Summary

This strain contains 15 protein-level mutations:

  • 2 mutations in Spike protein: M153T, D614G
  • 3 mutations in N protein: 203-204 RG->KR, G214C, P383L
  • 2 mutations in NS9c protein: G50N, M60I
  • 4 mutations in NSP3 protein: T428I, T725I, P1469S, F1569V
  • 1 mutation in NSP4 protein: L438P
  • 1 mutation in NSP6 protein: SGF 106-108 deletion
  • 1 mutation in NSP12 protein: P323L
  • 1 mutation in NSP16 protein: G213N

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

M153T

Reference  IKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    IKVCEFQFCNDPFLGVYYHKNNKSWTESEFRVYSSANNCTFEYVSQPFLMD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:04 KSWMESEFRVYSSAN KSWTESEFRVYSSAN 243 2119
HLA-DRB1*11:04 NKSWMESEFRVYSSA NKSWTESEFRVYSSA 259 2128
HLA-DRB1*11:01 KSWMESEFRVYSSAN KSWTESEFRVYSSAN 383 2982
HLA-DRB1*11:01 NKSWMESEFRVYSSA NKSWTESEFRVYSSA 435 2966
HLA-DRB1*11:04 NNKSWMESEFRVYSS NNKSWTESEFRVYSS 427 2759
HLA-DRB1*11:04 SWMESEFRVYSSANN SWTESEFRVYSSANN 476 1692
HLA-DRB1*13:02 VYYHKNNKSWMESEF VYYHKNNKSWTESEF 271 662
HLA-DRB1*11:04 NKSWMESEFRVYSSANNCTF NKSWTESEFRVYSSANNCTF 498 1205
HLA-DRB1*13:02 VYYHKNNKSWMESEFR VYYHKNNKSWTESEFR 471 1096
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVY YHKNNKSWTESEFRVY 210 486
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYS HKNNKSWTESEFRVYS 166 384
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVY HKNNKSWTESEFRVY 140 321
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYS KNNKSWTESEFRVYS 105 239
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYSS KNNKSWTESEFRVYSS 158 353
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVY YHKNNKSWTESEFRVY 181 403
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVY YYHKNNKSWTESEFRVY 236 521
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVYS YHKNNKSWTESEFRVYS 200 441
HLA-DPA1*03:01/DPB1*02:01 NNKSWMESEFRVYSS NNKSWTESEFRVYSS 98 215
HLA-DPA1*03:01/DPB1*02:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSWTESEFRVY 226 495
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVYS YHKNNKSWTESEFRVYS 162 354
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSSA NNKSWTESEFRVYSSA 144 310
HLA-DPA1*03:01/DPB1*02:01 NKSWMESEFRVYSSA NKSWTESEFRVYSSA 86 185
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYS HKNNKSWTESEFRVYS 133 286
HLA-DPA1*03:01/DPB1*02:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSWTESEFRVYS 160 344
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVY HKNNKSWTESEFRVY 187 402
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVY YYHKNNKSWTESEFRVY 272 584
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVYS YYHKNNKSWTESEFRVYS 304 650
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVYSS YYHKNNKSWTESEFRVYSS 138 295
HLA-DPA1*03:01/DPB1*02:01 KSWMESEFRVYSSAN KSWTESEFRVYSSAN 102 218
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVYS YYHKNNKSWTESEFRVYS 408 871
HLA-DRB1*13:02 GVYYHKNNKSWMESEF GVYYHKNNKSWTESEF 344 733
HLA-DPA1*03:01/DPB1*04:01 NKSWMESEFRVYSSAN NKSWTESEFRVYSSAN 160 340
HLA-DRB1*13:02 GVYYHKNNKSWMESE GVYYHKNNKSWTESE 210 445
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYS KNNKSWTESEFRVYS 152 322
HLA-DPA1*03:01/DPB1*02:01 VYYHKNNKSWMESEFRVY VYYHKNNKSWTESEFRVY 433 917
HLA-DPA1*03:01/DPB1*04:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSWTESEFRVY 275 580
HLA-DQA1*01:02/DQB1*05:01 HKNNKSWMESEFRVYS HKNNKSWTESEFRVYS 462 974
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYSS HKNNKSWTESEFRVYSS 187 394
HLA-DQA1*01:02/DQB1*05:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSWTESEFRVYS 392 824
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVYSS YYHKNNKSWTESEFRVYSS 185 388
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVYSS YHKNNKSWTESEFRVYSS 262 549
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYSS KNNKSWTESEFRVYSS 118 247
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYSS HKNNKSWTESEFRVYSS 144 301
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVYSSA YHKNNKSWTESEFRVYSSA 157 328
HLA-DPA1*03:01/DPB1*04:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSWTESEFRVYS 207 432
HLA-DRB1*10:01 YHKNNKSWMESEFRVYSSAN YHKNNKSWTESEFRVYSSAN 499 1040
HLA-DQA1*01:02/DQB1*05:01 YYHKNNKSWMESEFRVYSS YYHKNNKSWTESEFRVYSS 338 703
HLA-DRB1*13:02 GVYYHKNNKSWMESEFR GVYYHKNNKSWTESEFR 458 951
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVYSS YHKNNKSWTESEFRVYSS 372 772
HLA-DPA1*03:01/DPB1*02:01 NKSWMESEFRVYSSAN NKSWTESEFRVYSSAN 107 222
HLA-DQA1*01:02/DQB1*05:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSWTESEFRVYS 232 481
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSS NNKSWTESEFRVYSS 153 317
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYSSA KNNKSWTESEFRVYSSA 164 339
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYSSA KNNKSWTESEFRVYSSA 115 237
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVYSSA YHKNNKSWTESEFRVYSSA 110 225
HLA-DPA1*03:01/DPB1*02:01 NNKSWMESEFRVYSSAN NNKSWTESEFRVYSSAN 122 249
HLA-DRB1*13:02 VYYHKNNKSWMESEFRVYSS VYYHKNNKSWTESEFRVYSS 396 807
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYSSAN HKNNKSWTESEFRVYSSAN 114 232
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYSSA HKNNKSWTESEFRVYSSA 321 653
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYSSAN HKNNKSWTESEFRVYSSAN 166 337
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSSAN NNKSWTESEFRVYSSAN 180 364
HLA-DPA1*03:01/DPB1*04:01 NKSWMESEFRVYSSA NKSWTESEFRVYSSA 145 292
HLA-DQA1*01:02/DQB1*05:01 YHKNNKSWMESEFRVYSSA YHKNNKSWTESEFRVYSSA 289 581
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYSSA HKNNKSWTESEFRVYSSA 212 426

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 533 192
HLA-DRB1*01:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 521 192
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 328 123
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 889 335
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTE NTSNQVAVLYQGVNCTE 281 107
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 677 258
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 243 93
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 227 87
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 130 50
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 403 155
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 136 53
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 228 89
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 176 69
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 181 71
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 150 59
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 167 66
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 200 80
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQD TPGTNTSNQVAVLYQG 276 112
HLA-DRB1*01:01 VAVLYQDVNCTEVPV VAVLYQGVNCTEVPV 347 141
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEV NTSNQVAVLYQGVNCTEV 639 263
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 413 170
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVN TPGTNTSNQVAVLYQGVN 376 155
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQD ITPGTNTSNQVAVLYQG 339 140
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVA QVAVLYQGVNCTEVPVA 814 340
HLA-DRB1*01:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 867 365
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDV ITPGTNTSNQVAVLYQGV 435 184
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDVN ITPGTNTSNQVAVLYQGVN 229 97
HLA-DQA1*01:03/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 960 408
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPV NQVAVLYQGVNCTEVPV 799 340
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 176 75
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCT TNTSNQVAVLYQGVNCT 211 90
HLA-DRB1*01:01 VAVLYQDVNCTEVPVAI VAVLYQGVNCTEVPVAI 996 428
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 292 126
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 417 181
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 852 370
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 312 136
HLA-DRB1*01:01 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 699 305
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNC GTNTSNQVAVLYQGVNC 197 86
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVP NTSNQVAVLYQGVNCTEVP 412 180
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVP TSNQVAVLYQGVNCTEVP 908 399
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 450 198
HLA-DRB1*01:01 QVAVLYQDVNCTEVP QVAVLYQGVNCTEVP 285 126
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 530 235
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDVN VITPGTNTSNQVAVLYQGVN 189 84
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDV VITPGTNTSNQVAVLYQGV 270 121
HLA-DRB1*01:01 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 450 202
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 597 268
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 838 380
HLA-DRB1*01:01 VAVLYQDVNCTEVPVA VAVLYQGVNCTEVPVA 1017 462
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 801 365
HLA-DRB1*10:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 910 416
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVA SNQVAVLYQGVNCTEVPVA 979 449
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 365 168
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 447 206
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVNC PGTNTSNQVAVLYQGVNC 425 196
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 471 218
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTE TNTSNQVAVLYQGVNCTE 477 221
HLA-DRB1*01:01 QVAVLYQDVNCTEVPV QVAVLYQGVNCTEVPV 855 397
HLA-DRB1*01:01 NQVAVLYQDVNCTEV NQVAVLYQGVNCTEV 253 118
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPVA TSNQVAVLYQGVNCTEVPVA 488 228
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNCT GTNTSNQVAVLYQGVNCT 436 204
HLA-DQA1*02:01/DQB1*03:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DQA1*02:01/DQB1*03:19 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DRB1*01:01 NQVAVLYQDVNCTEVP NQVAVLYQGVNCTEVP 887 416
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAI NQVAVLYQGVNCTEVPVAI 991 467
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 984 467
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 485 231
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 641 306
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIH QVAVLYQGVNCTEVPVAIH 1021 488
HLA-DPA1*03:01/DPB1*04:01 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 307 635
HLA-DRB1*01:01 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 850 411
HLA-DRB1*01:01 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 502 243
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVAI SNQVAVLYQGVNCTEVPVAI 481 235
HLA-DQA1*01:02/DQB1*06:02 SVITPGTNTSNQVAVLYQDV SVITPGTNTSNQVAVLYQGV 231 113
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAIH NQVAVLYQGVNCTEVPVAIH 483 237
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 936 460
HLA-DQA1*01:03/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 493 243
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTEV TNTSNQVAVLYQGVNCTEV 298 147
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVNC TPGTNTSNQVAVLYQGVNC 254 126
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQD VITPGTNTSNQVAVLYQG 681 338
HLA-DRB1*01:01 TNTSNQVAVLYQDVNCTEVP TNTSNQVAVLYQGVNCTEVP 523 260
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIHA QVAVLYQGVNCTEVPVAIHA 502 251

N protein

N

203-204 RG->KR

Reference  GGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQ
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    GGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNCGDAALALLLLDRLNQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 114 560
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 114 560
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 158 745
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 158 745
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 264 1165
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 264 1165
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 111 481
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 111 481
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 126 535
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 126 535
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 80 325
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 80 325
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 225 911
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 225 911
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 194 766
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 194 766
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 216 837
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 216 837
HLA-DQA1*05:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 146 540
HLA-DQA1*05:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 146 540
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 132 485
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 132 485
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 87 312
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 87 312
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 198 701
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 198 701
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 421 1456
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 421 1456
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 497 1707
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 497 1707
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 286 982
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 286 982
HLA-DQA1*02:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 93 316
HLA-DQA1*02:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 93 316
HLA-DQA1*06:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 484 1637
HLA-DQA1*06:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 484 1637
HLA-DQA1*06:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 315 1063
HLA-DQA1*06:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 315 1063
HLA-DQA1*06:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 222 745
HLA-DQA1*06:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 222 745
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 497 1555
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 497 1555
HLA-DQA1*05:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 333 1030
HLA-DQA1*05:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 333 1030
HLA-DQA1*06:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 251 766
HLA-DQA1*06:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 251 766
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 161 487
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 161 487
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARM SRNSTPGSSKRTSPARM 309 922
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARM SRNSTPGSSKRTSPARM 309 922
HLA-DQA1*03:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 286 850
HLA-DQA1*03:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 286 850
HLA-DQA1*06:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 367 1086
HLA-DQA1*06:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 367 1086
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 328 968
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 328 968
HLA-DQA1*06:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 271 789
HLA-DQA1*06:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 271 789
HLA-DQA1*03:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 347 986
HLA-DQA1*03:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 347 986
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 484 1359
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 484 1359
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 469 1315
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 469 1315
HLA-DRB1*01:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 1305 473
HLA-DRB1*01:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 1312 479
HLA-DQA1*02:01/DQB1*03:01 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 185 506
HLA-DQA1*02:01/DQB1*03:19 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 185 506
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALA KRTSPARMAGNCGDAALA 491 1339
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALA KRTSPARMAGNCGDAALA 491 1339
HLA-DQA1*05:01/DQB1*03:01 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 300 817
HLA-DQA1*05:01/DQB1*03:19 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 300 817
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 416 1132
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 416 1132
HLA-DQA1*05:01/DQB1*03:01 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 221 601
HLA-DQA1*05:01/DQB1*03:19 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 221 601
HLA-DQA1*02:01/DQB1*03:01 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 126 340
HLA-DQA1*02:01/DQB1*03:19 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 126 340
HLA-DQA1*04:01/DQB1*03:01 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 490 1321
HLA-DQA1*04:01/DQB1*03:19 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 490 1321
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 403 1078
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 403 1078
HLA-DQA1*04:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 405 1080
HLA-DQA1*04:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 405 1080
HLA-DQA1*06:01/DQB1*03:01 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 408 1086
HLA-DQA1*06:01/DQB1*03:19 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 408 1086
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 166 429
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 166 429
HLA-DQA1*04:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 423 1082
HLA-DQA1*04:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 423 1082
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 164 419
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 164 419
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 254 646
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 254 646
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAALA KRTSPARMAGNCGDAALA 371 940
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAALA KRTSPARMAGNCGDAALA 371 940
HLA-DQA1*03:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 293 729
HLA-DQA1*03:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 293 729
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 270 665
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 270 665
HLA-DQA1*06:01/DQB1*03:01 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 348 854
HLA-DQA1*06:01/DQB1*03:19 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 348 854
HLA-DQA1*04:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 457 1120
HLA-DQA1*04:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 457 1120
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNC 403 975
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNC 403 975
HLA-DQA1*06:01/DQB1*03:01 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 478 1152
HLA-DQA1*06:01/DQB1*03:19 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 478 1152
HLA-DQA1*04:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 489 1173
HLA-DQA1*04:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 489 1173
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 221 530
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 221 530
HLA-DQA1*06:01/DQB1*03:01 GSSRGTSPARMAGNG GSSKRTSPARMAGNC 424 1012
HLA-DQA1*06:01/DQB1*03:19 GSSRGTSPARMAGNG GSSKRTSPARMAGNC 424 1012
HLA-DQA1*05:01/DQB1*03:01 TPGSSRGTSPARMAGNG TPGSSKRTSPARMAGNC 430 1009
HLA-DQA1*05:01/DQB1*03:19 TPGSSRGTSPARMAGNG TPGSSKRTSPARMAGNC 430 1009
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMAGNGG NSTPGSSKRTSPARMAGNCG 420 965
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMAGNGG NSTPGSSKRTSPARMAGNCG 420 965
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNC 199 457
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNC 199 457
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 215 491
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 215 491
HLA-DQA1*06:01/DQB1*03:01 PGSSRGTSPARMAGNG PGSSKRTSPARMAGNC 491 1109
HLA-DQA1*06:01/DQB1*03:19 PGSSRGTSPARMAGNG PGSSKRTSPARMAGNC 491 1109
HLA-DQA1*03:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 391 878
HLA-DQA1*03:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 391 878
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAGNGG NSTPGSSKRTSPARMAGNCG 202 453
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAGNGG NSTPGSSKRTSPARMAGNCG 202 453
HLA-DQA1*06:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 399 894
HLA-DQA1*06:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 399 894
HLA-DQA1*05:01/DQB1*03:01 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSKRTSPARMAG 458 1019
HLA-DQA1*05:01/DQB1*03:19 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSKRTSPARMAG 458 1019
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGNGG PGSSKRTSPARMAGNCG 452 999
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGNGG PGSSKRTSPARMAGNCG 452 999
HLA-DQA1*05:01/DQB1*03:01 GSSRGTSPARMAGNG GSSKRTSPARMAGNC 273 602
HLA-DQA1*05:01/DQB1*03:19 GSSRGTSPARMAGNG GSSKRTSPARMAGNC 273 602
HLA-DQA1*05:01/DQB1*03:01 SRNSTPGSSRGTSPARMAGN SRNSTPGSSKRTSPARMAGN 387 842
HLA-DQA1*05:01/DQB1*03:19 SRNSTPGSSRGTSPARMAGN SRNSTPGSSKRTSPARMAGN 387 842
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAGNGGD STPGSSKRTSPARMAGNCGD 208 450
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAGNGGD STPGSSKRTSPARMAGNCGD 208 450
HLA-DQA1*03:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 319 688
HLA-DQA1*03:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 319 688
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGNG PGSSKRTSPARMAGNC 338 722
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGNG PGSSKRTSPARMAGNC 338 722
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAGNGGD STPGSSKRTSPARMAGNCGD 436 928
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAGNGGD STPGSSKRTSPARMAGNCGD 436 928
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAGNG NSTPGSSKRTSPARMAGNC 281 597
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAGNG NSTPGSSKRTSPARMAGNC 281 597
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAGN TPGSSKRTSPARMAGN 481 1016
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAGN TPGSSKRTSPARMAGN 481 1016
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGNG TPGSSKRTSPARMAGNC 209 441
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGNG TPGSSKRTSPARMAGNC 209 441
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAGN STPGSSKRTSPARMAGN 423 888
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAGN STPGSSKRTSPARMAGN 423 888
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAGNGG STPGSSKRTSPARMAGNCG 292 611
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAGNGG STPGSSKRTSPARMAGNCG 292 611
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARMAG SRNSTPGSSKRTSPARMAG 318 665
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARMAG SRNSTPGSSKRTSPARMAG 318 665
HLA-DQA1*05:01/DQB1*03:03 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 456 941
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 258 526
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 258 526
HLA-DQA1*02:01/DQB1*03:01 RNSSRNSTPGSSRGTSPARM RNSSRNSTPGSSKRTSPARM 299 603
HLA-DQA1*02:01/DQB1*03:19 RNSSRNSTPGSSRGTSPARM RNSSRNSTPGSSKRTSPARM 299 603
HLA-DQA1*02:01/DQB1*03:01 NSSRNSTPGSSRGTSPARM NSSRNSTPGSSKRTSPARM 404 814
HLA-DQA1*02:01/DQB1*03:19 NSSRNSTPGSSRGTSPARM NSSRNSTPGSSKRTSPARM 404 814
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGNGGDA TPGSSKRTSPARMAGNCGDA 212 426
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGNGGDA TPGSSKRTSPARMAGNCGDA 212 426

