSSA 906 417
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 398 864
HLA-DRB1*10:01 NKSWMESEFRVYSSAN NKSWMKSEFRVYSSAN 874 403
HLA-DRB1*10:01 HKNNKSWMESEFRVYSSAN HKNNKSWMKSEFRVYSSAN 917 423
HLA-DRB1*01:01 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 787 364
HLA-DPA1*04:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 200 429
HLA-DRB1*01:01 HKNNKSWMESEFRVY HKNNKSWMKSEFRVY 978 456
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 141 301
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 268 572
HLA-DPA1*02:02/DPB1*01:01 PFLGVYYHKNNKSWMES PFLDVYYHKNNKSWMKS 390 830
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 481 1023
HLA-DPA1*02:02/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 496 1052
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 141 298
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 135 285
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 73 154
HLA-DRB1*11:01 SWMESEFRVYSSANNCTFEY SWMKSEFRVYSSANNCTFEY 632 301
HLA-DRB1*08:02 SWMESEFRVYSSANN SWMKSEFRVYSSANN 812 387
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMES DPFLDVYYHKNNKSWMKS 279 585
HLA-DRB1*11:04 GVYYHKNNKSWMESEFRVYS DVYYHKNNKSWMKSEFRVYS 639 305
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 130 272
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFLDVYYHKNNKSWMKSEF 254 531
HLA-DRB1*10:01 YHKNNKSWMESEFRVYSSA YHKNNKSWMKSEFRVYSSA 970 464
HLA-DRB1*15:01 NKSWMESEFRVYSSANN NKSWMKSEFRVYSSANN 474 227
HLA-DRB1*11:02 VYYHKNNKSWMESEFR VYYHKNNKSWMKSEFR 966 463
HLA-DRB1*13:01 VYYHKNNKSWMESEFR VYYHKNNKSWMKSEFR 966 463
HLA-DPA1*03:01/DPB1*04:02 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 492 1026
HLA-DPA1*03:01/DPB1*105:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 492 1026
HLA-DRB1*11:01 WMESEFRVYSSANNCTF WMKSEFRVYSSANNCTF 894 429
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 120 250
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 206 429
HLA-DPA1*04:01/DPB1*04:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 450 937
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFLDVYYHKNNKSWMKSE 224 466
HLA-DRB1*11:01 VYYHKNNKSWMESEFRV VYYHKNNKSWMKSEFRV 994 479
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMESEF PFLDVYYHKNNKSWMKSEF 496 1028
HLA-DPA1*04:01/DPB1*04:01 PFLGVYYHKNNKSWME PFLDVYYHKNNKSWMK 477 985
HLA-DRB1*10:01 NNKSWMESEFRVYSS NNKSWMKSEFRVYSS 658 319
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWMESE DPFLDVYYHKNNKSWMKSE 335 689
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLDVYYHKNNKSWMKS 332 682
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWME DPFLDVYYHKNNKSWMK 296 607
HLA-DRB1*08:02 NKSWMESEFRVYSSANNCT NKSWMKSEFRVYSSANNCT 932 456
HLA-DRB1*11:02 NKSWMESEFRVYSSANNCTF NKSWMKSEFRVYSSANNCTF 532 261
HLA-DRB1*13:01 NKSWMESEFRVYSSANNCTF NKSWMKSEFRVYSSANNCTF 532 261
HLA-DRB1*01:01 KNNKSWMESEFRVYSSANN KNNKSWMKSEFRVYSSANN 878 431
HLA-DRB1*10:01 YHKNNKSWMESEFRVYSSAN YHKNNKSWMKSEFRVYSSAN 499 245
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMESEFR PFLDVYYHKNNKSWMKSEFR 357 726
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESE PFLDVYYHKNNKSWMKSE 374 760
HLA-DRB1*01:01 NKSWMESEFRVYSSANN NKSWMKSEFRVYSSANN 704 347
HLA-DPA1*01:03/DPB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 498 1009
HLA-DPA1*01:03/DPB1*105:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 498 1009
HLA-DRB1*01:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSWMKSEFRVYSSA 706 350
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 71 143
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFLDVYYHKNNKSWMK 275 552
HLA-DPA1*03:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFLDVYYHKNNKSWMK 174 348
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFLDVYYHKNNKSWMKS 293 586

L452R

Reference  DDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    DDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRL LDSKVGGNYNYRYRL 424 3666
HLA-DPA1*03:01/DPB1*02:01 WNSNNLDSKVGGNYNYLYRL WNSNNLDSKVGGNYNYRYRL 415 2864
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 144 966
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 249 1634
HLA-DPA1*03:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 113 734
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 392 2542
HLA-DPA1*03:01/DPB1*04:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 305 1960
HLA-DPA1*03:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 218 1391
HLA-DPA1*03:01/DPB1*04:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 256 1631
HLA-DPA1*03:01/DPB1*04:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 345 2181
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 173 1093
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 359 2266
HLA-DPA1*03:01/DPB1*04:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 401 2531
HLA-DPA1*03:01/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 172 1064
HLA-DPA1*03:01/DPB1*02:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 196 1212
HLA-DPA1*03:01/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 144 883
HLA-DPA1*03:01/DPB1*04:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 441 2693
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 218 1325
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLF DSKVGGNYNYRYRLF 261 1555
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLF NLDSKVGGNYNYRYRLF 361 2150
HLA-DPA1*03:01/DPB1*04:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 305 1801
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 309 1809
HLA-DPA1*03:01/DPB1*04:02 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 444 2598
HLA-DPA1*03:01/DPB1*105:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 444 2598
HLA-DPA1*03:01/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 143 835
HLA-DPA1*03:01/DPB1*02:01 SNNLDSKVGGNYNYLYRLF SNNLDSKVGGNYNYRYRLF 324 1887
HLA-DPA1*03:01/DPB1*02:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 252 1455
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 351 2010
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLF LDSKVGGNYNYRYRLF 295 1679
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLFR NLDSKVGGNYNYRYRLFR 455 2516
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLFRK LDSKVGGNYNYRYRLFRK 304 1659
HLA-DPA1*03:01/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 244 1247
HLA-DPA1*01:03/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 439 2221
HLA-DPA1*01:03/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 317 1603
HLA-DPA1*03:01/DPB1*01:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 342 1688
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 424 2025
HLA-DPA1*03:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 322 1525
HLA-DPA1*01:03/DPB1*02:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 457 2136
HLA-DPA1*04:01/DPB1*02:01 DSKVGGNYNYLYRLF DSKVGGNYNYRYRLF 449 2083
HLA-DPA1*04:01/DPB1*02:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 325 1506
HLA-DPA1*03:01/DPB1*01:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 422 1941
HLA-DPA1*04:01/DPB1*02:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 419 1926
HLA-DRB1*11:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN