Summary

This strain contains 15 protein-level mutations:

  • 2 mutations in Spike protein: M153T, D614G
  • 3 mutations in N protein: 203-204 RG->KR, G214C, P383L
  • 2 mutations in NS9c protein: G50N, M60I
  • 4 mutations in NSP3 protein: T428I, T725I, P1469S, F1569V
  • 1 mutation in NSP4 protein: L438P
  • 1 mutation in NSP6 protein: SGF 106-108 deletion
  • 1 mutation in NSP12 protein: P323L
  • 1 mutation in NSP16 protein: G213N

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

M153T

Reference  IKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    IKVCEFQFCNDPFLGVYYHKNNKSWTESEFRVYSSANNCTFEYVSQPFLMD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*14:02 YYHKNNKSWM YYHKNNKSWT 19 3532
HLA-A*02:11 WMESEFRV WTESEFRV 156 9367
HLA-A*02:02 WMESEFRV WTESEFRV 320 13375
HLA-C*14:02 VYYHKNNKSWM VYYHKNNKSWT 327 13438
HLA-C*14:02 YHKNNKSWM YHKNNKSWT 392 15878
HLA-B*15:03 WMESEFRVY WTESEFRVY 10 283
HLA-A*02:02 WMESEFRVYS WTESEFRVYS 286 8023
HLA-B*15:01 WMESEFRVY WTESEFRVY 67 968
HLA-A*02:11 SWMESEFRV SWTESEFRV 262 3764
HLA-B*15:03 SWMESEFRVY SWTESEFRVY 196 2797
HLA-A*01:01 WMESEFRVY WTESEFRVY 544 43
HLA-B*15:01 SWMESEFRVY SWTESEFRVY 308 3578
HLA-A*01:01 SWMESEFRVY SWTESEFRVY 3515 398
HLA-A*23:01 SWMESEFRV SWTESEFRV 458 3488
HLA-B*15:03 MESEFRVY TESEFRVY 180 1193
HLA-A*29:02 SWMESEFRVY SWTESEFRVY 49 319
HLA-A*29:02 WMESEFRVY WTESEFRVY 109 700
HLA-C*16:01 WMESEFRVY WTESEFRVY 686 136
HLA-B*50:01 MESEFRVYS TESEFRVYS 146 656
HLA-C*14:02 SWMESEFRVY SWTESEFRVY 111 479
HLA-C*14:02 WMESEFRVY WTESEFRVY 387 1614
HLA-B*50:01 MESEFRVYSSA TESEFRVYSSA 142 589
HLA-B*18:01 MESEFRVYS TESEFRVYS 338 1347
HLA-B*40:06 MESEFRVYS TESEFRVYS 299 966
HLA-B*40:02 MESEFRVYS TESEFRVYS 383 1188
HLA-A*30:02 SWMESEFRVY SWTESEFRVY 183 564
HLA-B*40:06 MESEFRVYSSA TESEFRVYSSA 248 679
HLA-B*18:01 MESEFRVY TESEFRVY 11 30
HLA-B*35:01 WMESEFRVY WTESEFRVY 336 892
HLA-B*44:03 MESEFRVY TESEFRVY 439 1130
HLA-B*40:02 MESEFRVYSSA TESEFRVYSSA 453 1080
HLA-B*15:03 KSWMESEFRVY KSWTESEFRVY 250 549
HLA-A*30:02 WMESEFRVY WTESEFRVY 342 729
HLA-B*45:01 MESEFRVYSS TESEFRVYSS 143 302
HLA-B*45:01 MESEFRVYS TESEFRVYS 54 110

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*05:01 YQDVNCTEV YQGVNCTEV 82 8597
HLA-C*08:02 YQDVNCTEV YQGVNCTEV 89 8066
HLA-A*02:11 DVNCTEVPV GVNCTEVPV 2140 72
HLA-A*02:02 DVNCTEVPV GVNCTEVPV 4099 213
HLA-A*68:02 DVNCTEVPV GVNCTEVPV 36 659
HLA-A*02:06 DVNCTEVPV GVNCTEVPV 3807 208
HLA-A*68:02 QVAVLYQDV QVAVLYQGV 183 13
HLA-A*68:02 NQVAVLYQDV NQVAVLYQGV 650 52
HLA-A*02:06 QVAVLYQDV QVAVLYQGV 1312 148
HLA-A*02:11 QVAVLYQDV QVAVLYQGV 2169 268
HLA-A*68:02 NTSNQVAVLYQDV NTSNQVAVLYQGV 1858 231
HLA-A*68:02 TSNQVAVLYQDV TSNQVAVLYQGV 3281 457
HLA-A*02:02 QVAVLYQDV QVAVLYQGV 1107 188
HLA-A*02:01 YQDVNCTEV YQGVNCTEV 75 315
HLA-A*02:06 YQDVNCTEV YQGVNCTEV 17 57
HLA-A*02:11 VLYQDVNCT VLYQGVNCT 224 74
HLA-A*02:11 YQDVNCTEV YQGVNCTEV 31 93
HLA-A*02:11 VLYQDVNCTEVP VLYQGVNCTEVP 1000 402
HLA-A*02:02 NQVAVLYQDV NQVAVLYQGV 269 116
HLA-A*02:11 AVLYQDVNCTEV AVLYQGVNCTEV 500 238
HLA-A*02:01 NQVAVLYQDV NQVAVLYQGV 558 267
HLA-A*02:06 NQVAVLYQDV NQVAVLYQGV 36 18

N protein

N

203-204 RG->KR

Reference  GGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQ
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    GGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNCGDAALALLLLDRLNQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:01 NSTPGSSRG NSTPGSSKR 32767 34
HLA-A*33:03 NSTPGSSRG NSTPGSSKR 32767 300
HLA-B*15:03 SRGTSPARM SKRTSPARM 2669 106
HLA-A*31:01 RNSTPGSSRG RNSTPGSSKR 7013 340
HLA-A*30:01 SSRNSTPGSSR SSRNSTPGSSK 356 20
HLA-A*30:01 GTSPARMAG RTSPARMAG 493 30
HLA-A*31:01 SSRNSTPGSSRG SSRNSTPGSSKR 3757 231
HLA-A*31:01 SSRNSTPGSSR SSRNSTPGSSK 127 1853
HLA-A*30:01 NSSRNSTPGSSR NSSRNSTPGSSK 4255 353
HLA-A*30:01 RNSTPGSSR RNSTPGSSK 2120 188
HLA-A*31:01 RNSTPGSSR RNSTPGSSK 123 1335
HLA-A*03:01 SSRNSTPGSSR SSRNSTPGSSK 4753 442
HLA-A*11:01 SSRNSTPGSSR SSRNSTPGSSK 2231 263
HLA-A*68:01 NSSRNSTPGSSR NSSRNSTPGSSK 270 1385
HLA-A*30:01 GSSRGTSPA GSSKRTSPA 555 145
HLA-A*30:01 SSRNSTPGSSRG SSRNSTPGSSKR 1625 469
HLA-A*30:01 SSRGTSPARMAG SSKRTSPARMAG 449 1031