G214C

Reference  RSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    RSRNSSRNSTPGSSKRTSPARMAGNCGDAALALLLLDRLNQLESKMSGKGQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*05:01/DQB1*03:01 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 71 505
HLA-DQA1*05:01/DQB1*03:19 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 71 505
HLA-DQA1*05:01/DQB1*03:01 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 95 666
HLA-DQA1*05:01/DQB1*03:19 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 95 666
HLA-DQA1*05:01/DQB1*03:01 RMAGNGGDAALALLL RMAGNCGDAALALLL 54 377
HLA-DQA1*05:01/DQB1*03:19 RMAGNGGDAALALLL RMAGNCGDAALALLL 54 377
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALL ARMAGNCGDAALALL 58 404
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALL ARMAGNCGDAALALL 58 404
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 88 589
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 88 589
HLA-DQA1*05:01/DQB1*03:01 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 186 1217
HLA-DQA1*05:01/DQB1*03:19 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 186 1217
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 66 429
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 66 429
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 171 1104
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 171 1104
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 86 552
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 86 552
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 164 1047
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 164 1047
HLA-DQA1*05:01/DQB1*03:01 MAGNGGDAALALLLL MAGNCGDAALALLLL 72 458
HLA-DQA1*05:01/DQB1*03:19 MAGNGGDAALALLLL MAGNCGDAALALLLL 72 458
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALAL PARMAGNCGDAALAL 70 443
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALAL PARMAGNCGDAALAL 70 443
HLA-DQA1*05:01/DQB1*03:01 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 161 990
HLA-DQA1*05:01/DQB1*03:19 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 161 990
HLA-DQA1*05:01/DQB1*03:01 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 102 623
HLA-DQA1*05:01/DQB1*03:19 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 102 623
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALALL PARMAGNCGDAALALL 75 453
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALALL PARMAGNCGDAALALL 75 453
HLA-DQA1*05:01/DQB1*03:01 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 99 592
HLA-DQA1*05:01/DQB1*03:19 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 99 592
HLA-DQA1*05:01/DQB1*03:01 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 172 1024
HLA-DQA1*05:01/DQB1*03:19 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 172 1024
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 153 891
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 153 891
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 147 849
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 147 849
HLA-DQA1*05:01/DQB1*03:01 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 143 809
HLA-DQA1*05:01/DQB1*03:19 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 143 809
HLA-DQA1*05:01/DQB1*03:01 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 135 762
HLA-DQA1*05:01/DQB1*03:19 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 135 762
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 135 757
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 135 757
HLA-DQA1*05:01/DQB1*03:01 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 92 506
HLA-DQA1*05:01/DQB1*03:19 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 92 506
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 125 685
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 125 685
HLA-DQA1*05:01/DQB1*03:01 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 157 860
HLA-DQA1*05:01/DQB1*03:19 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 157 860
HLA-DQA1*05:01/DQB1*03:01 MAGNGGDAALALLLLDRL MAGNCGDAALALLLLDRL 284 1554
HLA-DQA1*05:01/DQB1*03:19 MAGNGGDAALALLLLDRL MAGNCGDAALALLLLDRL 284 1554
HLA-DQA1*05:01/DQB1*03:01 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 197 1070
HLA-DQA1*05:01/DQB1*03:19 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 197 1070
HLA-DQA1*05:01/DQB1*03:01 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 121 649
HLA-DQA1*05:01/DQB1*03:19 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 121 649
HLA-DQA1*05:01/DQB1*03:01 AGNGGDAALALLLLD AGNCGDAALALLLLD 110 588
HLA-DQA1*05:01/DQB1*03:19 AGNGGDAALALLLLD AGNCGDAALALLLLD 110 588
HLA-DQA1*02:01/DQB1*03:01 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 125 656
HLA-DQA1*02:01/DQB1*03:19 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 125 656
HLA-DQA1*05:01/DQB1*03:01 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 142 743
HLA-DQA1*05:01/DQB1*03:19 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 142 743
HLA-DQA1*02:01/DQB1*03:01 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 121 632
HLA-DQA1*02:01/DQB1*03:19 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 121 632
HLA-DQA1*05:01/DQB1*03:01 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 121 630
HLA-DQA1*05:01/DQB1*03:19 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 121 630
HLA-DQA1*05:01/DQB1*03:01 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 116 603
HLA-DQA1*05:01/DQB1*03:19 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 116 603
HLA-DQA1*02:01/DQB1*03:01 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 133 680
HLA-DQA1*02:01/DQB1*03:19 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 133 680
HLA-DQA1*02:01/DQB1*03:01 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 121 617
HLA-DQA1*02:01/DQB1*03:19 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 121 617
HLA-DQA1*05:01/DQB1*03:01 MAGNGGDAALALLLLDRLN MAGNCGDAALALLLLDRLN 266 1341
HLA-DQA1*05:01/DQB1*03:19 MAGNGGDAALALLLLDRLN MAGNCGDAALALLLLDRLN 266 1341
HLA-DQA1*02:01/DQB1*03:01 ARMAGNGGDAALALL ARMAGNCGDAALALL 53 267
HLA-DQA1*02:01/DQB1*03:19 ARMAGNGGDAALALL ARMAGNCGDAALALL 53 267
HLA-DQA1*02:01/DQB1*03:01 PARMAGNGGDAALAL PARMAGNCGDAALAL 61 307
HLA-DQA1*02:01/DQB1*03:19 PARMAGNGGDAALAL PARMAGNCGDAALAL 61 307
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 114 560
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 114 560
HLA-DQA1*02:01/DQB1*03:01 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 79 388
HLA-DQA1*02:01/DQB1*03:19 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 79 388
HLA-DQA1*02:01/DQB1*03:01 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 69 333
HLA-DQA1*02:01/DQB1*03:19 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 69 333
HLA-DQA1*02:01/DQB1*03:01 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 100 482
HLA-DQA1*02:01/DQB1*03:19 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 100 482
HLA-DQA1*05:01/DQB1*03:01 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 156 751
HLA-DQA1*05:01/DQB1*03:19 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 156 751
HLA-DQA1*02:01/DQB1*03:01 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 103 494
HLA-DQA1*02:01/DQB1*03:19 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 103 494
HLA-DQA1*02:01/DQB1*03:01 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 76 363
HLA-DQA1*02:01/DQB1*03:19 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 76 363
HLA-DQA1*02:01/DQB1*03:01 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 71 339
HLA-DQA1*02:01/DQB1*03:19 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 71 339
HLA-DQA1*05:01/DQB1*03:01 SPARMAGNGGDAALA SPARMAGNCGDAALA 116 550
HLA-DQA1*05:01/DQB1*03:19 SPARMAGNGGDAALA SPARMAGNCGDAALA 116 550
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 158 745
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 158 745
HLA-DQA1*02:01/DQB1*03:01 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 154 726
HLA-DQA1*02:01/DQB1*03:19 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 154 726
HLA-DQA1*06:01/DQB1*03:01 ARMAGNGGDAALALL ARMAGNCGDAALALL 145 683
HLA-DQA1*06:01/DQB1*03:19 ARMAGNGGDAALALL ARMAGNCGDAALALL 145 683
HLA-DQA1*02:01/DQB1*03:01 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 104 489
HLA-DQA1*02:01/DQB1*03:19 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 104 489
HLA-DQA1*06:01/DQB1*03:01 RMAGNGGDAALALLL RMAGNCGDAALALLL 129 602
HLA-DQA1*06:01/DQB1*03:19 RMAGNGGDAALALLL RMAGNCGDAALALLL 129 602
HLA-DQA1*06:01/DQB1*03:01 PARMAGNGGDAALAL PARMAGNCGDAALAL 176 820
HLA-DQA1*06:01/DQB1*03:19 PARMAGNGGDAALAL PARMAGNCGDAALAL 176 820
HLA-DQA1*02:01/DQB1*03:01 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 117 545
HLA-DQA1*02:01/DQB1*03:19 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 117 545
HLA-DQA1*02:01/DQB1*03:01 PARMAGNGGDAALALL PARMAGNCGDAALALL 62 288
HLA-DQA1*02:01/DQB1*03:19 PARMAGNGGDAALALL PARMAGNCGDAALALL 62 288
HLA-DQA1*05:01/DQB1*03:01 MAGNGGDAALALLLLDRLNQ MAGNCGDAALALLLLDRLNQ 244 1128
HLA-DQA1*05:01/DQB1*03:19 MAGNGGDAALALLLLDRLNQ MAGNCGDAALALLLLDRLNQ 244 1128
HLA-DQA1*02:01/DQB1*03:01 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 60 276
HLA-DQA1*02:01/DQB1*03:19 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 60 276
HLA-DQA1*02:01/DQB1*03:01 RMAGNGGDAALALLL RMAGNCGDAALALLL 50 229
HLA-DQA1*02:01/DQB1*03:19 RMAGNGGDAALALLL RMAGNCGDAALALLL 50 229
HLA-DQA1*02:01/DQB1*03:01 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 56 255
HLA-DQA1*02:01/DQB1*03:19 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 56 255
HLA-DQA1*02:01/DQB1*03:01 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 87 395
HLA-DQA1*02:01/DQB1*03:19 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 87 395
HLA-DQA1*02:01/DQB1*03:01 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 99 448
HLA-DQA1*02:01/DQB1*03:19 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 99 448
HLA-DQA1*05:01/DQB1*03:01 AGNGGDAALALLLLDRL AGNCGDAALALLLLDRL 222 1001
HLA-DQA1*05:01/DQB1*03:19 AGNGGDAALALLLLDRL AGNCGDAALALLLLDRL 222 1001
HLA-DQA1*06:01/DQB1*03:01 MAGNGGDAALALLLL MAGNCGDAALALLLL 160 716
HLA-DQA1*06:01/DQB1*03:19 MAGNGGDAALALLLL MAGNCGDAALALLLL 160 716
HLA-DQA1*02:01/DQB1*03:01 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 90 402
HLA-DQA1*02:01/DQB1*03:19 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 90 402
HLA-DQA1*02:01/DQB1*03:01 MAGNGGDAALALLLLDRL MAGNCGDAALALLLLDRL 198 876
HLA-DQA1*02:01/DQB1*03:19 MAGNGGDAALALLLLDRL MAGNCGDAALALLLLDRL 198 876
HLA-DQA1*02:01/DQB1*03:01 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 96 424
HLA-DQA1*02:01/DQB1*03:19 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 96 424
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 264 1165
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 264 1165
HLA-DQA1*02:01/DQB1*03:01 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 84 370
HLA-DQA1*02:01/DQB1*03:19 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 84 370
HLA-DQA1*02:01/DQB1*03:01 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 77 334
HLA-DQA1*02:01/DQB1*03:19 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 77 334
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 111 481
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 111 481
HLA-DQA1*02:01/DQB1*03:01 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 110 472
HLA-DQA1*02:01/DQB1*03:19 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 110 472
HLA-DQA1*03:01/DQB1*03:01 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 182 775
HLA-DQA1*03:01/DQB1*03:19 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 182 775
HLA-DQA1*02:01/DQB1*03:01 MAGNGGDAALALLLL MAGNCGDAALALLLL 63 268
HLA-DQA1*02:01/DQB1*03:19 MAGNGGDAALALLLL MAGNCGDAALALLLL 63 268
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 126 535
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 126 535
HLA-DQA1*02:01/DQB1*03:01 SPARMAGNGGDAALA SPARMAGNCGDAALA 97 408
HLA-DQA1*02:01/DQB1*03:19 SPARMAGNGGDAALA SPARMAGNCGDAALA 97 408
HLA-DQA1*02:01/DQB1*03:01 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 98 412
HLA-DQA1*02:01/DQB1*03:19 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 98 412
HLA-DQA1*02:01/DQB1*03:01 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 81 340
HLA-DQA1*02:01/DQB1*03:19 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 81 340
HLA-DQA1*03:01/DQB1*03:01 RMAGNGGDAALALLL RMAGNCGDAALALLL 160 663
HLA-DQA1*03:01/DQB1*03:19 RMAGNGGDAALALLL RMAGNCGDAALALLL 160 663
HLA-DQA1*03:01/DQB1*03:01 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 243 1005
HLA-DQA1*03:01/DQB1*03:19 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 243 1005
HLA-DQA1*03:01/DQB1*03:01 MAGNGGDAALALLLL MAGNCGDAALALLLL 214 880
HLA-DQA1*03:01/DQB1*03:19 MAGNGGDAALALLLL MAGNCGDAALALLLL 214 880
HLA-DQA1*05:01/DQB1*03:01 AGNGGDAALALLLLDRLN AGNCGDAALALLLLDRLN 487 1999
HLA-DQA1*05:01/DQB1*03:19 AGNGGDAALALLLLDRLN AGNCGDAALALLLLDRLN 487 1999
HLA-DQA1*06:01/DQB1*03:01 PARMAGNGGDAALALL PARMAGNCGDAALALL 175 715
HLA-DQA1*06:01/DQB1*03:19 PARMAGNGGDAALALL PARMAGNCGDAALALL 175 715
HLA-DQA1*02:01/DQB1*03:01 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 101 411
HLA-DQA1*02:01/DQB1*03:19 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 101 411
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 80 325
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 80 325
HLA-DQA1*06:01/DQB1*03:01 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 212 851
HLA-DQA1*06:01/DQB1*03:19 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 212 851
HLA-DQA1*06:01/DQB1*03:01 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 334 1334
HLA-DQA1*06:01/DQB1*03:19 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 334 1334
HLA-DQA1*06:01/DQB1*03:01 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 152 606
HLA-DQA1*06:01/DQB1*03:19 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 152 606
HLA-DQA1*03:01/DQB1*03:01 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 252 1003
HLA-DQA1*03:01/DQB1*03:19 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 252 1003
HLA-DQA1*06:01/DQB1*03:01 SPARMAGNGGDAALA SPARMAGNCGDAALA 252 1002
HLA-DQA1*06:01/DQB1*03:19 SPARMAGNGGDAALA SPARMAGNCGDAALA 252 1002
HLA-DQA1*06:01/DQB1*03:01 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 161 640
HLA-DQA1*06:01/DQB1*03:19 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 161 640
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 194 766
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 194 766
HLA-DQA1*02:01/DQB1*03:01 MAGNGGDAALALLLLDRLN MAGNCGDAALALLLLDRLN 179 706
HLA-DQA1*02:01/DQB1*03:19 MAGNGGDAALALLLLDRLN MAGNCGDAALALLLLDRLN 179 706
HLA-DQA1*06:01/DQB1*03:01 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 334 1313
HLA-DQA1*06:01/DQB1*03:19 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 334 1313
HLA-DQA1*06:01/DQB1*03:01 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 221 862
HLA-DQA1*06:01/DQB1*03:19 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 221 862
HLA-DQA1*05:01/DQB1*03:01 AGNGGDAALALLLLDRLNQ AGNCGDAALALLLLDRLNQ 448 1747
HLA-DQA1*05:01/DQB1*03:19 AGNGGDAALALLLLDRLNQ AGNCGDAALALLLLDRLNQ 448 1747
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 216 837
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 216 837
HLA-DQA1*03:01/DQB1*03:01 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 232 898
HLA-DQA1*03:01/DQB1*03:19 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 232 898
HLA-DQA1*03:01/DQB1*03:01 ARMAGNGGDAALALL ARMAGNCGDAALALL 176 680
HLA-DQA1*03:01/DQB1*03:19 ARMAGNGGDAALALL ARMAGNCGDAALALL 176 680
HLA-DQA1*05:01/DQB1*03:01 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 153 590
HLA-DQA1*05:01/DQB1*03:19 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 153 590
HLA-DQA1*03:01/DQB1*03:01 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 383 1473
HLA-DQA1*03:01/DQB1*03:19 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 383 1473
HLA-DQA1*03:01/DQB1*03:01 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 172 661
HLA-DQA1*03:01/DQB1*03:19 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 172 661
HLA-DQA1*03:01/DQB1*03:01 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 402 1534
HLA-DQA1*03:01/DQB1*03:19 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 402 1534
HLA-DQA1*05:01/DQB1*03:01 AGNGGDAALALLLLDRLNQL AGNCGDAALALLLLDRLNQL 416 1581
HLA-DQA1*05:01/DQB1*03:19 AGNGGDAALALLLLDRLNQL AGNCGDAALALLLLDRLNQL 416 1581
HLA-DQA1*06:01/DQB1*03:01 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 344 1302
HLA-DQA1*06:01/DQB1*03:19 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 344 1302
HLA-DQA1*06:01/DQB1*03:01 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 205 772
HLA-DQA1*06:01/DQB1*03:19 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 205 772
HLA-DQA1*06:01/DQB1*03:01 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 205 768
HLA-DQA1*06:01/DQB1*03:19 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 205 768
HLA-DQA1*06:01/DQB1*03:01 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 361 1347
HLA-DQA1*06:01/DQB1*03:19 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 361 1347
HLA-DQA1*03:01/DQB1*03:01 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 386 1440
HLA-DQA1*03:01/DQB1*03:19 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 386 1440
HLA-DQA1*03:01/DQB1*03:01 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 387 1439
HLA-DQA1*03:01/DQB1*03:19 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 387 1439
HLA-DQA1*06:01/DQB1*03:01 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 208 772
HLA-DQA1*06:01/DQB1*03:19 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 208 772
HLA-DQA1*06:01/DQB1*03:01 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 400 1482
HLA-DQA1*06:01/DQB1*03:19 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 400 1482
HLA-DQA1*02:01/DQB1*03:01 MAGNGGDAALALLLLDRLNQ MAGNCGDAALALLLLDRLNQ 170 629
HLA-DQA1*02:01/DQB1*03:19 MAGNGGDAALALLLLDRLNQ MAGNCGDAALALLLLDRLNQ 170 629
HLA-DQA1*05:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 146 540
HLA-DQA1*05:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 146 540
HLA-DQA1*06:01/DQB1*03:01 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 299 1102
HLA-DQA1*06:01/DQB1*03:19 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 299 1102
HLA-DQA1*06:01/DQB1*03:01 AGNGGDAALALLLLD AGNCGDAALALLLLD 231 850
HLA-DQA1*06:01/DQB1*03:19 AGNGGDAALALLLLD AGNCGDAALALLLLD 231 850
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 132 485
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 132 485
HLA-DQA1*03:01/DQB1*03:01 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 379 1391
HLA-DQA1*03:01/DQB1*03:19 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 379 1391
HLA-DQA1*06:01/DQB1*03:01 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 241 883
HLA-DQA1*06:01/DQB1*03:19 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 241 883
HLA-DQA1*02:01/DQB1*03:01 AGNGGDAALALLLLD AGNCGDAALALLLLD 90 328
HLA-DQA1*02:01/DQB1*03:19 AGNGGDAALALLLLD AGNCGDAALALLLLD 90 328
HLA-DQA1*03:01/DQB1*03:01 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 346 1254
HLA-DQA1*03:01/DQB1*03:19 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 346 1254
HLA-DQA1*03:01/DQB1*03:01 PARMAGNGGDAALAL PARMAGNCGDAALAL 207 747
HLA-DQA1*03:01/DQB1*03:19 PARMAGNGGDAALAL PARMAGNCGDAALAL 207 747
HLA-DQA1*03:01/DQB1*03:01 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 226 815
HLA-DQA1*03:01/DQB1*03:19 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 226 815
HLA-DQA1*06:01/DQB1*03:01 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 279 1006
HLA-DQA1*06:01/DQB1*03:19 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 279 1006
HLA-DQA1*06:01/DQB1*03:01 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 266 959
HLA-DQA1*06:01/DQB1*03:19 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 266 959
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 87 312
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 87 312
HLA-DQA1*03:01/DQB1*03:01 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 346 1239
HLA-DQA1*03:01/DQB1*03:19 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 346 1239
HLA-DQA1*06:01/DQB1*03:01 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 338 1202
HLA-DQA1*06:01/DQB1*03:19 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 338 1202
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 198 701
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 198 701
HLA-DQA1*02:01/DQB1*03:01 AGNGGDAALALLLLDRLN AGNCGDAALALLLLDRLN 327 1155
HLA-DQA1*02:01/DQB1*03:19 AGNGGDAALALLLLDRLN AGNCGDAALALLLLDRLN 327 1155
HLA-DQA1*06:01/DQB1*03:01 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 229 808
HLA-DQA1*06:01/DQB1*03:19 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 229 808
HLA-DQA1*03:01/DQB1*03:01 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 339 1192
HLA-DQA1*03:01/DQB1*03:19 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 339 1192
HLA-DQA1*06:01/DQB1*03:01 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 247 867
HLA-DQA1*06:01/DQB1*03:19 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 247 867
HLA-DQA1*06:01/DQB1*03:01 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 251 881
HLA-DQA1*06:01/DQB1*03:19 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 251 881
HLA-DQA1*06:01/DQB1*03:01 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 293 1023
HLA-DQA1*06:01/DQB1*03:19 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 293 1023
HLA-DQA1*03:01/DQB1*03:01 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 342 1194
HLA-DQA1*03:01/DQB1*03:19 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 342 1194
HLA-DQA1*06:01/DQB1*03:01 MAGNGGDAALALLLLDRL MAGNCGDAALALLLLDRL 479 1671
HLA-DQA1*06:01/DQB1*03:19 MAGNGGDAALALLLLDRL MAGNCGDAALALLLLDRL 479 1671
HLA-DQA1*02:01/DQB1*03:01 AGNGGDAALALLLLDRL AGNCGDAALALLLLDRL 156 541
HLA-DQA1*02:01/DQB1*03:19 AGNGGDAALALLLLDRL AGNCGDAALALLLLDRL 156 541
HLA-DQA1*03:01/DQB1*03:01 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 370 1283
HLA-DQA1*03:01/DQB1*03:19 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 370 1283
HLA-DQA1*06:01/DQB1*03:01 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 279 967
HLA-DQA1*06:01/DQB1*03:19 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 279 967
HLA-DQA1*06:01/DQB1*03:01 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 304 1052
HLA-DQA1*06:01/DQB1*03:19 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 304 1052
HLA-DQA1*06:01/DQB1*03:01 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 297 1021
HLA-DQA1*06:01/DQB1*03:19 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 297 1021
HLA-DQA1*03:01/DQB1*03:01 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 333 1138
HLA-DQA1*03:01/DQB1*03:19 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 333 1138
HLA-DQA1*06:01/DQB1*03:01 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 280 956
HLA-DQA1*06:01/DQB1*03:19 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 280 956
HLA-DQA1*04:01/DQB1*03:01 ARMAGNGGDAALALL ARMAGNCGDAALALL 231 788
HLA-DQA1*04:01/DQB1*03:19 ARMAGNGGDAALALL ARMAGNCGDAALALL 231 788
HLA-DQA1*03:01/DQB1*03:01 AGNGGDAALALLLLD AGNCGDAALALLLLD 317 1081
HLA-DQA1*03:01/DQB1*03:19 AGNGGDAALALLLLD AGNCGDAALALLLLD 317 1081
HLA-DQA1*04:01/DQB1*03:01 RMAGNGGDAALALLL RMAGNCGDAALALLL 208 708
HLA-DQA1*04:01/DQB1*03:19 RMAGNGGDAALALLL RMAGNCGDAALALLL 208 708
HLA-DQA1*02:01/DQB1*03:01 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 113 384
HLA-DQA1*02:01/DQB1*03:19 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 113 384
HLA-DQA1*02:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 93 316
HLA-DQA1*02:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 93 316
HLA-DQA1*06:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 315 1063
HLA-DQA1*06:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 315 1063
HLA-DQA1*03:01/DQB1*03:01 PARMAGNGGDAALALL PARMAGNCGDAALALL 197 664
HLA-DQA1*03:01/DQB1*03:19 PARMAGNGGDAALALL PARMAGNCGDAALALL 197 664
HLA-DQA1*06:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 222 745
HLA-DQA1*06:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 222 745
HLA-DQA1*06:01/DQB1*03:01 MAGNGGDAALALLLLDRLNQ MAGNCGDAALALLLLDRLNQ 410 1371
HLA-DQA1*06:01/DQB1*03:19 MAGNGGDAALALLLLDRLNQ MAGNCGDAALALLLLDRLNQ 410 1371
HLA-DQA1*03:01/DQB1*03:01 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 317 1054
HLA-DQA1*03:01/DQB1*03:19 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 317 1054
HLA-DQA1*03:01/DQB1*03:01 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 324 1065
HLA-DQA1*03:01/DQB1*03:19 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 324 1065
HLA-DQA1*06:01/DQB1*03:01 AGNGGDAALALLLLDRL AGNCGDAALALLLLDRL 404 1326
HLA-DQA1*06:01/DQB1*03:19 AGNGGDAALALLLLDRL AGNCGDAALALLLLDRL 404 1326
HLA-DQA1*06:01/DQB1*03:01 MAGNGGDAALALLLLDRLN MAGNCGDAALALLLLDRLN 453 1484
HLA-DQA1*06:01/DQB1*03:19 MAGNGGDAALALLLLDRLN MAGNCGDAALALLLLDRLN 453 1484
HLA-DQA1*03:01/DQB1*03:01 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 264 863
HLA-DQA1*03:01/DQB1*03:19 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 264 863
HLA-DQA1*04:01/DQB1*03:01 MAGNGGDAALALLLL MAGNCGDAALALLLL 244 793
HLA-DQA1*04:01/DQB1*03:19 MAGNGGDAALALLLL MAGNCGDAALALLLL 244 793
HLA-DQA1*06:01/DQB1*03:01 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 275 883
HLA-DQA1*06:01/DQB1*03:19 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 275 883
HLA-DQA1*03:01/DQB1*03:01 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 312 1001
HLA-DQA1*03:01/DQB1*03:19 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 312 1001
HLA-DQA1*04:01/DQB1*03:01 PARMAGNGGDAALAL PARMAGNCGDAALAL 268 859
HLA-DQA1*04:01/DQB1*03:19 PARMAGNGGDAALAL PARMAGNCGDAALAL 268 859
HLA-DQA1*02:01/DQB1*03:01 AGNGGDAALALLLLDRLNQ AGNCGDAALALLLLDRLNQ 286 906
HLA-DQA1*02:01/DQB1*03:19 AGNGGDAALALLLLDRLNQ AGNCGDAALALLLLDRLNQ 286 906
HLA-DQA1*04:01/DQB1*03:01 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 219 683
HLA-DQA1*04:01/DQB1*03:19 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 219 683
HLA-DQA1*04:01/DQB1*03:01 PARMAGNGGDAALALL PARMAGNCGDAALALL 236 735
HLA-DQA1*04:01/DQB1*03:19 PARMAGNGGDAALALL PARMAGNCGDAALALL 236 735
HLA-DQA1*02:01/DQB1*03:01 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 126 391
HLA-DQA1*02:01/DQB1*03:19 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 126 391
HLA-DQA1*02:01/DQB1*03:01 AGNGGDAALALLLLDRLNQL AGNCGDAALALLLLDRLNQL 273 843
HLA-DQA1*02:01/DQB1*03:19 AGNGGDAALALLLLDRLNQL AGNCGDAALALLLLDRLNQL 273 843
HLA-DQA1*03:01/DQB1*03:01 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 307 945
HLA-DQA1*03:01/DQB1*03:19 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 307 945
HLA-DQA1*04:01/DQB1*03:01 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 280 859
HLA-DQA1*04:01/DQB1*03:19 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 280 859
HLA-DQA1*04:01/DQB1*03:01 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 343 1051
HLA-DQA1*04:01/DQB1*03:19 SPARMAGNGGDAALALLL SPARMAGNCGDAALALLL 343 1051
HLA-DQA1*03:01/DQB1*03:01 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 363 1111
HLA-DQA1*03:01/DQB1*03:19 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 363 1111
HLA-DQA1*04:01/DQB1*03:01 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 287 877
HLA-DQA1*04:01/DQB1*03:19 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 287 877
HLA-DQA1*04:01/DQB1*03:01 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 344 1051
HLA-DQA1*04:01/DQB1*03:19 PARMAGNGGDAALALLLL PARMAGNCGDAALALLLL 344 1051
HLA-DQA1*06:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 251 766
HLA-DQA1*06:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 251 766
HLA-DQA1*03:01/DQB1*03:01 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 239 729
HLA-DQA1*03:01/DQB1*03:19 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 239 729
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 161 487
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 161 487