G214C

Reference  RSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    RSRNSSRNSTPGSSKRTSPARMAGNCGDAALALLLLDRLNQLESKMSGKGQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*08:02 GGDAALALL CGDAALALL 759 279
HLA-A*02:02 RMAGNGGDAA RMAGNCGDAA 845 327
HLA-C*05:01 GGDAALALL CGDAALALL 462 188
HLA-A*02:11 RMAGNGGDAAL RMAGNCGDAAL 406 192

P383L

Reference  DAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    DAYKTFPPTEPKKDKKKKADETQALLQRQKKQQTVTLLPAADLDDFSKQLQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*05:01 KADETQALP KADETQALL 9174 9
HLA-C*08:02 KADETQALP KADETQALL 11640 15
HLA-C*17:01 KADETQALP KADETQALL 22549 45
HLA-C*05:01 KKADETQALP KKADETQALL 25295 149
HLA-C*08:01 KADETQALP KADETQALL 26628 171
HLA-C*03:03 KADETQALP KADETQALL 32767 260
HLA-C*03:04 KADETQALP KADETQALL 32767 260
HLA-C*08:02 KKADETQALP KKADETQALL 29830 316
HLA-B*42:01 LPQRQKKQQTVTL LLQRQKKQQTVTL 175 12764
HLA-C*16:01 KADETQALP KADETQALL 27175 385
HLA-C*15:02 KADETQALP KADETQALL 23236 380

NS9c protein

NS9c

G50N

Reference  AAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           ||||||||||||||||||||||||| |||||||||||||||||||||||
Mutated    AAVKPLLVPHHVVATVQEIQLQAAVNELLLLEWLAIAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*18:01 GELLLLEW NELLLLEW 3915 401
HLA-A*02:11 GELLLLEWLAMA NELLLLEWLAIA 29 160
HLA-A*02:01 GELLLLEWLAMA NELLLLEWLAIA 109 593
HLA-B*40:01 GELLLLEWL NELLLLEWL 28 140
HLA-A*02:11 QLQAAVGEL QLQAAVNEL 120 27
HLA-A*02:11 IQLQAAVGEL IQLQAAVNEL 338 81
HLA-B*40:02 GELLLLEWL NELLLLEWL 52 204
HLA-B*40:02 GELLLLEWLAM NELLLLEWLAI 201 733
HLA-A*02:01 QLQAAVGEL QLQAAVNEL 1290 358
HLA-A*02:02 GELLLLEWLAMA NELLLLEWLAIA 428 1431
HLA-A*02:02 QLQAAVGEL QLQAAVNEL 92 28
HLA-B*58:01 VGELLLLEW VNELLLLEW 330 1071
HLA-A*02:06 GELLLLEWLAMA NELLLLEWLAIA 396 1246
HLA-A*02:11 VGELLLLEWLAMA VNELLLLEWLAIA 70 207
HLA-A*02:02 IQLQAAVGEL IQLQAAVNEL 170 58
HLA-A*02:11 AVGELLLLEWLAMA AVNELLLLEWLAIA 76 220
HLA-A*02:01 LQAAVGELL LQAAVNELL 938 352
HLA-A*02:02 LQAAVGELL LQAAVNELL 44 17
HLA-B*40:06 GELLLLEWLA NELLLLEWLA 268 677
HLA-B*40:02 GELLLLEWLA NELLLLEWLA 475 1195
HLA-A*02:11 LQAAVGELL LQAAVNELL 386 154
HLA-A*02:01 IQLQAAVGEL IQLQAAVNEL 1138 475
HLA-A*02:01 QLQAAVGELL QLQAAVNELL 961 403
HLA-A*02:02 QLQAAVGELL QLQAAVNELL 35 15
HLA-A*02:02 IQLQAAVGELL IQLQAAVNELL 724 313
HLA-A*02:11 QLQAAVGELL QLQAAVNELL 303 131
HLA-B*58:01 AVGELLLLEW AVNELLLLEW 196 87
HLA-A*02:01 VGELLLLEWLAMA VNELLLLEWLAIA 298 664
HLA-A*02:01 AVGELLLLEWLAMA AVNELLLLEWLAIA 340 724
HLA-B*57:01 AVGELLLLEW AVNELLLLEW 432 206
HLA-A*68:02 EIQLQAAVGELL EIQLQAAVNELL 697 346