HLA-DQA1*04:01/DQB1*03:01 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 208 628
HLA-DQA1*04:01/DQB1*03:19 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 208 628
HLA-DQA1*04:01/DQB1*03:01 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 277 832
HLA-DQA1*04:01/DQB1*03:19 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 277 832
HLA-DQA1*06:01/DQB1*03:01 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 304 908
HLA-DQA1*06:01/DQB1*03:19 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 304 908
HLA-DQA1*03:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 286 850
HLA-DQA1*03:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 286 850
HLA-DQA1*03:01/DQB1*03:01 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 445 1320
HLA-DQA1*03:01/DQB1*03:19 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 445 1320
HLA-DQA1*06:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 367 1086
HLA-DQA1*06:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 367 1086
HLA-DQA1*04:01/DQB1*03:01 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 327 958
HLA-DQA1*04:01/DQB1*03:19 SPARMAGNGGDAALALL SPARMAGNCGDAALALL 327 958
HLA-DQA1*04:01/DQB1*03:01 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 277 811
HLA-DQA1*04:01/DQB1*03:19 SPARMAGNGGDAALAL SPARMAGNCGDAALAL 277 811
HLA-DQA1*04:01/DQB1*03:01 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 406 1186
HLA-DQA1*04:01/DQB1*03:19 TSPARMAGNGGDAALALL TSPARMAGNCGDAALALL 406 1186
HLA-DQA1*06:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 271 789
HLA-DQA1*06:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 271 789
HLA-DQA1*04:01/DQB1*03:01 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 337 972
HLA-DQA1*04:01/DQB1*03:19 RMAGNGGDAALALLLLDR RMAGNCGDAALALLLLDR 337 972
HLA-DQA1*04:01/DQB1*03:01 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 335 952
HLA-DQA1*04:01/DQB1*03:19 ARMAGNGGDAALALLLLD ARMAGNCGDAALALLLLD 335 952
HLA-DQA1*03:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 347 986
HLA-DQA1*03:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 347 986
HLA-DQA1*04:01/DQB1*03:01 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 233 659
HLA-DQA1*04:01/DQB1*03:19 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 233 659
HLA-DQA1*04:01/DQB1*03:01 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 376 1063
HLA-DQA1*04:01/DQB1*03:19 SPARMAGNGGDAALALLLL SPARMAGNCGDAALALLLL 376 1063
HLA-DQA1*03:01/DQB1*03:01 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 320 900
HLA-DQA1*03:01/DQB1*03:19 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 320 900
HLA-DQA1*04:01/DQB1*03:01 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 317 889
HLA-DQA1*04:01/DQB1*03:19 MAGNGGDAALALLLLDR MAGNCGDAALALLLLDR 317 889
HLA-DQA1*05:01/DQB1*03:01 GNGGDAALALLLLDR GNCGDAALALLLLDR 279 778
HLA-DQA1*05:01/DQB1*03:19 GNGGDAALALLLLDR GNCGDAALALLLLDR 279 778
HLA-DQA1*04:01/DQB1*03:01 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 371 1030
HLA-DQA1*04:01/DQB1*03:19 TSPARMAGNGGDAALALLL TSPARMAGNCGDAALALLL 371 1030
HLA-DQA1*04:01/DQB1*03:01 SPARMAGNGGDAALA SPARMAGNCGDAALA 401 1108
HLA-DQA1*04:01/DQB1*03:19 SPARMAGNGGDAALA SPARMAGNCGDAALA 401 1108
HLA-DQA1*04:01/DQB1*03:01 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 366 1008
HLA-DQA1*04:01/DQB1*03:19 PARMAGNGGDAALALLLLD PARMAGNCGDAALALLLLD 366 1008
HLA-DQA1*04:01/DQB1*03:01 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 401 1098
HLA-DQA1*04:01/DQB1*03:19 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 401 1098
HLA-DQA1*02:01/DQB1*03:01 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 185 506
HLA-DQA1*02:01/DQB1*03:19 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 185 506
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALA KRTSPARMAGNCGDAALA 491 1339
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALA KRTSPARMAGNCGDAALA 491 1339
HLA-DQA1*05:01/DQB1*03:01 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 300 817
HLA-DQA1*05:01/DQB1*03:19 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 300 817
HLA-DQA1*04:01/DQB1*03:01 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 407 1107
HLA-DQA1*04:01/DQB1*03:19 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 407 1107
HLA-DQA1*05:01/DQB1*03:01 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 221 601
HLA-DQA1*05:01/DQB1*03:19 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 221 601
HLA-DQA1*04:01/DQB1*03:01 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 390 1054
HLA-DQA1*04:01/DQB1*03:19 TSPARMAGNGGDAALAL TSPARMAGNCGDAALAL 390 1054
HLA-DQA1*05:01/DQB1*03:03 ARMAGNGGDAALALL ARMAGNCGDAALALL 355 959
HLA-DQA1*02:01/DQB1*03:01 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 126 340
HLA-DQA1*02:01/DQB1*03:19 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 126 340
HLA-DQA1*04:01/DQB1*03:01 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 490 1321
HLA-DQA1*04:01/DQB1*03:19 GTSPARMAGNGGDAALAL RTSPARMAGNCGDAALAL 490 1321
HLA-DQA1*04:01/DQB1*03:01 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 367 981
HLA-DQA1*04:01/DQB1*03:19 ARMAGNGGDAALALLLLDR ARMAGNCGDAALALLLLDR 367 981
HLA-DQA1*04:01/DQB1*03:01 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 405 1080
HLA-DQA1*04:01/DQB1*03:19 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 405 1080
HLA-DQA1*06:01/DQB1*03:01 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 408 1086
HLA-DQA1*06:01/DQB1*03:19 GTSPARMAGNGGDAALA RTSPARMAGNCGDAALA 408 1086
HLA-DQA1*04:01/DQB1*03:01 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 404 1073
HLA-DQA1*04:01/DQB1*03:19 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 404 1073
HLA-DQA1*04:01/DQB1*03:01 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 464 1228
HLA-DQA1*04:01/DQB1*03:19 RMAGNGGDAALALLLLDRLN RMAGNCGDAALALLLLDRLN 464 1228
HLA-DQA1*04:01/DQB1*03:01 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 401 1059
HLA-DQA1*04:01/DQB1*03:19 RMAGNGGDAALALLLLDRL RMAGNCGDAALALLLLDRL 401 1059
HLA-DQA1*04:01/DQB1*03:01 MAGNGGDAALALLLLDRL MAGNCGDAALALLLLDRL 415 1094
HLA-DQA1*04:01/DQB1*03:19 MAGNGGDAALALLLLDRL MAGNCGDAALALLLLDRL 415 1094
HLA-DQA1*04:01/DQB1*03:01 AGNGGDAALALLLLD AGNCGDAALALLLLD 303 795
HLA-DQA1*04:01/DQB1*03:19 AGNGGDAALALLLLD AGNCGDAALALLLLD 303 795
HLA-DQA1*05:01/DQB1*03:03 RMAGNGGDAALALLL RMAGNCGDAALALLL 291 761
HLA-DQA1*04:01/DQB1*03:01 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 433 1132
HLA-DQA1*04:01/DQB1*03:19 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 433 1132
HLA-DQA1*03:01/DQB1*03:01 SPARMAGNGGDAALA SPARMAGNCGDAALA 337 872
HLA-DQA1*03:01/DQB1*03:19 SPARMAGNGGDAALA SPARMAGNCGDAALA 337 872
HLA-DQA1*04:01/DQB1*03:01 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 423 1082
HLA-DQA1*04:01/DQB1*03:19 GTSPARMAGNGGDAALALL RTSPARMAGNCGDAALALL 423 1082
HLA-DQA1*05:01/DQB1*03:01 GNGGDAALALLLLDRL GNCGDAALALLLLDRL 424 1084
HLA-DQA1*05:01/DQB1*03:19 GNGGDAALALLLLDRL GNCGDAALALLLLDRL 424 1084
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAALA KRTSPARMAGNCGDAALA 371 940
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAALA KRTSPARMAGNCGDAALA 371 940
HLA-DQA1*03:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 293 729
HLA-DQA1*03:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 293 729
HLA-DQA1*06:01/DQB1*03:01 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 348 854
HLA-DQA1*06:01/DQB1*03:19 SSRGTSPARMAGNGGDAALA SSKRTSPARMAGNCGDAALA 348 854
HLA-DQA1*05:01/DQB1*03:03 PARMAGNGGDAALALL PARMAGNCGDAALALL 422 1035
HLA-DQA1*04:01/DQB1*03:01 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 457 1120
HLA-DQA1*04:01/DQB1*03:19 RGTSPARMAGNGGDAALALL KRTSPARMAGNCGDAALALL 457 1120
HLA-DQA1*05:01/DQB1*03:03 PARMAGNGGDAALAL PARMAGNCGDAALAL 439 1072
HLA-DQA1*05:01/DQB1*03:03 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 339 824
HLA-DQA1*04:01/DQB1*03:01 AGNGGDAALALLLLDRL AGNCGDAALALLLLDRL 420 1018
HLA-DQA1*04:01/DQB1*03:19 AGNGGDAALALLLLDRL AGNCGDAALALLLLDRL 420 1018
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNC 403 975
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNC 403 975
HLA-DQA1*04:01/DQB1*03:01 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 292 706
HLA-DQA1*04:01/DQB1*03:19 AGNGGDAALALLLLDR AGNCGDAALALLLLDR 292 706
HLA-DQA1*05:01/DQB1*03:03 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 326 787
HLA-DQA1*06:01/DQB1*03:01 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 478 1152
HLA-DQA1*06:01/DQB1*03:19 SRGTSPARMAGNGGDAALA SKRTSPARMAGNCGDAALA 478 1152
HLA-DQA1*04:01/DQB1*03:01 MAGNGGDAALALLLLDRLN MAGNCGDAALALLLLDRLN 491 1181
HLA-DQA1*04:01/DQB1*03:19 MAGNGGDAALALLLLDRLN MAGNCGDAALALLLLDRLN 491 1181
HLA-DQA1*04:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 489 1173
HLA-DQA1*04:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 489 1173
HLA-DQA1*04:01/DQB1*03:01 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 404 968
HLA-DQA1*04:01/DQB1*03:19 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 404 968
HLA-DQA1*06:01/DQB1*03:01 GSSRGTSPARMAGNG GSSKRTSPARMAGNC 424 1012
HLA-DQA1*06:01/DQB1*03:19 GSSRGTSPARMAGNG GSSKRTSPARMAGNC 424 1012
HLA-DQA1*05:01/DQB1*03:01 TPGSSRGTSPARMAGNG TPGSSKRTSPARMAGNC 430 1009
HLA-DQA1*05:01/DQB1*03:19 TPGSSRGTSPARMAGNG TPGSSKRTSPARMAGNC 430 1009
HLA-DQA1*05:01/DQB1*06:01 RMAGNGGDAALALLL RMAGNCGDAALALLL 493 1141
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMAGNGG NSTPGSSKRTSPARMAGNCG 420 965
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMAGNGG NSTPGSSKRTSPARMAGNCG 420 965
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNC 199 457
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNC 199 457
HLA-DQA1*06:01/DQB1*03:01 PGSSRGTSPARMAGNG PGSSKRTSPARMAGNC 491 1109
HLA-DQA1*06:01/DQB1*03:19 PGSSRGTSPARMAGNG PGSSKRTSPARMAGNC 491 1109
HLA-DQA1*03:01/DQB1*03:01 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 391 878
HLA-DQA1*03:01/DQB1*03:19 RGTSPARMAGNGGDAALAL KRTSPARMAGNCGDAALAL 391 878
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAGNGG NSTPGSSKRTSPARMAGNCG 202 453
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAGNGG NSTPGSSKRTSPARMAGNCG 202 453
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGNGG PGSSKRTSPARMAGNCG 452 999
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGNGG PGSSKRTSPARMAGNCG 452 999
HLA-DQA1*05:01/DQB1*03:01 GSSRGTSPARMAGNG GSSKRTSPARMAGNC 273 602
HLA-DQA1*05:01/DQB1*03:19 GSSRGTSPARMAGNG GSSKRTSPARMAGNC 273 602
HLA-DQA1*05:01/DQB1*03:03 RMAGNGGDAALALLLLD RMAGNCGDAALALLLLD 473 1043
HLA-DQA1*05:01/DQB1*03:03 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 459 1000
HLA-DQA1*06:01/DQB1*03:01 GNGGDAALALLLLDR GNCGDAALALLLLDR 472 1025
HLA-DQA1*06:01/DQB1*03:19 GNGGDAALALLLLDR GNCGDAALALLLLDR 472 1025
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAGNGGD STPGSSKRTSPARMAGNCGD 208 450
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAGNGGD STPGSSKRTSPARMAGNCGD 208 450
HLA-DQA1*03:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 319 688
HLA-DQA1*03:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SKRTSPARMAGNCGDAALAL 319 688
HLA-DQA1*03:01/DQB1*03:01 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 363 778
HLA-DQA1*03:01/DQB1*03:19 TSPARMAGNGGDAALA TSPARMAGNCGDAALA 363 778
HLA-DQA1*05:01/DQB1*03:03 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 483 1035
HLA-DQA1*05:01/DQB1*03:03 MAGNGGDAALALLLL MAGNCGDAALALLLL 369 790
HLA-DQA1*05:01/DQB1*03:03 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 472 1009
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGNG PGSSKRTSPARMAGNC 338 722
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGNG PGSSKRTSPARMAGNC 338 722
HLA-DQA1*02:01/DQB1*03:01 GNGGDAALALLLLDR GNCGDAALALLLLDR 177 377
HLA-DQA1*02:01/DQB1*03:19 GNGGDAALALLLLDR GNCGDAALALLLLDR 177 377
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAGNGGD STPGSSKRTSPARMAGNCGD 436 928
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAGNGGD STPGSSKRTSPARMAGNCGD 436 928
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAGNG NSTPGSSKRTSPARMAGNC 281 597
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAGNG NSTPGSSKRTSPARMAGNC 281 597
HLA-DQA1*05:01/DQB1*03:03 SPARMAGNGGDAALALLLLD SPARMAGNCGDAALALLLLD 459 973
HLA-DQA1*02:01/DQB1*03:01 GNGGDAALALLLLDRLN GNCGDAALALLLLDRLN 344 729
HLA-DQA1*02:01/DQB1*03:19 GNGGDAALALLLLDRLN GNCGDAALALLLLDRLN 344 729
HLA-DQA1*05:01/DQB1*03:03 TSPARMAGNGGDAALALLLL TSPARMAGNCGDAALALLLL 454 958
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGNG TPGSSKRTSPARMAGNC 209 441
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGNG TPGSSKRTSPARMAGNC 209 441
HLA-DQA1*05:01/DQB1*03:03 MAGNGGDAALALLLLD MAGNCGDAALALLLLD 447 940
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAGNGG STPGSSKRTSPARMAGNCG 292 611
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAGNGG STPGSSKRTSPARMAGNCG 292 611
HLA-DQA1*04:01/DQB1*06:01 ARMAGNGGDAALALL ARMAGNCGDAALALL 467 977
HLA-DQA1*04:01/DQB1*06:01 PARMAGNGGDAALALL PARMAGNCGDAALALL 492 1027
HLA-DQA1*02:01/DQB1*03:03 RMAGNGGDAALALLL RMAGNCGDAALALLL 337 701
HLA-DQA1*04:01/DQB1*06:01 PARMAGNGGDAALALLL PARMAGNCGDAALALLL 488 1012
HLA-DQA1*05:01/DQB1*03:03 PARMAGNGGDAALALLLLDR PARMAGNCGDAALALLLLDR 448 926
HLA-DQA1*05:01/DQB1*03:03 GTSPARMAGNGGDAALALLL RTSPARMAGNCGDAALALLL 456 941
HLA-DQA1*04:01/DQB1*06:01 RMAGNGGDAALALLL RMAGNCGDAALALLL 381 785
HLA-DQA1*02:01/DQB1*03:03 ARMAGNGGDAALALL ARMAGNCGDAALALL 471 959
HLA-DQA1*04:01/DQB1*06:01 MAGNGGDAALALLLL MAGNCGDAALALLLL 433 879
HLA-DQA1*04:01/DQB1*06:01 ARMAGNGGDAALALLL ARMAGNCGDAALALLL 407 825
HLA-DQA1*02:01/DQB1*03:01 GNGGDAALALLLLDRL GNCGDAALALLLLDRL 254 514
HLA-DQA1*02:01/DQB1*03:19 GNGGDAALALLLLDRL GNCGDAALALLLLDRL 254 514
HLA-DQA1*02:01/DQB1*03:03 RMAGNGGDAALALLLL RMAGNCGDAALALLLL 350 708
HLA-DQA1*04:01/DQB1*06:01 ARMAGNGGDAALALLLL ARMAGNCGDAALALLLL 472 953
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGNGGDA TPGSSKRTSPARMAGNCGDA 212 426
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGNGGDA TPGSSKRTSPARMAGNCGDA 212 426
HLA-DQA1*02:01/DQB1*03:03 ARMAGNGGDAALALLLLDRL ARMAGNCGDAALALLLLDRL 453 907

P383L

Reference  DAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    DAYKTFPPTEPKKDKKKKADETQALLQRQKKQQTVTLLPAADLDDFSKQLQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:04 QALPQRQKKQQTVTL QALLQRQKKQQTVTL 1824 52
HLA-DRB1*11:04 TQALPQRQKKQQTVTL TQALLQRQKKQQTVTL 3465 102
HLA-DRB1*11:04 TQALPQRQKKQQTVT TQALLQRQKKQQTVT 1917 61
HLA-DRB1*11:04 QALPQRQKKQQTVTLL QALLQRQKKQQTVTLL 3664 122
HLA-DRB1*11:04 TQALPQRQKKQQTVTLL TQALLQRQKKQQTVTLL 2871 98
HLA-DRB1*11:04 ETQALPQRQKKQQTVTL ETQALLQRQKKQQTVTL 2749 94
HLA-DRB1*11:04 ETQALPQRQKKQQTVT ETQALLQRQKKQQTVT 3593 137
HLA-DRB1*11:04 ETQALPQRQKKQQTV ETQALLQRQKKQQTV 1752 68
HLA-DRB1*11:04 DETQALPQRQKKQQTVT DETQALLQRQKKQQTVT 3292 128
HLA-DRB1*11:04 QALPQRQKKQQTVTLLP QALLQRQKKQQTVTLLP 2959 122
HLA-DRB1*11:04 ALPQRQKKQQTVTLL ALLQRQKKQQTVTLL 1872 79
HLA-DRB1*11:02 TQALPQRQKKQQTVT TQALLQRQKKQQTVT 2268 96
HLA-DRB1*13:01 TQALPQRQKKQQTVT TQALLQRQKKQQTVT 2268 96
HLA-DRB1*11:04 ADETQALPQRQKKQQTVTL ADETQALLQRQKKQQTVTL 3803 164
HLA-DRB1*11:04 DETQALPQRQKKQQTV DETQALLQRQKKQQTV 3969 174
HLA-DRB1*11:04 KADETQALPQRQKKQQTVTL KADETQALLQRQKKQQTVTL 2461 111
HLA-DRB1*11:04 DETQALPQRQKKQQTVTLL DETQALLQRQKKQQTVTLL 3611 165
HLA-DRB1*11:02 ETQALPQRQKKQQTV ETQALLQRQKKQQTV 2282 107
HLA-DRB1*13:01 ETQALPQRQKKQQTV ETQALLQRQKKQQTV 2282 107
HLA-DRB1*11:04 KKADETQALPQRQKKQQTVT KKADETQALLQRQKKQQTVT 3100 147
HLA-DRB1*11:01 TQALPQRQKKQQTVT TQALLQRQKKQQTVT 4567 217
HLA-DRB1*11:04 ALPQRQKKQQTVTLLP ALLQRQKKQQTVTLLP 3933 187
HLA-DRB1*11:02 QALPQRQKKQQTVTL QALLQRQKKQQTVTL 1553 74
HLA-DRB1*13:01 QALPQRQKKQQTVTL QALLQRQKKQQTVTL 1553 74
HLA-DRB1*11:04 ETQALPQRQKKQQTVTLLP ETQALLQRQKKQQTVTLLP 3472 166
HLA-DRB1*11:01 QALPQRQKKQQTVTL QALLQRQKKQQTVTL 3670 178
HLA-DRB1*11:04 ADETQALPQRQKKQQTV ADETQALLQRQKKQQTV 3255 158
HLA-DRB1*11:04 DETQALPQRQKKQQTVTLLP DETQALLQRQKKQQTVTLLP 2262 111
HLA-DRB1*11:04 ADETQALPQRQKKQQTVTLL ADETQALLQRQKKQQTVTLL 2198 109
HLA-DRB1*11:04 KADETQALPQRQKKQQTVT KADETQALLQRQKKQQTVT 4422 224
HLA-DRB1*11:01 TQALPQRQKKQQTVTL TQALLQRQKKQQTVTL 6506 339
HLA-DRB1*11:01 ETQALPQRQKKQQTV ETQALLQRQKKQQTV 4551 259
HLA-DRB1*11:04 DETQALPQRQKKQQT DETQALLQRQKKQQT 2553 146
HLA-DRB1*11:02 ETQALPQRQKKQQTVTL ETQALLQRQKKQQTVTL 2971 173
HLA-DRB1*13:01 ETQALPQRQKKQQTVTL ETQALLQRQKKQQTVTL 2971 173
HLA-DRB1*11:01 ETQALPQRQKKQQTVTL ETQALLQRQKKQQTVTL 5016 293
HLA-DRB1*11:02 TQALPQRQKKQQTVTL TQALLQRQKKQQTVTL 3866 230
HLA-DRB1*13:01 TQALPQRQKKQQTVTL TQALLQRQKKQQTVTL 3866 230
HLA-DRB1*11:04 DETQALPQRQKKQQTVTL DETQALLQRQKKQQTVTL 6880 427
HLA-DRB1*11:04 KKKADETQALPQRQKKQQTV KKKADETQALLQRQKKQQTV 3274 205
HLA-DRB1*11:01 ETQALPQRQKKQQTVT ETQALLQRQKKQQTVT 7508 477
HLA-DRB1*11:02 DETQALPQRQKKQQTVT DETQALLQRQKKQQTVT 4143 264
HLA-DRB1*13:01 DETQALPQRQKKQQTVT DETQALLQRQKKQQTVT 4143 264
HLA-DRB1*11:02 DETQALPQRQKKQQT DETQALLQRQKKQQT 3711 239
HLA-DRB1*13:01 DETQALPQRQKKQQT DETQALLQRQKKQQT 3711 239
HLA-DRB1*11:04 ETQALPQRQKKQQTVTLL ETQALLQRQKKQQTVTLL 6772 437
HLA-DRB1*11:04 TQALPQRQKKQQTVTLLPA TQALLQRQKKQQTVTLLPA 2758 179
HLA-DRB1*11:04 KKADETQALPQRQKKQQTV KKADETQALLQRQKKQQTV 4665 306
HLA-DRB1*11:04 ETQALPQRQKKQQTVTLLPA ETQALLQRQKKQQTVTLLPA 1684 111
HLA-DRB1*11:04 TQALPQRQKKQQTVTLLP TQALLQRQKKQQTVTLLP 7072 476
HLA-DRB1*11:01 DETQALPQRQKKQQTVT DETQALLQRQKKQQTVT 6585 447
HLA-DRB1*11:02 ETQALPQRQKKQQTVT ETQALLQRQKKQQTVT 5004 341
HLA-DRB1*13:01 ETQALPQRQKKQQTVT ETQALLQRQKKQQTVT 5004 341
HLA-DRB1*11:01 QALPQRQKKQQTVTLL QALLQRQKKQQTVTLL 5719 393
HLA-DRB1*11:01 TQALPQRQKKQQTVTLL TQALLQRQKKQQTVTLL 4339 302
HLA-DRB1*11:02 KADETQALPQRQKKQQTVTL KADETQALLQRQKKQQTVTL 2634 186
HLA-DRB1*13:01 KADETQALPQRQKKQQTVTL KADETQALLQRQKKQQTVTL 2634 186
HLA-DRB1*11:02 DETQALPQRQKKQQTV DETQALLQRQKKQQTV 5533 401
HLA-DRB1*13:01 DETQALPQRQKKQQTV DETQALLQRQKKQQTV 5533 401
HLA-DRB1*11:02 ADETQALPQRQKKQQTV ADETQALLQRQKKQQTV 4147 301
HLA-DRB1*13:01 ADETQALPQRQKKQQTV ADETQALLQRQKKQQTV 4147 301
HLA-DRB1*11:01 KADETQALPQRQKKQQTVTL KADETQALLQRQKKQQTVTL 4111 307
HLA-DRB1*11:02 KKADETQALPQRQKKQQTVT KKADETQALLQRQKKQQTVT 3567 267
HLA-DRB1*13:01 KKADETQALPQRQKKQQTVT KKADETQALLQRQKKQQTVT 3567 267
HLA-DRB1*11:04 LPQRQKKQQTVTLLP LLQRQKKQQTVTLLP 2147 164
HLA-DRB1*11:02 ADETQALPQRQKKQQTVTL ADETQALLQRQKKQQTVTL 4081 312
HLA-DRB1*13:01 ADETQALPQRQKKQQTVTL ADETQALLQRQKKQQTVTL 4081 312
HLA-DRB1*11:02 TQALPQRQKKQQTVTLL TQALLQRQKKQQTVTLL 2327 179
HLA-DRB1*13:01 TQALPQRQKKQQTVTLL TQALLQRQKKQQTVTLL 2327 179
HLA-DRB1*11:01 KKADETQALPQRQKKQQTVT KKADETQALLQRQKKQQTVT 5385 422
HLA-DRB1*11:01 ALPQRQKKQQTVTLL ALLQRQKKQQTVTLL 3220 259
HLA-DRB1*08:04 TQALPQRQKKQQTVT TQALLQRQKKQQTVT 3986 321
HLA-DRB1*11:02 QALPQRQKKQQTVTLLP QALLQRQKKQQTVTLLP 2437 197
HLA-DRB1*13:01 QALPQRQKKQQTVTLLP QALLQRQKKQQTVTLLP 2437 197
HLA-DRB1*11:04 ALPQRQKKQQTVTLLPA ALLQRQKKQQTVTLLPA 2197 180
HLA-DRB1*11:01 QALPQRQKKQQTVTLLP QALLQRQKKQQTVTLLP 4368 359
HLA-DRB1*11:02 ALPQRQKKQQTVTLL ALLQRQKKQQTVTLL 1145 95
HLA-DRB1*13:01 ALPQRQKKQQTVTLL ALLQRQKKQQTVTLL 1145 95
HLA-DRB1*11:02 QALPQRQKKQQTVTLL QALLQRQKKQQTVTLL 3019 252
HLA-DRB1*13:01 QALPQRQKKQQTVTLL QALLQRQKKQQTVTLL 3019 252
HLA-DRB1*11:02 KADETQALPQRQKKQQTVT KADETQALLQRQKKQQTVT 5591 472
HLA-DRB1*13:01 KADETQALPQRQKKQQTVT KADETQALLQRQKKQQTVT 5591 472
HLA-DRB1*11:01 ADETQALPQRQKKQQTVTLL ADETQALLQRQKKQQTVTLL 3473 299
HLA-DRB1*11:04 ADETQALPQRQKKQQT ADETQALLQRQKKQQT 4386 383
HLA-DRB1*08:04 QALPQRQKKQQTVTL QALLQRQKKQQTVTL 3352 294
HLA-DRB1*11:02 KKKADETQALPQRQKKQQTV KKKADETQALLQRQKKQQTV 3725 329
HLA-DRB1*13:01 KKKADETQALPQRQKKQQTV KKKADETQALLQRQKKQQTV 3725 329
HLA-DRB1*11:01 DETQALPQRQKKQQTVTLLP DETQALLQRQKKQQTVTLLP 3407 306
HLA-DRB1*11:02 ADETQALPQRQKKQQTVTLL ADETQALLQRQKKQQTVTLL 1990 180
HLA-DRB1*13:01 ADETQALPQRQKKQQTVTLL ADETQALLQRQKKQQTVTLL 1990 180
HLA-DRB1*11:04 TQALPQRQKKQQTVTLLPAA TQALLQRQKKQQTVTLLPAA 1367 125
HLA-DRB1*08:04 TQALPQRQKKQQTVTL TQALLQRQKKQQTVTL 5194 478
HLA-DRB1*11:04 KADETQALPQRQKKQQT KADETQALLQRQKKQQT 3647 348
HLA-DRB1*11:04 QALPQRQKKQQTVTLLPAA QALLQRQKKQQTVTLLPAA 2315 225
HLA-DRB1*11:02 DETQALPQRQKKQQTVTLLP DETQALLQRQKKQQTVTLLP 1862 182
HLA-DRB1*13:01 DETQALPQRQKKQQTVTLLP DETQALLQRQKKQQTVTLLP 1862 182
HLA-DRB1*08:04 ETQALPQRQKKQQTV ETQALLQRQKKQQTV 3533 346
HLA-DRB1*11:02 ALPQRQKKQQTVTLLP ALLQRQKKQQTVTLLP 3313 327
HLA-DRB1*13:01 ALPQRQKKQQTVTLLP ALLQRQKKQQTVTLLP 3313 327
HLA-DRB1*11:02 DETQALPQRQKKQQTVTLL DETQALLQRQKKQQTVTLL 3004 302
HLA-DRB1*13:01 DETQALPQRQKKQQTVTLL DETQALLQRQKKQQTVTLL 3004 302
HLA-DRB1*11:02 ETQALPQRQKKQQTVTLLP ETQALLQRQKKQQTVTLLP 3040 307
HLA-DRB1*13:01 ETQALPQRQKKQQTVTLLP ETQALLQRQKKQQTVTLLP 3040 307
HLA-DRB1*11:04 QALPQRQKKQQTVTLLPAAD QALLQRQKKQQTVTLLPAAD 1535 164
HLA-DRB1*11:04 KKKKADETQALPQRQKKQQT KKKKADETQALLQRQKKQQT 3933 431
HLA-DRB1*08:04 ETQALPQRQKKQQTVTL ETQALLQRQKKQQTVTL 4300 472
HLA-DRB1*11:02 LPQRQKKQQTVTLLP LLQRQKKQQTVTLLP 1339 161
HLA-DRB1*13:01 LPQRQKKQQTVTLLP LLQRQKKQQTVTLLP 1339 161
HLA-DRB1*11:01 ETQALPQRQKKQQTVTLLPA ETQALLQRQKKQQTVTLLPA 2534 309
HLA-DRB1*11:02 ETQALPQRQKKQQTVTLLPA ETQALLQRQKKQQTVTLLPA 1483 181
HLA-DRB1*13:01 ETQALPQRQKKQQTVTLLPA ETQALLQRQKKQQTVTLLPA 1483 181
HLA-DRB1*11:04 LPQRQKKQQTVTLLPA LLQRQKKQQTVTLLPA 3122 384
HLA-DRB1*08:04 TQALPQRQKKQQTVTLL TQALLQRQKKQQTVTLL 3890 488
HLA-DRB1*08:04 KADETQALPQRQKKQQTVTL KADETQALLQRQKKQQTVTL 3498 439
HLA-DRB1*11:02 ALPQRQKKQQTVTLLPA ALLQRQKKQQTVTLLPA 1960 249
HLA-DRB1*13:01 ALPQRQKKQQTVTLLPA ALLQRQKKQQTVTLLPA 1960 249
HLA-DRB1*11:04 ADETQALPQRQKKQQ ADETQALLQRQKKQQ 2546 330
HLA-DRB1*11:02 TQALPQRQKKQQTVTLLPA TQALLQRQKKQQTVTLLPA 2402 317
HLA-DRB1*13:01 TQALPQRQKKQQTVTLLPA TQALLQRQKKQQTVTLLPA 2402 317
HLA-DRB1*08:04 ALPQRQKKQQTVTLL ALLQRQKKQQTVTLL 2775 374
HLA-DRB1*11:01 LPQRQKKQQTVTLLP LLQRQKKQQTVTLLP 3512 494
HLA-DRB1*11:04 ALPQRQKKQQTVTLLPAAD ALLQRQKKQQTVTLLPAAD 2770 397
HLA-DRB1*08:04 ADETQALPQRQKKQQTVTLL ADETQALLQRQKKQQTVTLL 2986 428
HLA-DRB1*11:02 TQALPQRQKKQQTVTLLPAA TQALLQRQKKQQTVTLLPAA 1282 188
HLA-DRB1*13:01 TQALPQRQKKQQTVTLLPAA TQALLQRQKKQQTVTLLPAA 1282 188
HLA-DRB1*08:04 DETQALPQRQKKQQTVTLLP DETQALLQRQKKQQTVTLLP 2952 441
HLA-DRB1*11:02 QALPQRQKKQQTVTLLPAAD QALLQRQKKQQTVTLLPAAD 1391 216
HLA-DRB1*13:01 QALPQRQKKQQTVTLLPAAD QALLQRQKKQQTVTLLPAAD 1391 216
HLA-DRB1*11:04 KADETQALPQRQKKQ KADETQALLQRQKKQ 2711 421
HLA-DRB1*11:02 QALPQRQKKQQTVTLLPAA QALLQRQKKQQTVTLLPAA 2028 343
HLA-DRB1*13:01 QALPQRQKKQQTVTLLPAA QALLQRQKKQQTVTLLPAA 2028 343
HLA-DRB1*11:01 TQALPQRQKKQQTVTLLPAA TQALLQRQKKQQTVTLLPAA 1964 336
HLA-DRB1*11:01 QALPQRQKKQQTVTLLPAAD QALLQRQKKQQTVTLLPAAD 2141 402
HLA-DRB1*11:04 LPQRQKKQQTVTLLPAA LLQRQKKQQTVTLLPAA 1894 369
HLA-DRB1*11:02 ALPQRQKKQQTVTLLPAAD ALLQRQKKQQTVTLLPAAD 2386 471
HLA-DRB1*13:01 ALPQRQKKQQTVTLLPAAD ALLQRQKKQQTVTLLPAAD 2386 471
HLA-DRB1*08:04 ETQALPQRQKKQQTVTLLPA ETQALLQRQKKQQTVTLLPA 1950 429
HLA-DRB1*11:02 LPQRQKKQQTVTLLPAA LLQRQKKQQTVTLLPAA 1688 382
HLA-DRB1*13:01 LPQRQKKQQTVTLLPAA LLQRQKKQQTVTLLPAA 1688 382
HLA-DRB1*11:04 ALPQRQKKQQTVTLLPAADL ALLQRQKKQQTVTLLPAADL 1166 280
HLA-DRB1*11:02 ALPQRQKKQQTVTLLPAADL ALLQRQKKQQTVTLLPAADL 980 282
HLA-DRB1*13:01 ALPQRQKKQQTVTLLPAADL ALLQRQKKQQTVTLLPAADL 980 282
HLA-DRB1*08:04 TQALPQRQKKQQTVTLLPAA TQALLQRQKKQQTVTLLPAA 1402 423
HLA-DRB1*08:04 QALPQRQKKQQTVTLLPAAD QALLQRQKKQQTVTLLPAAD 1412 471
HLA-DQA1*01:02/DQB1*06:02 KKADETQALPQRQKKQ KKADETQALLQRQKKQ 1313 467
HLA-DPA1*03:01/DPB1*01:01 KKKKADETQALPQRQKKQQT KKKKADETQALLQRQKKQQT 1324 478
HLA-DPA1*03:01/DPB1*01:01 DKKKKADETQALPQRQKKQQ DKKKKADETQALLQRQKKQQ 1302 480
HLA-DPA1*03:01/DPB1*01:01 KDKKKKADETQALPQRQKKQ KDKKKKADETQALLQRQKKQ 1247 467
HLA-DPA1*03:01/DPB1*01:01 KKDKKKKADETQALPQRQKK KKDKKKKADETQALLQRQKK 1209 464
HLA-DRB1*11:02 PQRQKKQQTVTLLPA LQRQKKQQTVTLLPA 1146 450
HLA-DRB1*13:01 PQRQKKQQTVTLLPA LQRQKKQQTVTLLPA 1146 450
HLA-DQA1*01:02/DQB1*06:02 KKKADETQALPQRQKK KKKADETQALLQRQKK 1270 499
HLA-DPA1*03:01/DPB1*01:01 PKKDKKKKADETQALPQRQK PKKDKKKKADETQALLQRQK 1215 487
HLA-DRB1*11:02 LPQRQKKQQTVTLLPAADLD LLQRQKKQQTVTLLPAADLD 946 396
HLA-DRB1*13:01 LPQRQKKQQTVTLLPAADLD LLQRQKKQQTVTLLPAADLD 946 396
HLA-DPA1*04:01/DPB1*01:01 KKKKADETQALPQRQKK KKKKADETQALLQRQKK 1104 474
HLA-DPA1*04:01/DPB1*01:01 KKKADETQALPQRQKKQQTV KKKADETQALLQRQKKQQTV 1004 446
HLA-DPA1*04:01/DPB1*01:01 KDKKKKADETQALPQRQKK KDKKKKADETQALLQRQKK 1094 494
HLA-DPA1*04:01/DPB1*01:01 KKKKADETQALPQRQK KKKKADETQALLQRQK 977 451
HLA-DPA1*04:01/DPB1*01:01 KKKKADETQALPQRQKKQQT KKKKADETQALLQRQKKQQT 759 352
HLA-DPA1*04:01/DPB1*01:01 DKKKKADETQALPQRQKKQQ DKKKKADETQALLQRQKKQQ 736 345
HLA-DPA1*04:01/DPB1*01:01 KKKKADETQALPQRQ KKKKADETQALLQRQ 1019 480
HLA-DPA1*04:01/DPB1*01:01 KKDKKKKADETQALPQRQKK KKDKKKKADETQALLQRQKK 688 329
HLA-DPA1*04:01/DPB1*01:01 KDKKKKADETQALPQRQKKQ KDKKKKADETQALLQRQKKQ 696 334
HLA-DPA1*04:01/DPB1*01:01 PKKDKKKKADETQALPQRQK PKKDKKKKADETQALLQRQK 710 344
HLA-DPA1*04:01/DPB1*01:01 DKKKKADETQALPQRQ DKKKKADETQALLQRQ 1026 500
HLA-DPA1*04:01/DPB1*01:01 EPKKDKKKKADETQALPQRQ EPKKDKKKKADETQALLQRQ 783 384