M60I

Reference  HVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           ||||||||||||||||||||||||| |||||||||||||
Mutated    HVVATVQEIQLQAAVNELLLLEWLAIAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 AMAVMLLLL AIAVMLLLL 13 198
HLA-A*02:01 AMAVMLLLL AIAVMLLLL 51 683
HLA-B*15:03 LLLLEWLAM LLLLEWLAI 118 1425
HLA-A*02:11 LAMAVMLLLL LAIAVMLLLL 144 1637
HLA-A*02:02 AMAVMLLLL AIAVMLLLL 14 147
HLA-A*02:02 AMAVMLLLLC AIAVMLLLLC 318 3251
HLA-A*02:02 AMAVMLLL AIAVMLLL 401 4083
HLA-A*02:02 LAMAVMLLLL LAIAVMLLLL 63 552
HLA-A*02:11 LLLLEWLAM LLLLEWLAI 283 33
HLA-A*02:01 LAMAVMLLLL LAIAVMLLLL 247 1862
HLA-A*02:11 LAMAVMLLL LAIAVMLLL 92 689
HLA-A*02:01 LAMAVMLLL LAIAVMLLL 196 1146
HLA-A*02:11 GELLLLEWLAMA NELLLLEWLAIA 29 160
HLA-A*02:01 LLLLEWLAM LLLLEWLAI 573 105
HLA-A*02:01 GELLLLEWLAMA NELLLLEWLAIA 109 593
HLA-A*02:11 LLEWLAMAVMLLL LLEWLAIAVMLLL 208 1096
HLA-A*02:02 LAMAVMLLL LAIAVMLLL 148 704
HLA-A*02:11 LLLEWLAM LLLEWLAI 188 40
HLA-A*02:01 LLLEWLAM LLLEWLAI 902 208
HLA-A*02:06 LAMAVMLLL LAIAVMLLL 40 158
HLA-C*16:01 LAMAVMLL LAIAVMLL 182 703
HLA-A*02:06 LLLLEWLAM LLLLEWLAI 763 204
HLA-B*40:02 GELLLLEWLAM NELLLLEWLAI 201 733
HLA-C*15:02 LAMAVMLLL LAIAVMLLL 139 501
HLA-A*02:11 LLEWLAMA LLEWLAIA 101 354
HLA-A*02:06 LAMAVMLLLL LAIAVMLLLL 148 511
HLA-A*02:02 LLLLEWLAM LLLLEWLAI 1379 400
HLA-C*16:01 LAMAVMLLL LAIAVMLLL 61 205
HLA-A*02:02 GELLLLEWLAMA NELLLLEWLAIA 428 1431
HLA-B*53:01 LAMAVMLLL LAIAVMLLL 461 1514
HLA-A*02:06 GELLLLEWLAMA NELLLLEWLAIA 396 1246
HLA-A*02:11 VGELLLLEWLAMA VNELLLLEWLAIA 70 207
HLA-A*02:11 AVGELLLLEWLAMA AVNELLLLEWLAIA 76 220
HLA-A*02:06 AMAVMLLLL AIAVMLLLL 156 448
HLA-A*02:11 WLAMAVMLLL WLAIAVMLLL 16 45
HLA-B*58:01 LAMAVMLLL LAIAVMLLL 42 115
HLA-A*02:11 ELLLLEWLAMA ELLLLEWLAIA 299 818
HLA-A*02:11 WLAMAVMLLLL WLAIAVMLLLL 254 667
HLA-A*02:01 WLAMAVMLLL WLAIAVMLLL 58 152
HLA-C*17:01 LAMAVMLLL LAIAVMLLL 113 294
HLA-B*15:03 LAMAVMLLL LAIAVMLLL 177 441
HLA-A*02:06 WLAMAVMLLL WLAIAVMLLL 185 447
HLA-B*58:01 LAMAVMLLLL LAIAVMLLLL 185 429
HLA-A*02:01 VGELLLLEWLAMA VNELLLLEWLAIA 298 664
HLA-A*02:01 AVGELLLLEWLAMA AVNELLLLEWLAIA 340 724
HLA-A*02:06 LLLLEWLAMA LLLLEWLAIA 49 101
HLA-A*68:02 LAMAVMLLL LAIAVMLLL 266 546
HLA-A*02:01 LLLLEWLAMA LLLLEWLAIA 23 47
HLA-A*02:11 LLLLEWLAMA LLLLEWLAIA 8 16
HLA-C*03:03 LAMAVMLLL LAIAVMLLL 36 72
HLA-C*03:04 LAMAVMLLL LAIAVMLLL 36 72

NSP3 protein

NSP3

T428I

Reference  SVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SVEQRKQDDKKIKACVEEVTTTLEEIKFLTENLLLYIDINGNLHPDSATLV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:02 EVTTTLEET EVTTTLEEI 835 45
HLA-A*68:02 EEVTTTLEET EEVTTTLEEI 5842 416
HLA-A*01:01 ETKFLTENLLLY EIKFLTENLLLY 499 3969
HLA-B*40:02 EETKFLTENL EEIKFLTENL 1267 272
HLA-A*68:02 ETKFLTENLL EIKFLTENLL 78 359
HLA-B*44:03 EETKFLTENL EEIKFLTENL 1657 429
HLA-A*68:02 EETKFLTENL EEIKFLTENL 349 1239
HLA-A*02:11 TLEETKFLT TLEEIKFLT 1055 305
HLA-A*02:06 TTLEETKFL TTLEEIKFL 1511 453
HLA-B*18:01 EETKFLTENLLLY EEIKFLTENLLLY 1116 339
HLA-A*68:02 ETKFLTENL EIKFLTENL 34 110
HLA-B*40:01 EETKFLTENL EEIKFLTENL 1220 446
HLA-B*44:03 EETKFLTENLLLY EEIKFLTENLLLY 633 244
HLA-B*15:03 TKFLTENLL IKFLTENLL 211 85
HLA-B*15:03 TKFLTENLLL IKFLTENLLL 627 279
HLA-A*26:01 ETKFLTENLLLY EIKFLTENLLLY 253 556

T725I

Reference  GQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTI
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    GQSTQLGIEFLKRGDKSVYYTSNPTIFHLDGEVITFDNLKTLLSLREVRTI

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*24:02 VYYTSNPTT VYYTSNPTI 9554 38
HLA-A*23:01 VYYTSNPTT VYYTSNPTI 7288 33
HLA-A*24:02 SVYYTSNPTT SVYYTSNPTI 21832 386
HLA-A*23:01 SVYYTSNPTT SVYYTSNPTI 18764 334
HLA-B*58:01 KSVYYTSNPTT KSVYYTSNPTI 7184 257
HLA-C*14:02 SVYYTSNPTT SVYYTSNPTI 4153 204
HLA-C*14:02 YYTSNPTT YYTSNPTI 1456 95
HLA-C*14:02 VYYTSNPTT VYYTSNPTI 178 12
HLA-C*07:02 VYYTSNPTT VYYTSNPTI 5186 405
HLA-A*68:02 SVYYTSNPTT SVYYTSNPTI 1475 123
HLA-A*68:02 NPTTFHLDGEV NPTIFHLDGEV 417 4221
HLA-A*02:11 TTFHLDGEV TIFHLDGEV 1123 158
HLA-A*68:02 TTFHLDGEVI TIFHLDGEVI 170 1013
HLA-A*68:02 TTFHLDGEV TIFHLDGEV 11 65
HLA-A*02:02 TTFHLDGEV TIFHLDGEV 1463 288
HLA-A*02:11 YTSNPTTFHL YTSNPTIFHL 158 63
HLA-A*02:06 YTSNPTTFHL YTSNPTIFHL 141 59
HLA-A*02:01 YTSNPTTFHL YTSNPTIFHL 679 287
HLA-A*24:02 KSVYYTSNPTTF KSVYYTSNPTIF 453 1054
HLA-C*14:02 SVYYTSNPTTF SVYYTSNPTIF 156 360
HLA-B*58:01 KSVYYTSNPTTF KSVYYTSNPTIF 96 215
HLA-A*23:01 TFHLDGEVITF IFHLDGEVITF 759 350
HLA-C*14:02 YYTSNPTTFHL YYTSNPTIFHL 50 101
HLA-A*24:02 SVYYTSNPTTF SVYYTSNPTIF 304 611