NS9c protein

NS9c

G50N

Reference  AAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           ||||||||||||||||||||||||| |||||||||||||||||||||||
Mutated    AAVKPLLVPHHVVATVQEIQLQAAVNELLLLEWLAIAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*13:02 QLQAAVGELLLLEWLA QLQAAVNELLLLEWLA 1993 489
HLA-DRB1*13:02 QLQAAVGELLLLEWL QLQAAVNELLLLEWL 848 223
HLA-DRB1*13:02 IQLQAAVGELLLLEWL IQLQAAVNELLLLEWL 1066 297
HLA-DRB1*13:02 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 435 139
HLA-DRB1*13:02 QEIQLQAAVGELLLLEWLAM QEIQLQAAVNELLLLEWLAI 887 291
HLA-DRB1*13:02 IQLQAAVGELLLLEWLA IQLQAAVNELLLLEWLA 1414 466
HLA-DRB1*13:02 EIQLQAAVGELLLLEWLAMA EIQLQAAVNELLLLEWLAIA 1063 356
HLA-DRB1*13:02 VQEIQLQAAVGELLLLEWLA VQEIQLQAAVNELLLLEWLA 762 260
HLA-DRB1*13:02 EIQLQAAVGELLLLEW EIQLQAAVNELLLLEW 498 172
HLA-DRB1*13:02 TVQEIQLQAAVGELLLLEWL TVQEIQLQAAVNELLLLEWL 694 242
HLA-DRB1*13:02 ATVQEIQLQAAVGELLLLEW ATVQEIQLQAAVNELLLLEW 654 233
HLA-DRB1*01:01 QLQAAVGELLLLEWL QLQAAVNELLLLEWL 47 130
HLA-DRB1*13:02 EIQLQAAVGELLLLEWLAM EIQLQAAVNELLLLEWLAI 1309 477
HLA-DRB1*13:02 QEIQLQAAVGELLLLE QEIQLQAAVNELLLLE 396 145
HLA-DRB1*13:02 VATVQEIQLQAAVGELLLLE VATVQEIQLQAAVNELLLLE 637 236
HLA-DRB1*13:02 EIQLQAAVGELLLLEWL EIQLQAAVNELLLLEWL 695 259
HLA-DRB1*13:02 QEIQLQAAVGELLLLEWLA QEIQLQAAVNELLLLEWLA 1027 387
HLA-DRB1*13:02 QEIQLQAAVGELLLLEW QEIQLQAAVNELLLLEW 553 211
HLA-DRB1*13:02 VQEIQLQAAVGELLLL VQEIQLQAAVNELLLL 415 160
HLA-DRB1*01:01 EIQLQAAVGELLLLEWL EIQLQAAVNELLLLEWL 51 131
HLA-DRB1*01:01 IQLQAAVGELLLLEWLA IQLQAAVNELLLLEWLA 96 245
HLA-DRB1*13:02 VQEIQLQAAVGELLLLEWL VQEIQLQAAVNELLLLEWL 867 341
HLA-DRB1*13:02 VVATVQEIQLQAAVGELLLL VVATVQEIQLQAAVNELLLL 738 299
HLA-DRB1*13:02 VQEIQLQAAVGELLLLE VQEIQLQAAVNELLLLE 469 191
HLA-DRB1*13:02 EIQLQAAVGELLLLE EIQLQAAVNELLLLE 211 86
HLA-DRB1*13:02 TVQEIQLQAAVGELLLLEW TVQEIQLQAAVNELLLLEW 799 328
HLA-DRB1*13:02 QEIQLQAAVGELLLL QEIQLQAAVNELLLL 210 87
HLA-DRB1*01:01 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 25 60
HLA-DRB1*01:01 QLQAAVGELLLLEWLAM QLQAAVNELLLLEWLAI 185 443
HLA-DRB1*01:01 QEIQLQAAVGELLLLEW QEIQLQAAVNELLLLEW 45 107
HLA-DRB1*04:01 EIQLQAAVGELLLLE EIQLQAAVNELLLLE 784 332
HLA-DRB1*01:01 EIQLQAAVGELLLLEW EIQLQAAVNELLLLEW 53 123
HLA-DRB1*13:02 ATVQEIQLQAAVGELLLLE ATVQEIQLQAAVNELLLLE 767 331
HLA-DRB1*01:01 IQLQAAVGELLLLEWL IQLQAAVNELLLLEWL 100 231
HLA-DRB1*01:01 VQEIQLQAAVGELLLLE VQEIQLQAAVNELLLLE 43 99
HLA-DRB1*04:04 EIQLQAAVGELLLLEW EIQLQAAVNELLLLEW 780 340
HLA-DRB1*04:04 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 705 308
HLA-DRB1*01:01 QLQAAVGELLLLEWLA QLQAAVNELLLLEWLA 198 452
HLA-DRB1*13:02 TVQEIQLQAAVGELLLL TVQEIQLQAAVNELLLL 525 231
HLA-DRB1*01:01 EIQLQAAVGELLLLE EIQLQAAVNELLLLE 16 36
HLA-DQA1*02:01/DQB1*03:01 QLQAAVGELLLLEWL QLQAAVNELLLLEWL 412 919
HLA-DQA1*02:01/DQB1*03:19 QLQAAVGELLLLEWL QLQAAVNELLLLEWL 412 919
HLA-DRB1*01:01 QEIQLQAAVGELLLL QEIQLQAAVNELLLL 18 40
HLA-DRB1*01:01 VQEIQLQAAVGELLL VQEIQLQAAVNELLL 21 45
HLA-DRB1*01:01 QEIQLQAAVGELLLLE QEIQLQAAVNELLLLE 49 105
HLA-DRB1*01:01 ATVQEIQLQAAVGELLL ATVQEIQLQAAVNELLL 71 151
HLA-DRB1*01:01 TVQEIQLQAAVGELLLL TVQEIQLQAAVNELLLL 56 119
HLA-DRB1*13:02 TVQEIQLQAAVGELLL TVQEIQLQAAVNELLL 404 195
HLA-DRB1*01:01 EIQLQAAVGELLLLEWLAM EIQLQAAVNELLLLEWLAI 154 318
HLA-DRB1*04:04 EIQLQAAVGELLLLE EIQLQAAVNELLLLE 408 198
HLA-DRB1*01:01 EIQLQAAVGELLLLEWLA EIQLQAAVNELLLLEWLA 372 758
HLA-DQA1*01:02/DQB1*06:04 TVQEIQLQAAVGELLL TVQEIQLQAAVNELLL 457 225
HLA-DQA1*01:02/DQB1*06:04 EIQLQAAVGELLLLEW EIQLQAAVNELLLLEW 522 258
HLA-DRB1*13:02 VATVQEIQLQAAVGELLLL VATVQEIQLQAAVNELLLL 874 433
HLA-DQA1*01:02/DQB1*06:04 VQEIQLQAAVGELLL VQEIQLQAAVNELLL 512 255
HLA-DRB1*04:01 QEIQLQAAVGELLLL QEIQLQAAVNELLLL 684 341
HLA-DQA1*02:01/DQB1*03:01 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 312 625
HLA-DQA1*02:01/DQB1*03:19 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 312 625