P1469S

Reference  YCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITIS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    YCTGYREGYLNSTNVTIATYCTGSISCSVCLSGLDSLDTYPSLETIQITIS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*42:01 IPCSVCLSGL ISCSVCLSGL 119 14504
HLA-B*07:02 IPCSVCLSGL ISCSVCLSGL 338 20577
HLA-A*68:02 CTGSIPCSV CTGSISCSV 128 49
HLA-A*68:02 YCTGSIPCSV YCTGSISCSV 150 59
HLA-A*68:02 ATYCTGSIPCSV ATYCTGSISCSV 475 218

F1569V

Reference  SWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMC
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SWLMWLIINLVQMAPISAMVRMYIFVASFYYVWKSYVHVVDGCNSSTCMMC

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 AMVRMYIFF AMVRMYIFV 2675 7
HLA-A*02:01 AMVRMYIFF AMVRMYIFV 6750 42
HLA-A*02:11 SAMVRMYIFF SAMVRMYIFV 7691 50
HLA-A*02:02 AMVRMYIFF AMVRMYIFV 3333 33
HLA-A*68:02 SAMVRMYIFF SAMVRMYIFV 12059 130
HLA-A*02:06 AMVRMYIFF AMVRMYIFV 3604 48
HLA-A*02:06 FFASFYYVWKSYV FVASFYYVWKSYV 4015 57
HLA-A*02:06 SAMVRMYIFF SAMVRMYIFV 5725 101
HLA-B*15:03 AMVRMYIFF AMVRMYIFV 60 3324
HLA-A*02:01 SAMVRMYIFF SAMVRMYIFV 10976 207
HLA-A*68:02 FFASFYYV FVASFYYV 1710 34
HLA-A*02:02 FFASFYYVWKSYV FVASFYYVWKSYV 1437 29
HLA-A*23:01 AMVRMYIFF AMVRMYIFV 258 11849
HLA-A*02:02 SAMVRMYIFF SAMVRMYIFV 6649 147
HLA-A*68:02 FFASFYYVWKSYV FVASFYYVWKSYV 1385 32
HLA-A*02:11 FFASFYYVWKSYV FVASFYYVWKSYV 1027 28
HLA-B*15:01 AMVRMYIFF AMVRMYIFV 217 7129
HLA-A*02:01 FFASFYYVWKSYV FVASFYYVWKSYV 5617 174
HLA-B*58:01 FFASFYYVW FVASFYYVW 738 26
HLA-A*02:06 FFASFYYV FVASFYYV 567 20
HLA-A*02:02 FFASFYYV FVASFYYV 927 33
HLA-A*23:01 SAMVRMYIFF SAMVRMYIFV 424 11152
HLA-A*02:01 FFASFYYV FVASFYYV 2202 95
HLA-A*02:11 FFASFYYV FVASFYYV 341 16
HLA-B*57:01 FFASFYYVW FVASFYYVW 3595 186
HLA-B*15:01 SAMVRMYIFF SAMVRMYIFV 482 8851
HLA-B*15:03 SAMVRMYIFF SAMVRMYIFV 294 5097
HLA-A*32:01 FFASFYYVW FVASFYYVW 1119 70
HLA-B*53:01 FFASFYYVW FVASFYYVW 820 56
HLA-C*03:02 FASFYYVWKSY VASFYYVWKSY 104 1301
HLA-A*68:02 FASFYYVWKSYV VASFYYVWKSYV 96 1038
HLA-A*24:02 FFASFYYVW FVASFYYVW 55 582
HLA-C*03:02 FFASFYYVW FVASFYYVW 4516 454
HLA-B*58:01 ISAMVRMYIFF ISAMVRMYIFV 395 3761
HLA-B*58:01 MYIFFASFYYVW MYIFVASFYYVW 2025 226
HLA-B*58:01 SAMVRMYIFF SAMVRMYIFV 271 2417
HLA-B*57:01 SAMVRMYIFF SAMVRMYIFV 497 4192
HLA-C*12:02 FASFYYVWKSY VASFYYVWKSY 492 4145
HLA-C*12:03 FASFYYVWKSY VASFYYVWKSY 270 2138
HLA-A*11:01 FFASFYYVWK FVASFYYVWK 271 35
HLA-B*58:01 IFFASFYYVW IFVASFYYVW 371 48
HLA-A*02:02 FASFYYVWKSYV VASFYYVWKSYV 393 2793
HLA-A*30:01 SAMVRMYIFF SAMVRMYIFV 2918 414
HLA-A*23:01 FFASFYYVW FVASFYYVW 21 144
HLA-A*02:06 FASFYYVWKSYV VASFYYVWKSYV 393 2643
HLA-B*57:01 IFFASFYYVW IFVASFYYVW 828 127
HLA-B*53:01 FASFYYVW VASFYYVW 253 1637
HLA-A*03:01 FFASFYYVWK FVASFYYVWK 978 153
HLA-A*31:01 IFFASFYYV IFVASFYYV 228 1316
HLA-A*03:02 FFASFYYVWK FVASFYYVWK 355 62
HLA-A*68:01 FASFYYVWK VASFYYVWK 10 54
HLA-A*23:01 YIFFASFYYVW YIFVASFYYVW 164 879
HLA-B*08:01 MVRMYIFFA MVRMYIFVA 473 91
HLA-A*02:01 IFFASFYYV IFVASFYYV 95 486
HLA-A*02:11 FASFYYVWKSYV VASFYYVWKSYV 382 1938
HLA-A*29:02 IFFASFYYV IFVASFYYV 129 639
HLA-A*29:02 IFFASFYYVWKSY IFVASFYYVWKSY 16 78
HLA-A*30:01 IFFASFYYV IFVASFYYV 399 1900
HLA-A*68:01 FFASFYYVWK FVASFYYVWK 38 8
HLA-A*02:11 IFFASFYYV IFVASFYYV 16 76
HLA-A*02:11 MVRMYIFFA MVRMYIFVA 111 470
HLA-A*68:02 MVRMYIFFA MVRMYIFVA 137 576
HLA-A*31:01 IFFASFYYVWK IFVASFYYVWK 75 310
HLA-A*02:01 MVRMYIFFASFYYV MVRMYIFVASFYYV 224 907
HLA-B*27:05 VRMYIFFAS VRMYIFVAS 94 380
HLA-A*29:02 IFFASFYY IFVASFYY 10 40
HLA-C*16:01 FASFYYVWKSY VASFYYVWKSY 231 854
HLA-A*29:02 IFFASFYYVW IFVASFYYVW 359 1289
HLA-A*30:01 FASFYYVWK VASFYYVWK 820 233
HLA-A*30:01 MVRMYIFF MVRMYIFV 1537 442
HLA-A*02:02 IFFASFYYV IFVASFYYV 77 266
HLA-A*02:02 MVRMYIFFASFYYV MVRMYIFVASFYYV 148 479
HLA-A*02:11 MVRMYIFFASFYYV MVRMYIFVASFYYV 47 151
HLA-A*30:02 IFFASFYY IFVASFYY 215 674
HLA-A*32:01 YIFFASFYY YIFVASFYY 267 818
HLA-C*16:01 SAMVRMYIFF SAMVRMYIFV 223 669
HLA-C*14:02 FFASFYYVWKSY FVASFYYVWKSY 392 1165
HLA-A*03:02 IFFASFYYVWK IFVASFYYVWK 413 1197
HLA-A*26:01 YIFFASFYY YIFVASFYY 330 913
HLA-B*08:01 SAMVRMYIFFASF SAMVRMYIFVASF 261 716
HLA-B*27:05 MVRMYIFFAS MVRMYIFVAS 107 290
HLA-A*23:01 YIFFASFYYV YIFVASFYYV 454 1204
HLA-A*31:01 YIFFASFYYVWK YIFVASFYYVWK 303 792
HLA-A*29:02 FASFYYVWKSY VASFYYVWKSY 213 554
HLA-A*02:02 MVRMYIFFA MVRMYIFVA 248 640
HLA-A*02:06 IFFASFYYV IFVASFYYV 66 169
HLA-A*03:01 YIFFASFYYVWK YIFVASFYYVWK 66 168
HLA-A*32:01 IFFASFYYVW IFVASFYYVW 676 266
HLA-A*02:11 YIFFASFYY YIFVASFYY 394 987
HLA-A*68:01 YIFFASFYYVWK YIFVASFYYVWK 14 35
HLA-A*68:01 MVRMYIFFASFYY MVRMYIFVASFYY 86 214
HLA-A*30:02 IFFASFYYVWKSY IFVASFYYVWKSY 462 1140
HLA-A*68:02 MVRMYIFFASFYYV MVRMYIFVASFYYV 33 81
HLA-A*11:01 RMYIFFASFYY RMYIFVASFYY 114 279
HLA-A*03:02 YIFFASFYY YIFVASFYY 50 121
HLA-A*03:01 YIFFASFYY YIFVASFYY 62 149
HLA-A*29:02 AMVRMYIFFASFYY AMVRMYIFVASFYY 38 90
HLA-A*23:01 VRMYIFFASF VRMYIFVASF 323 749
HLA-B*57:01 RMYIFFASFYYVW RMYIFVASFYYVW 905 397
HLA-A*03:01 FASFYYVWK VASFYYVWK 490 217
HLA-A*02:11 AMVRMYIFFA AMVRMYIFVA 28 63
HLA-A*32:01 RMYIFFASFYY RMYIFVASFYY 100 225
HLA-A*23:01 IFFASFYYV IFVASFYYV 61 137
HLA-A*68:02 IFFASFYYV IFVASFYYV 118 265
HLA-A*29:02 RMYIFFASFYYV RMYIFVASFYYV 223 498
HLA-A*03:02 VRMYIFFASFYY VRMYIFVASFYY 387 864
HLA-A*29:02 YIFFASFYYVW YIFVASFYYVW 392 869
HLA-A*74:01 MYIFFASFYY MYIFVASFYY 358 793
HLA-B*57:01 FASFYYVW VASFYYVW 500 226
HLA-A*02:06 MVRMYIFFASFYYV MVRMYIFVASFYYV 66 145
HLA-A*03:01 MYIFFASFYY MYIFVASFYY 58 127
HLA-A*03:02 RMYIFFASFYY RMYIFVASFYY 62 135
HLA-A*02:01 AMVRMYIFFA AMVRMYIFVA 79 171
HLA-A*03:02 MYIFFASFYY MYIFVASFYY 49 106
HLA-A*03:01 VRMYIFFASFYY VRMYIFVASFYY 251 542
HLA-B*58:01 RMYIFFASFYYVW RMYIFVASFYYVW 427 198
HLA-A*11:01 FASFYYVWK VASFYYVWK 56 26
HLA-A*02:06 MVRMYIFFA MVRMYIFVA 167 353
HLA-A*03:02 MVRMYIFFASFYY MVRMYIFVASFYY 500 1055
HLA-A*31:01 RMYIFFASF RMYIFVASF 270 565
HLA-B*15:03 FASFYYVWKSY VASFYYVWKSY 354 738
HLA-A*68:01 YIFFASFYY YIFVASFYY 12 25
HLA-A*74:01 RMYIFFASFYY RMYIFVASFYY 342 705
HLA-A*11:01 IFFASFYYVWK IFVASFYYVWK 468 952
HLA-A*68:01 YIFFASFYYV YIFVASFYYV 182 365
HLA-A*29:02 YIFFASFYY YIFVASFYY 1 2
HLA-A*29:02 RMYIFFASFYY RMYIFVASFYY 9 18
HLA-A*23:01 IFFASFYYVW IFVASFYYVW 10 20
HLA-A*03:01 RMYIFFASFYY RMYIFVASFYY 25 50