M60I

Reference  HVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           ||||||||||||||||||||||||| |||||||||||||
Mutated    HVVATVQEIQLQAAVNELLLLEWLAIAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*13:02 QEIQLQAAVGELLLLEWLAM QEIQLQAAVNELLLLEWLAI 887 291
HLA-DRB1*13:02 EIQLQAAVGELLLLEWLAMA EIQLQAAVNELLLLEWLAIA 1063 356
HLA-DRB1*13:02 EIQLQAAVGELLLLEWLAM EIQLQAAVNELLLLEWLAI 1309 477
HLA-DRB1*01:01 QLQAAVGELLLLEWLAM QLQAAVNELLLLEWLAI 185 443
HLA-DRB1*01:01 EIQLQAAVGELLLLEWLAM EIQLQAAVNELLLLEWLAI 154 318

NSP3 protein

NSP3

T428I

Reference  SVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SVEQRKQDDKKIKACVEEVTTTLEEIKFLTENLLLYIDINGNLHPDSATLV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*15:01 TTTLEETKFLTENLL TTTLEEIKFLTENLL 1854 278
HLA-DRB1*01:01 TTTLEETKFLTENLL TTTLEEIKFLTENLL 666 113
HLA-DRB1*15:01 TTLEETKFLTENLLL TTLEEIKFLTENLLL 807 142
HLA-DRB1*01:02 TTLEETKFLTENLLL TTLEEIKFLTENLLL 1002 181
HLA-DRB1*01:01 TTLEETKFLTENLLL TTLEEIKFLTENLLL 250 50
HLA-DRB1*15:03 TTLEETKFLTENLLL TTLEEIKFLTENLLL 1639 340
HLA-DRB1*01:02 TTTLEETKFLTENLL TTTLEEIKFLTENLL 1713 360
HLA-DRB1*15:01 TTTLEETKFLTENLLL TTTLEEIKFLTENLLL 2031 432
HLA-DRB1*15:01 VTTTLEETKFLTENLLL VTTTLEEIKFLTENLLL 1816 388
HLA-DRB1*01:02 TLEETKFLTENLLLY TLEEIKFLTENLLLY 586 128
HLA-DRB1*01:01 VTTTLEETKFLTENLL VTTTLEEIKFLTENLL 2153 483
HLA-DRB1*01:01 TTTLEETKFLTENLLL TTTLEEIKFLTENLLL 971 223
HLA-DPA1*03:01/DPB1*04:01 CVEEVTTTLEETKFL CVEEVTTTLEEIKFL 952 225
HLA-DRB1*01:02 TTTLEETKFLTENLLLY TTTLEEIKFLTENLLLY 1560 374
HLA-DPA1*03:01/DPB1*04:01 VEEVTTTLEETKFLT VEEVTTTLEEIKFLT 840 206
HLA-DRB1*15:01 TLEETKFLTENLLLY TLEEIKFLTENLLLY 378 93
HLA-DRB1*01:01 VTTTLEETKFLTENLLL VTTTLEEIKFLTENLLL 819 207
HLA-DRB1*01:01 EVTTTLEETKFLTENLL EVTTTLEEIKFLTENLL 1797 461
HLA-DPA1*03:01/DPB1*04:01 ACVEEVTTTLEETKFL ACVEEVTTTLEEIKFL 1060 274
HLA-DPA1*03:01/DPB1*04:01 ACVEEVTTTLEETKF ACVEEVTTTLEEIKF 1317 349
HLA-DPA1*03:01/DPB1*04:01 CVEEVTTTLEETKFLT CVEEVTTTLEEIKFLT 1045 280
HLA-DPA1*03:01/DPB1*04:01 KACVEEVTTTLEETKFL KACVEEVTTTLEEIKFL 965 259
HLA-DPA1*03:01/DPB1*04:01 ACVEEVTTTLEETKFLT ACVEEVTTTLEEIKFLT 971 263
HLA-DRB1*01:01 TLEETKFLTENLLLY TLEEIKFLTENLLLY 129 35
HLA-DRB1*01:02 TTLEETKFLTENLLLY TTLEEIKFLTENLLLY 1536 418
HLA-DRB1*10:01 TTTLEETKFLTENLL TTTLEEIKFLTENLL 791 217
HLA-DRB1*04:04 TTLEETKFLTENLLL TTLEEIKFLTENLLL 1509 419
HLA-DRB1*15:03 TLEETKFLTENLLLY TLEEIKFLTENLLLY 872 245
HLA-DRB1*01:02 EETKFLTENLLLYID EEIKFLTENLLLYID 455 128
HLA-DPA1*03:01/DPB1*04:01 IKACVEEVTTTLEETKFLT IKACVEEVTTTLEEIKFLT 895 252
HLA-DRB1*01:01 TTLEETKFLTENLLLY TTLEEIKFLTENLLLY 466 135
HLA-DRB1*15:01 TTLEETKFLTENLLLY TTLEEIKFLTENLLLY 961 279
HLA-DRB1*01:01 TTTLEETKFLTENLLLY TTTLEEIKFLTENLLLY 411 120
HLA-DRB1*15:01 TTTLEETKFLTENLLLY TTTLEEIKFLTENLLLY 834 244
HLA-DPA1*03:01/DPB1*02:01 VEEVTTTLEETKFLT VEEVTTTLEEIKFLT 747 220
HLA-DPA1*03:01/DPB1*02:01 CVEEVTTTLEETKFL CVEEVTTTLEEIKFL 784 238
HLA-DRB1*01:02 LEETKFLTENLLLYI LEEIKFLTENLLLYI 438 133
HLA-DQA1*01:02/DQB1*05:01 VTTTLEETKFLTENLL VTTTLEEIKFLTENLL 661 203
HLA-DPA1*03:01/DPB1*04:01 KACVEEVTTTLEETKF KACVEEVTTTLEEIKF 1373 424
HLA-DPA1*03:01/DPB1*04:01 KIKACVEEVTTTLEETKFL KIKACVEEVTTTLEEIKFL 844 261
HLA-DRB1*15:01 EETKFLTENLLLYID EEIKFLTENLLLYID 345 107
HLA-DRB1*01:02 TTLEETKFLTENLLLYI TTLEEIKFLTENLLLYI 1183 369
HLA-DQA1*01:02/DQB1*05:01 TTTLEETKFLTENLL TTTLEEIKFLTENLL 701 219
HLA-DPA1*03:01/DPB1*04:01 KIKACVEEVTTTLEETKFLT KIKACVEEVTTTLEEIKFLT 572 180
HLA-DRB1*16:01 TTLEETKFLTENLLL TTLEEIKFLTENLLL 1560 491
HLA-DPA1*03:01/DPB1*04:01 IKACVEEVTTTLEETKF IKACVEEVTTTLEEIKF 1291 410
HLA-DQA1*01:02/DQB1*05:01 EVTTTLEETKFLTENLL EVTTTLEEIKFLTENLL 775 247
HLA-DQA1*01:02/DQB1*05:01 EEVTTTLEETKFLTENLL EEVTTTLEEIKFLTENLL 1189 379
HLA-DRB1*10:01 EVTTTLEETKFLTENLL EVTTTLEEIKFLTENLL 1488 477
HLA-DRB1*15:02 TTLEETKFLTENLLL TTLEEIKFLTENLLL 1020 335
HLA-DRB1*01:02 TLEETKFLTENLLLYID TLEEIKFLTENLLLYID 1118 370
HLA-DPA1*03:01/DPB1*02:01 ACVEEVTTTLEETKF ACVEEVTTTLEEIKF 1096 363
HLA-DRB1*01:02 EETKFLTENLLLYIDIN EEIKFLTENLLLYIDIN 1156 388
HLA-DRB1*10:01 TTLEETKFLTENLLL TTLEEIKFLTENLLL 408 138
HLA-DPA1*03:01/DPB1*02:01 ACVEEVTTTLEETKFL ACVEEVTTTLEEIKFL 1044 354
HLA-DPA1*03:01/DPB1*02:01 CVEEVTTTLEETKFLT CVEEVTTTLEEIKFLT 1032 350
HLA-DRB1*15:01 LEETKFLTENLLLYI LEEIKFLTENLLLYI 283 96
HLA-DRB1*01:01 EETKFLTENLLLYID EEIKFLTENLLLYID 106 36
HLA-DPA1*03:01/DPB1*02:01 KACVEEVTTTLEETKFL KACVEEVTTTLEEIKFL 937 320
HLA-DRB1*15:03 EETKFLTENLLLYID EEIKFLTENLLLYID 720 246
HLA-DPA1*03:01/DPB1*02:01 ACVEEVTTTLEETKFLT ACVEEVTTTLEEIKFLT 950 325
HLA-DRB1*15:01 TLEETKFLTENLLLYID TLEEIKFLTENLLLYID 651 224
HLA-DRB1*01:02 EETKFLTENLLLYIDI EEIKFLTENLLLYIDI 1256 433
HLA-DRB1*01:02 TLEETKFLTENLLLYI TLEEIKFLTENLLLYI 1251 433
HLA-DRB1*01:02 LEETKFLTENLLLYIDI LEEIKFLTENLLLYIDI 1092 384
HLA-DPA1*03:01/DPB1*04:01 KKIKACVEEVTTTLEETKFL KKIKACVEEVTTTLEEIKFL 510 180
HLA-DRB1*16:01 TLEETKFLTENLLLY TLEEIKFLTENLLLY 910 329
HLA-DRB1*10:01 VTTTLEETKFLTENLLL VTTTLEEIKFLTENLLL 816 297
HLA-DRB1*15:01 TTLEETKFLTENLLLYI TTLEEIKFLTENLLLYI 580 212
HLA-DPA1*02:01/DPB1*01:01 VEEVTTTLEETKFLT VEEVTTTLEEIKFLT 1181 433
HLA-DRB1*10:01 TTTLEETKFLTENLLL TTTLEEIKFLTENLLL 912 337
HLA-DRB1*15:01 LEETKFLTENLLLYID LEEIKFLTENLLLYID 810 301
HLA-DRB1*15:01 TLEETKFLTENLLLYI TLEEIKFLTENLLLYI 714 266
HLA-DPA1*03:01/DPB1*02:01 IKACVEEVTTTLEETKFLT IKACVEEVTTTLEEIKFLT 799 299
HLA-DRB1*14:04 TTLEETKFLTENLLL TTLEEIKFLTENLLL 1184 446
HLA-DRB1*01:02 LEETKFLTENLLLYID LEEIKFLTENLLLYID 1207 455
HLA-DRB1*01:01 TLEETKFLTENLLLYID TLEEIKFLTENLLLYID 293 111
HLA-DPA1*03:01/DPB1*04:02 KIKACVEEVTTTLEETKFLT KIKACVEEVTTTLEEIKFLT 1270 488
HLA-DPA1*03:01/DPB1*105:01 KIKACVEEVTTTLEETKFLT KIKACVEEVTTTLEEIKFLT 1270 488
HLA-DRB1*01:01 EETKFLTENLLLYIDI EEIKFLTENLLLYIDI 346 133
HLA-DRB1*01:01 TTLEETKFLTENLLLYI TTLEEIKFLTENLLLYI 287 111
HLA-DRB1*15:01 LEETKFLTENLLLYIDI LEEIKFLTENLLLYIDI 641 248
HLA-DRB1*15:01 EETKFLTENLLLYIDI EEIKFLTENLLLYIDI 813 315
HLA-DQA1*01:02/DQB1*05:01 TTLEETKFLTENLLL TTLEEIKFLTENLLL 387 150
HLA-DRB1*15:03 LEETKFLTENLLLYI LEEIKFLTENLLLYI 658 256
HLA-DRB1*01:01 LEETKFLTENLLLYID LEEIKFLTENLLLYID 352 137
HLA-DRB1*01:01 LEETKFLTENLLLYI LEEIKFLTENLLLYI 95 37
HLA-DRB1*01:01 TLEETKFLTENLLLYI TLEEIKFLTENLLLYI 340 133
HLA-DPA1*03:01/DPB1*02:01 KIKACVEEVTTTLEETKFLT KIKACVEEVTTTLEEIKFLT 490 193
HLA-DPA1*03:01/DPB1*02:01 KIKACVEEVTTTLEETKFL KIKACVEEVTTTLEEIKFL 767 305
HLA-DRB1*04:04 TLEETKFLTENLLLY TLEEIKFLTENLLLY 681 271
HLA-DQA1*01:02/DQB1*05:01 VTTTLEETKFLTENLLL VTTTLEEIKFLTENLLL 431 173
HLA-DPA1*03:01/DPB1*04:01 DKKIKACVEEVTTTLEETKF DKKIKACVEEVTTTLEEIKF 657 267
HLA-DPA1*03:01/DPB1*01:01 CVEEVTTTLEETKFLT CVEEVTTTLEEIKFLT 371 151
HLA-DPA1*03:01/DPB1*04:01 KKIKACVEEVTTTLEETKF KKIKACVEEVTTTLEEIKF 947 387
HLA-DPA1*03:01/DPB1*02:01 IKACVEEVTTTLEETKF IKACVEEVTTTLEEIKF 1162 478
HLA-DQA1*01:02/DQB1*05:01 TTTLEETKFLTENLLL TTTLEEIKFLTENLLL 367 151
HLA-DRB1*01:01 EETKFLTENLLLYIDIN EEIKFLTENLLLYIDIN 289 119
HLA-DPA1*03:01/DPB1*04:02 KKIKACVEEVTTTLEETKFL KKIKACVEEVTTTLEEIKFL 1206 497
HLA-DPA1*03:01/DPB1*105:01 KKIKACVEEVTTTLEETKFL KKIKACVEEVTTTLEEIKFL 1206 497
HLA-DPA1*03:01/DPB1*01:01 ACVEEVTTTLEETKFL ACVEEVTTTLEEIKFL 366 151
HLA-DRB1*15:01 EETKFLTENLLLYIDIN EEIKFLTENLLLYIDIN 674 279
HLA-DQA1*01:02/DQB1*05:01 CVEEVTTTLEETKFLTENLL CVEEVTTTLEEIKFLTENLL 529 219
HLA-DQA1*01:02/DQB1*05:01 EVTTTLEETKFLTENLLL EVTTTLEEIKFLTENLLL 686 285
HLA-DRB1*01:01 LEETKFLTENLLLYIDI LEEIKFLTENLLLYIDI 276 116
HLA-DPA1*03:01/DPB1*01:01 CVEEVTTTLEETKFL CVEEVTTTLEEIKFL 347 148
HLA-DPA1*03:01/DPB1*01:01 VEEVTTTLEETKFLT VEEVTTTLEEIKFLT 318 136
HLA-DRB1*01:02 ETKFLTENLLLYIDI EIKFLTENLLLYIDI 507 217
HLA-DPA1*03:01/DPB1*01:01 ACVEEVTTTLEETKF ACVEEVTTTLEEIKF 467 200
HLA-DPA1*03:01/DPB1*01:01 ACVEEVTTTLEETKFLT ACVEEVTTTLEEIKFLT 368 158
HLA-DQA1*01:02/DQB1*05:01 VEEVTTTLEETKFLTENLL VEEVTTTLEEIKFLTENLL 631 271
HLA-DPA1*02:01/DPB1*01:01 KIKACVEEVTTTLEETKFLT KIKACVEEVTTTLEEIKFLT 1071 462
HLA-DQA1*01:03/DQB1*05:01 TTLEETKFLTENLLL TTLEEIKFLTENLLL 997 435
HLA-DPA1*03:01/DPB1*01:01 KACVEEVTTTLEETKFL KACVEEVTTTLEEIKFL 352 154
HLA-DPA1*01:03/DPB1*01:01 CVEEVTTTLEETKFL CVEEVTTTLEEIKFL 1018 446
HLA-DPA1*03:01/DPB1*01:01 IKACVEEVTTTLEETKFLT IKACVEEVTTTLEEIKFLT 351 154
HLA-DRB1*13:02 TTLEETKFLTENLLL TTLEEIKFLTENLLL 1070 471
HLA-DRB1*16:01 EETKFLTENLLLYID EEIKFLTENLLLYID 823 365
HLA-DPA1*03:01/DPB1*01:01 KACVEEVTTTLEETKF KACVEEVTTTLEEIKF 452 201
HLA-DPA1*03:01/DPB1*01:01 KACVEEVTTTLEETK KACVEEVTTTLEEIK 633 282
HLA-DPA1*03:01/DPB1*02:01 KKIKACVEEVTTTLEETKFL KKIKACVEEVTTTLEEIKFL 424 189
HLA-DPA1*01:03/DPB1*01:01 VEEVTTTLEETKFLT VEEVTTTLEEIKFLT 907 407
HLA-DPA1*03:01/DPB1*01:01 KACVEEVTTTLEETKFLT KACVEEVTTTLEEIKFLT 738 333
HLA-DPA1*02:01/DPB1*01:01 KKIKACVEEVTTTLEETKFL KKIKACVEEVTTTLEEIKFL 1031 469
HLA-DQA1*01:03/DQB1*05:01 TTTLEETKFLTENLLL TTTLEEIKFLTENLLL 1037 473
HLA-DRB1*15:02 TTLEETKFLTENLLLY TTLEEIKFLTENLLLY 898 412
HLA-DRB1*15:02 TLEETKFLTENLLLY TLEEIKFLTENLLLY 451 207
HLA-DPA1*02:02/DPB1*01:01 VEEVTTTLEETKFLT VEEVTTTLEEIKFLT 508 236
HLA-DRB1*16:01 LEETKFLTENLLLYI LEEIKFLTENLLLYI 729 339
HLA-DPA1*03:01/DPB1*04:01 DDKKIKACVEEVTTTLEETK DDKKIKACVEEVTTTLEEIK 828 389
HLA-DPA1*03:01/DPB1*01:01 KIKACVEEVTTTLEETKFL KIKACVEEVTTTLEEIKFL 323 152
HLA-DRB1*01:01 EVTTTLEETKFLTENLLLY EVTTTLEEIKFLTENLLLY 669 315
HLA-DPA1*03:01/DPB1*01:01 IKACVEEVTTTLEETKF IKACVEEVTTTLEEIKF 440 208
HLA-DQA1*05:01/DQB1*02:01 VEEVTTTLEETKFLTENLL VEEVTTTLEEIKFLTENLL 1051 498
HLA-DQA1*05:01/DQB1*02:02 VEEVTTTLEETKFLTENLL VEEVTTTLEEIKFLTENLL 1051 498
HLA-DPA1*02:02/DPB1*01:01 CVEEVTTTLEETKFL CVEEVTTTLEEIKFL 602 286
HLA-DPA1*03:01/DPB1*01:01 IKACVEEVTTTLEETK IKACVEEVTTTLEEIK 569 274
HLA-DPA1*03:01/DPB1*01:01 IKACVEEVTTTLEET IKACVEEVTTTLEEI 738 356
HLA-DPA1*03:01/DPB1*01:01 IKACVEEVTTTLEETKFL IKACVEEVTTTLEEIKFL 709 346
HLA-DRB1*10:01 TTTLEETKFLTENLLLY TTTLEEIKFLTENLLLY 391 192
HLA-DPA1*02:02/DPB1*01:01 KACVEEVTTTLEETKFL KACVEEVTTTLEEIKFL 643 316
HLA-DRB1*10:01 TLEETKFLTENLLLY TLEEIKFLTENLLLY 203 101
HLA-DPA1*03:01/DPB1*04:01 KACVEEVTTTLEETKFLTE KACVEEVTTTLEEIKFLTE 186 93