NSP4 protein

NSP4

L438P

Reference  EEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSY
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    EEAALCTFLLNKEMYLKLRSDVLLPPTQYNRYLALYNKYKYFSGAMDTTSY

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 KLRSDVLLPL KLRSDVLLPP 5 1146
HLA-C*06:02 LRSDVLLPL LRSDVLLPP 103 17926
HLA-A*02:11 YLKLRSDVLLPL YLKLRSDVLLPP 5 788
HLA-A*02:11 LKLRSDVLLPL LKLRSDVLLPP 93 14621
HLA-C*07:02 LRSDVLLPL LRSDVLLPP 104 15467
HLA-C*07:01 LRSDVLLPL LRSDVLLPP 104 15210
HLA-A*02:01 KLRSDVLLPL KLRSDVLLPP 10 1434
HLA-A*02:02 KLRSDVLLPL KLRSDVLLPP 6 686
HLA-A*02:11 MYLKLRSDVLLPL MYLKLRSDVLLPP 82 9276
HLA-A*02:02 LKLRSDVLLPL LKLRSDVLLPP 120 12620
HLA-A*02:01 LKLRSDVLLPL LKLRSDVLLPP 161 15657
HLA-A*02:02 MYLKLRSDVLLPL MYLKLRSDVLLPP 49 4677
HLA-A*02:02 LPLTQYNRYL LPPTQYNRYL 241 20700
HLA-B*08:01 YLKLRSDVLLPL YLKLRSDVLLPP 13 1103
HLA-A*02:01 YLKLRSDVLLPL YLKLRSDVLLPP 11 889
HLA-A*02:02 YLKLRSDVLLPL YLKLRSDVLLPP 6 417
HLA-A*02:06 KLRSDVLLPL KLRSDVLLPP 29 1825
HLA-A*02:01 MYLKLRSDVLLPL MYLKLRSDVLLPP 161 9143
HLA-C*14:02 MYLKLRSDVLLPL MYLKLRSDVLLPP 313 17335
HLA-C*08:02 RSDVLLPL RSDVLLPP 400 21753
HLA-B*27:05 LRSDVLLPL LRSDVLLPP 81 4120
HLA-B*15:03 LRSDVLLPL LRSDVLLPP 149 6800
HLA-B*27:05 KLRSDVLLPL KLRSDVLLPP 94 4082
HLA-A*02:06 YLKLRSDVLLPL YLKLRSDVLLPP 35 1507
HLA-A*02:01 KLRSDVLLPLT KLRSDVLLPPT 144 5473
HLA-A*02:02 KLRSDVLLPLT KLRSDVLLPPT 183 6897
HLA-B*08:01 EMYLKLRSDVLLPL EMYLKLRSDVLLPP 231 8566
HLA-B*38:01 LRSDVLLPL LRSDVLLPP 499 18496
HLA-A*02:11 EMYLKLRSDVLLPL EMYLKLRSDVLLPP 400 14119
HLA-B*08:01 MYLKLRSDVLLPL MYLKLRSDVLLPP 151 5303
HLA-B*27:05 YLKLRSDVLLPL YLKLRSDVLLPP 270 9416
HLA-A*32:01 KLRSDVLLPL KLRSDVLLPP 418 14267
HLA-A*68:02 LTQYNRYLA PTQYNRYLA 349 11388
HLA-A*02:02 YLKLRSDVLLPLT YLKLRSDVLLPPT 82 2621
HLA-A*02:02 EMYLKLRSDVLLPL EMYLKLRSDVLLPP 322 9290
HLA-C*16:01 LTQYNRYLAL PTQYNRYLAL 285 8211
HLA-B*27:05 MYLKLRSDVLLPL MYLKLRSDVLLPP 378 10377
HLA-A*02:11 KLRSDVLLPLT KLRSDVLLPPT 114 2763
HLA-A*23:01 MYLKLRSDVLLPL MYLKLRSDVLLPP 466 10083
HLA-B*15:01 LTQYNRYLAL PTQYNRYLAL 125 2585
HLA-B*15:01 KLRSDVLLPL KLRSDVLLPP 335 6450
HLA-A*30:01 LTQYNRYLA PTQYNRYLA 171 3143
HLA-A*02:01 YLKLRSDVLLPLT YLKLRSDVLLPPT 177 2183
HLA-B*15:03 LTQYNRYLAL PTQYNRYLAL 15 177
HLA-B*53:01 LPLTQYNRY LPPTQYNRY 497 4773
HLA-A*02:06 LTQYNRYLAL PTQYNRYLAL 483 4423
HLA-A*11:01 LTQYNRYLALYNK PTQYNRYLALYNK 388 3496
HLA-A*02:11 YLKLRSDVLLPLT YLKLRSDVLLPPT 115 1005
HLA-B*35:01 LPLTQYNRY LPPTQYNRY 66 540
HLA-B*08:01 YLKLRSDVLLPLT YLKLRSDVLLPPT 258 1470
HLA-B*08:01 LTQYNRYLAL PTQYNRYLAL 126 711
HLA-A*01:01 LTQYNRYLALY PTQYNRYLALY 400 1559
HLA-A*02:11 LLPLTQYNRYL LLPPTQYNRYL 389 105
HLA-A*30:01 KLRSDVLLPL KLRSDVLLPP 108 390
HLA-A*29:02 LTQYNRYLALY PTQYNRYLALY 212 592
HLA-A*02:02 LLPLTQYNRYL LLPPTQYNRYL 400 145
HLA-A*02:01 VLLPLTQYNRYLAL VLLPPTQYNRYLAL 343 922
HLA-A*02:01 VLLPLTQYNRYL VLLPPTQYNRYL 170 445
HLA-A*30:02 LTQYNRYLALY PTQYNRYLALY 92 211
HLA-A*02:02 VLLPLTQYNRYL VLLPPTQYNRYL 147 335
HLA-B*42:01 LPLTQYNRYL LPPTQYNRYL 72 154
HLA-A*02:02 VLLPLTQYNRYLAL VLLPPTQYNRYLAL 381 810
HLA-A*29:02 VLLPLTQYNRY VLLPPTQYNRY 143 302

NSP6 protein

NSP6

SGF 106-108 deletion

Reference  FNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYD
           |||||||||||||||||||||||||   |||||||||||||||||||||||||
Mutated    FNMVYMPASWVMRIMTWLDMVDTSL‑‑‑KLKDCVMYASAVVLLILMTARTVYD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:02 FKLKDCVMYA - 8 -
HLA-A*02:11 FKLKDCVMYA - 12 -
HLA-B*15:03 FKLKDCVMY - 15 -
HLA-A*02:01 FKLKDCVMYA - 27 -
HLA-A*02:06 FKLKDCVMYA - 90 -
HLA-A*02:02 SGFKLKDCVMYA - 126 -
HLA-A*02:11 SGFKLKDCVMYA - 200 -
HLA-A*02:02 GFKLKDCVMYA - 239 -
HLA-A*23:01 TWLDMVDTSLSGF - 387 -
HLA-A*02:11 GFKLKDCVMYA - 394 -
HLA-A*02:02 WLDMVDTSLS - 441 -
HLA-A*02:11 FKLKDCVMYASAVV - 481 -
HLA-B*15:03 LSGFKLKDCVMY LKLKDCVMY 3466 22
HLA-A*02:11 LDMVDTSLSGFKL LDMVDTSLKL 16396 166
HLA-A*02:02 LDMVDTSLSGFKL LDMVDTSLKL 9971 106
HLA-A*02:11 SLSGFKLKDCV SLKLKDCV 122 9934
HLA-A*02:01 LDMVDTSLSGFKL LDMVDTSLKL 20579 311
HLA-B*08:01 SLSGFKLKDCVM SLKLKDCVM 929 36
HLA-A*02:02 SLSGFKLKDCV SLKLKDCV 408 10216
HLA-C*05:01 WLDMVDTSLSGFKL WLDMVDTSLKL 8375 417
HLA-B*15:01 SLSGFKLKDCVMY SLKLKDCVMY 2952 158
HLA-B*08:01 TSLSGFKLKDCVM TSLKLKDCVM 4628 289
HLA-B*15:01 SLSGFKLKDCVM SLKLKDCVM 2654 197
HLA-A*68:01 DMVDTSLSGFK DMVDTSLK 366 4919
HLA-A*02:11 WLDMVDTSLSGFKL WLDMVDTSLKL 1342 108
HLA-C*08:02 MVDTSLSGFKL MVDTSLKL 2134 174
HLA-B*15:03 SLSGFKLKDCVM SLKLKDCVM 3634 297
HLA-A*02:01 WLDMVDTSLSGFKL WLDMVDTSLKL 2214 195
HLA-A*03:02 WLDMVDTSLSGFK WLDMVDTSLK 1756 156
HLA-A*02:02 LSGFKLKDCVMYA LKLKDCVMYA 305 28
HLA-A*02:01 LSGFKLKDCVMYA LKLKDCVMYA 1788 165
HLA-A*02:11 LSGFKLKDCVMYA LKLKDCVMYA 578 54
HLA-B*15:03 SLSGFKLKDCVMY SLKLKDCVMY 3626 349
HLA-A*03:01 WLDMVDTSLSGFK WLDMVDTSLK 2900 287
HLA-C*05:01 MVDTSLSGFKL MVDTSLKL 1125 124
HLA-A*11:01 WLDMVDTSLSGFK WLDMVDTSLK 4020 492
HLA-A*02:02 WLDMVDTSLSGFKL WLDMVDTSLKL 788 116
HLA-A*68:01 DMVDTSLSGFKLK DMVDTSLKLK 1679 251
HLA-A*02:01 SLSGFKLKDCVMYA SLKLKDCVMYA 203 853
HLA-A*02:11 SLSGFKLKDCVMYA SLKLKDCVMYA 64 223
HLA-A*02:02 SLSGFKLKDCVMYA SLKLKDCVMYA 55 171
HLA-A*29:02 SLSGFKLKDCVMY SLKLKDCVMY 404 1192
HLA-A*11:01 MVDTSLSGFKLK MVDTSLKLK 143 50
HLA-A*03:02 MVDTSLSGFKLK MVDTSLKLK 312 127
HLA-A*68:01 MVDTSLSGFKLK MVDTSLKLK 602 246
HLA-A*03:01 MVDTSLSGFKLK MVDTSLKLK 441 190

NSP12 protein

NSP12

P323L

Reference  CVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    CVNCLDDRCILHCANFNVLFSTVFPLTSFGPLVRKIFVDGVPFVVSTGYHF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:01 FPPTSFGPLV FPLTSFGPLV 8999 21
HLA-A*02:02 FPPTSFGPLV FPLTSFGPLV 7237 18
HLA-A*02:11 FPPTSFGPLV FPLTSFGPLV 3405 9
HLA-A*32:01 VLFSTVFPP VLFSTVFPL 5415 27
HLA-A*02:11 LFSTVFPP LFSTVFPL 6706 35
HLA-A*02:11 ANFNVLFSTVFPP ANFNVLFSTVFPL 1827 12
HLA-A*02:11 NFNVLFSTVFPP NFNVLFSTVFPL 1779 13
HLA-A*02:11 NVLFSTVFPP NVLFSTVFPL 739 6
HLA-C*03:03 VLFSTVFPP VLFSTVFPL 28468 265
HLA-C*03:04 VLFSTVFPP VLFSTVFPL 28468 265
HLA-A*02:11 FNVLFSTVFPP FNVLFSTVFPL 413 4
HLA-C*14:02 VLFSTVFPP VLFSTVFPL 21407 220
HLA-A*02:11 FNVLFSTVFPPT FNVLFSTVFPLT 2618 27
HLA-A*02:01 LFSTVFPP LFSTVFPL 7475 81
HLA-C*14:02 LFSTVFPP LFSTVFPL 11979 138
HLA-B*15:03 VLFSTVFPP VLFSTVFPL 3115 36
HLA-A*02:11 VLFSTVFPP VLFSTVFPL 78 1
HLA-C*03:02 VLFSTVFPP VLFSTVFPL 20533 273
HLA-A*02:01 FNVLFSTVFPP FNVLFSTVFPL 656 9
HLA-A*02:01 ANFNVLFSTVFPP ANFNVLFSTVFPL 2569 37
HLA-A*02:11 FNVLFSTVFPPTS FNVLFSTVFPLTS 9448 142
HLA-A*02:02 NVLFSTVFPP NVLFSTVFPL 1088 17
HLA-A*02:11 CANFNVLFSTVFPP CANFNVLFSTVFPL 6143 96
HLA-A*02:02 FNVLFSTVFPP FNVLFSTVFPL 1014 16
HLA-A*68:02 NVLFSTVFPP NVLFSTVFPL 2213 37
HLA-A*02:02 ANFNVLFSTVFPP ANFNVLFSTVFPL 3126 53
HLA-A*02:11 PPTSFGPLV PLTSFGPLV 28329 483
HLA-C*16:01 VLFSTVFPP VLFSTVFPL 24733 432
HLA-C*17:01 VLFSTVFPP VLFSTVFPL 25087 439
HLA-A*02:01 FNVLFSTVFPPT FNVLFSTVFPLT 3765 66
HLA-A*02:02 LFSTVFPP LFSTVFPL 9311 167
HLA-A*02:01 NVLFSTVFPP NVLFSTVFPL 928 17
HLA-A*02:02 NFNVLFSTVFPP NFNVLFSTVFPL 2542 47
HLA-A*02:02 VLFSTVFPP VLFSTVFPL 269 5
HLA-A*02:01 NFNVLFSTVFPP NFNVLFSTVFPL 2286 44
HLA-A*02:06 FPPTSFGPLV FPLTSFGPLV 3379 73
HLA-A*02:01 VLFSTVFPP VLFSTVFPL 179 4
HLA-A*02:06 FNVLFSTVFPP FNVLFSTVFPL 1609 37
HLA-A*02:02 FNVLFSTVFPPT FNVLFSTVFPLT 4116 110
HLA-A*02:11 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 6695 180
HLA-A*02:01 FNVLFSTVFPPTS FNVLFSTVFPLTS 11451 311
HLA-A*02:06 VLFSTVFPP VLFSTVFPL 368 10
HLA-A*02:11 ANFNVLFSTVFPPT ANFNVLFSTVFPLT 14639 409
HLA-A*02:01 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 12596 425
HLA-A*68:01 PTSFGPLVR LTSFGPLVR 908 36
HLA-A*02:06 NVLFSTVFPP NVLFSTVFPL 1611 66
HLA-B*15:01 VLFSTVFPP VLFSTVFPL 5731 243
HLA-B*35:01 FPPTSFGPL FPLTSFGPL 304 13
HLA-B*53:01 FPPTSFGPL FPLTSFGPL 3581 154
HLA-C*01:02 FPPTSFGPL FPLTSFGPL 217 4855
HLA-A*02:01 CANFNVLFSTVFPP CANFNVLFSTVFPL 8519 384
HLA-A*02:02 FNVLFSTVFPPTS FNVLFSTVFPLTS 10920 497
HLA-A*02:02 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 6958 322
HLA-A*02:11 VFPPTSFGPLV VFPLTSFGPLV 4242 199
HLA-A*02:02 CANFNVLFSTVFPP CANFNVLFSTVFPL 8183 391
HLA-A*02:11 NFNVLFSTVFPPT NFNVLFSTVFPLT 9111 472
HLA-A*02:06 ANFNVLFSTVFPP ANFNVLFSTVFPL 5191 304
HLA-A*02:06 NFNVLFSTVFPP NFNVLFSTVFPL 4220 274
HLA-A*02:06 FNVLFSTVFPPT FNVLFSTVFPLT 4868 388
HLA-B*35:03 FPPTSFGPL FPLTSFGPL 286 24
HLA-A*03:01 PTSFGPLVRK LTSFGPLVRK 554 47
HLA-A*31:01 PTSFGPLVR LTSFGPLVR 4402 390
HLA-A*11:01 PTSFGPLVR LTSFGPLVR 4068 379
HLA-A*03:02 PTSFGPLVRK LTSFGPLVRK 868 88
HLA-B*07:02 STVFPPTSFGPL STVFPLTSFGPL 777 79
HLA-A*68:01 PTSFGPLVRK LTSFGPLVRK 308 34
HLA-B*07:02 TVFPPTSFGPL TVFPLTSFGPL 1498 171
HLA-A*02:11 STVFPPTSFGPLV STVFPLTSFGPLV 2427 285
HLA-A*02:11 NVLFSTVFPPT NVLFSTVFPLT 1183 139
HLA-A*33:03 PTSFGPLVR LTSFGPLVR 3228 381
HLA-A*26:01 STVFPPTSF STVFPLTSF 786 95
HLA-B*07:02 VFPPTSFGPL VFPLTSFGPL 339 43
HLA-A*02:01 NVLFSTVFPPT NVLFSTVFPLT 2111 290
HLA-B*42:01 FSTVFPPTSFGPL FSTVFPLTSFGPL 1320 185
HLA-B*42:01 STVFPPTSFGPL STVFPLTSFGPL 738 111
HLA-A*02:01 VLFSTVFPPTSF VLFSTVFPLTSF 2225 342
HLA-B*08:01 FPPTSFGPL FPLTSFGPL 973 153
HLA-B*42:01 TVFPPTSFGPL TVFPLTSFGPL 843 142
HLA-A*11:01 PTSFGPLVRK LTSFGPLVRK 123 21
HLA-B*42:01 VFPPTSFGPL VFPLTSFGPL 274 47
HLA-A*02:01 VLFSTVFPPTS VLFSTVFPLTS 708 124
HLA-B*07:02 FSTVFPPTSFGPL FSTVFPLTSFGPL 2537 466
HLA-B*07:02 FPPTSFGPL FPLTSFGPL 42 8
HLA-A*02:11 VLFSTVFPPTSF VLFSTVFPLTSF 1019 195
HLA-A*25:01 STVFPPTSF STVFPLTSF 1533 296
HLA-B*07:02 FPPTSFGPLV FPLTSFGPLV 1131 236
HLA-B*42:01 FPPTSFGPL FPLTSFGPL 21 5
HLA-A*26:01 FSTVFPPTSF FSTVFPLTSF 1667 398
HLA-B*51:01 FPPTSFGPL FPLTSFGPL 1809 433
HLA-A*02:11 VLFSTVFPPTS VLFSTVFPLTS 309 74
HLA-B*42:01 FPPTSFGPLV FPLTSFGPLV 368 89
HLA-A*02:02 VLFSTVFPPTS VLFSTVFPLTS 1210 377
HLA-C*03:02 FPPTSFGPL FPLTSFGPL 960 313
HLA-A*32:01 STVFPPTSF STVFPLTSF 230 86
HLA-B*58:01 FSTVFPPTSF FSTVFPLTSF 88 33
HLA-B*15:01 STVFPPTSF STVFPLTSF 130 49
HLA-A*02:01 VLFSTVFPPT VLFSTVFPLT 61 23
HLA-C*03:03 FPPTSFGPL FPLTSFGPL 375 145
HLA-C*03:04 FPPTSFGPL FPLTSFGPL 375 145
HLA-A*02:02 VLFSTVFPPT VLFSTVFPLT 113 44
HLA-C*16:01 FSTVFPPTS FSTVFPLTS 1127 460
HLA-C*14:02 LFSTVFPPTSF LFSTVFPLTSF 396 950
HLA-C*01:02 VFPPTSFGPL VFPLTSFGPL 429 997
HLA-A*02:02 TVFPPTSFGPLV TVFPLTSFGPLV 789 343
HLA-A*68:02 STVFPPTSFGPLV STVFPLTSFGPLV 169 74
HLA-A*02:11 VLFSTVFPPT VLFSTVFPLT 25 11
HLA-A*03:01 TVFPPTSFGPLVRK TVFPLTSFGPLVRK 92 198
HLA-C*14:02 VFPPTSFGPL VFPLTSFGPL 47 99
HLA-A*23:01 LFSTVFPPTSF LFSTVFPLTSF 370 179

NSP16 protein

NSP16

G213N

Reference  AWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    AWWTAFVTNVNASSSEAFLIGCNYLNKPREQIDGYVMHANYIFWRNTNPIQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:02 FLIGCNYLG FLIGCNYLN 43 822
HLA-A*02:01 FLIGCNYLG FLIGCNYLN 156 1444
HLA-A*02:11 FLIGCNYLG FLIGCNYLN 95 686
HLA-A*02:06 FLIGCNYLG FLIGCNYLN 220 1258
HLA-A*02:02 YLGKPREQIDGYV YLNKPREQIDGYV 188 62
HLA-A*02:11 YLGKPREQIDGYV YLNKPREQIDGYV 152 62
HLA-A*11:01 LIGCNYLGK LIGCNYLNK 195 93
HLA-A*02:02 YLGKPREQI YLNKPREQI 111 55