T725I

Reference  GQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTI
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    GQSTQLGIEFLKRGDKSVYYTSNPTIFHLDGEVITFDNLKTLLSLREVRTI

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*01:01 TSNPTTFHLDGEVIT TSNPTIFHLDGEVIT 641 30
HLA-DRB1*01:02 TSNPTTFHLDGEVIT TSNPTIFHLDGEVIT 1878 88
HLA-DRB1*01:02 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 1026 58
HLA-DRB1*01:02 NPTTFHLDGEVITFD NPTIFHLDGEVITFD 1075 62
HLA-DRB1*01:02 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 1320 77
HLA-DRB1*01:02 TSNPTTFHLDGEVITFD TSNPTIFHLDGEVITFD 2501 150
HLA-DRB1*01:02 SNPTTFHLDGEVITFD SNPTIFHLDGEVITFD 2244 135
HLA-DRB1*01:02 NPTTFHLDGEVITFDN NPTIFHLDGEVITFDN 2297 141
HLA-DRB1*01:02 SNPTTFHLDGEVITFDN SNPTIFHLDGEVITFDN 2420 149
HLA-DRB1*01:02 TSNPTTFHLDGEVITF TSNPTIFHLDGEVITF 2448 153
HLA-DRB1*01:02 NPTTFHLDGEVITFDNL NPTIFHLDGEVITFDNL 2576 161
HLA-DRB1*01:02 YTSNPTTFHLDGEVIT YTSNPTIFHLDGEVIT 3911 246
HLA-DRB1*01:02 YTSNPTTFHLDGEVITF YTSNPTIFHLDGEVITF 2728 177
HLA-DRB1*01:01 TSNPTTFHLDGEVITFD TSNPTIFHLDGEVITFD 1079 71
HLA-DRB1*01:01 YTSNPTTFHLDGEVI YTSNPTIFHLDGEVI 1333 88
HLA-DRB1*01:01 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 271 18
HLA-DRB1*01:01 YTSNPTTFHLDGEVIT YTSNPTIFHLDGEVIT 1848 126
HLA-DRB1*01:01 TSNPTTFHLDGEVITF TSNPTIFHLDGEVITF 965 66
HLA-DRB1*01:01 YTSNPTTFHLDGEVITF YTSNPTIFHLDGEVITF 931 64
HLA-DRB1*01:02 YTSNPTTFHLDGEVI YTSNPTIFHLDGEVI 3646 251
HLA-DRB1*15:01 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 3803 268
HLA-DRB1*01:01 NPTTFHLDGEVITFD NPTIFHLDGEVITFD 326 23
HLA-DRB1*01:01 SNPTTFHLDGEVITFDN SNPTIFHLDGEVITFDN 1002 71
HLA-DRB1*01:01 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 336 24
HLA-DRB1*01:01 SNPTTFHLDGEVITFD SNPTIFHLDGEVITFD 991 72
HLA-DRB1*01:02 PTTFHLDGEVITFDNL PTIFHLDGEVITFDNL 2816 208
HLA-DRB1*01:02 YYTSNPTTFHLDGEVIT YYTSNPTIFHLDGEVIT 3789 286
HLA-DRB1*01:01 NPTTFHLDGEVITFDNL NPTIFHLDGEVITFDNL 1011 77
HLA-DRB1*01:02 YTSNPTTFHLDGEVITFDNL YTSNPTIFHLDGEVITFDNL 2511 192
HLA-DRB1*01:02 TTFHLDGEVITFDNL TIFHLDGEVITFDNL 1817 139
HLA-DRB1*01:02 TSNPTTFHLDGEVITFDNLK TSNPTIFHLDGEVITFDNLK 2561 197
HLA-DRB1*01:02 TSNPTTFHLDGEVITFDNL TSNPTIFHLDGEVITFDNL 3252 252
HLA-DRB1*01:02 YTSNPTTFHLDGEVITFDN YTSNPTIFHLDGEVITFDN 3225 252
HLA-DRB1*01:01 YTSNPTTFHLDGEVITFDNL YTSNPTIFHLDGEVITFDNL 634 50
HLA-DRB1*01:02 YTSNPTTFHLDGEVITFD YTSNPTIFHLDGEVITFD 5876 473
HLA-DRB1*01:02 TSNPTTFHLDGEVITFDN TSNPTIFHLDGEVITFDN 5747 464
HLA-DRB1*01:02 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 2345 190
HLA-DRB1*01:02 PTTFHLDGEVITFDNLK PTIFHLDGEVITFDNLK 3034 246
HLA-DRB1*01:01 NPTTFHLDGEVITFDN NPTIFHLDGEVITFDN 934 76
HLA-DRB1*01:02 SNPTTFHLDGEVITFDNLK SNPTIFHLDGEVITFDNLK 3238 264
HLA-DRB1*01:01 TSNPTTFHLDGEVITFDNLK TSNPTIFHLDGEVITFDNLK 629 52
HLA-DRB1*01:02 YYTSNPTTFHLDGEVITFD YYTSNPTIFHLDGEVITFD 3127 259
HLA-DRB1*01:02 SNPTTFHLDGEVITFDNL SNPTIFHLDGEVITFDNL 5737 478
HLA-DRB1*01:01 TSNPTTFHLDGEVITFDNL TSNPTIFHLDGEVITFDNL 1249 105
HLA-DRB1*01:01 YTSNPTTFHLDGEVITFDN YTSNPTIFHLDGEVITFDN 1248 105
HLA-DRB1*15:01 NPTTFHLDGEVITFD NPTIFHLDGEVITFD 4417 374
HLA-DRB1*15:01 TSNPTTFHLDGEVIT TSNPTIFHLDGEVIT 5733 492
HLA-DRB1*01:01 SNPTTFHLDGEVITFDNLK SNPTIFHLDGEVITFDNLK 1234 112
HLA-DRB1*01:01 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 539 49
HLA-DRB1*01:02 SNPTTFHLDGEVITFDNLKT SNPTIFHLDGEVITFDNLKT 2266 207
HLA-DRB1*01:01 SNPTTFHLDGEVITFDNLKT SNPTIFHLDGEVITFDNLKT 601 55
HLA-DRB1*15:01 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 4739 437
HLA-DRB1*01:01 PTTFHLDGEVITFDNLK PTIFHLDGEVITFDNLK 1137 105
HLA-DRB1*01:01 TTFHLDGEVITFDNL TIFHLDGEVITFDNL 410 38
HLA-DRB1*01:01 YYTSNPTTFHLDGEVIT YYTSNPTIFHLDGEVIT 1187 111
HLA-DRB1*01:02 NPTTFHLDGEVITFDNLKT NPTIFHLDGEVITFDNLKT 3110 294
HLA-DRB1*01:01 YYTSNPTTFHLDGEVITFD YYTSNPTIFHLDGEVITFD 1103 105
HLA-DRB1*01:02 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 2041 196
HLA-DRB1*01:01 PTTFHLDGEVITFDNL PTIFHLDGEVITFDNL 1062 103
HLA-DRB1*01:01 YTSNPTTFHLDGEVITFD YTSNPTIFHLDGEVITFD 3428 349
HLA-DRB1*01:01 TSNPTTFHLDGEVITFDN TSNPTIFHLDGEVITFDN 3301 340
HLA-DRB1*01:01 NPTTFHLDGEVITFDNLKT NPTIFHLDGEVITFDNLKT 1205 127
HLA-DRB1*01:01 SNPTTFHLDGEVITFDNL SNPTIFHLDGEVITFDNL 3301 355
HLA-DRB1*01:02 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 2749 321
HLA-DRB1*01:02 NPTTFHLDGEVITFDNLKTL NPTIFHLDGEVITFDNLKTL 1967 234
HLA-DRB1*01:01 NPTTFHLDGEVITFDNLKTL NPTIFHLDGEVITFDNLKTL 528 63
HLA-DRB1*01:01 NPTTFHLDGEVITFDNLK NPTIFHLDGEVITFDNLK 3383 404
HLA-DRB1*15:02 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 2728 336
HLA-DRB1*01:01 YYTSNPTTFHLDGEVITF YYTSNPTIFHLDGEVITF 3248 411
HLA-DRB1*01:02 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 1790 233
HLA-DRB1*01:01 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 348 46
HLA-DRB1*15:02 NPTTFHLDGEVITFD NPTIFHLDGEVITFD 3063 428
HLA-DRB1*01:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 643 91
HLA-DRB1*10:01 TSNPTTFHLDGEVIT TSNPTIFHLDGEVIT 1437 207
HLA-DRB1*15:02 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 3128 483
HLA-DRB1*01:01 TTFHLDGEVITFDNLK TIFHLDGEVITFDNLK 1328 207
HLA-DRB1*10:01 YTSNPTTFHLDGEVI YTSNPTIFHLDGEVI 2157 348
HLA-DRB1*07:01 KRGDKSVYYTSNPTT KRGDKSVYYTSNPTI 871 149
HLA-DRB1*01:01 PTTFHLDGEVITFDNLKTL PTIFHLDGEVITFDNLKTL 1081 189
HLA-DRB1*01:01 TTFHLDGEVITFDNLKT TIFHLDGEVITFDNLKT 1207 214
HLA-DRB1*01:02 PTTFHLDGEVITFDNLKTL PTIFHLDGEVITFDNLKTL 2688 485
HLA-DRB1*13:02 KRGDKSVYYTSNPTT KRGDKSVYYTSNPTI 1790 329
HLA-DRB1*10:01 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 667 127
HLA-DRB1*15:02 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 2292 437
HLA-DRB1*01:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 224 44
HLA-DRB1*07:01 LKRGDKSVYYTSNPTT LKRGDKSVYYTSNPTI 2102 414
HLA-DRB1*01:01 PTTFHLDGEVITFDNLKTLL PTIFHLDGEVITFDNLKTLL 522 105
HLA-DRB1*01:01 YYTSNPTTFHLDGEVI YYTSNPTIFHLDGEVI 1596 335
HLA-DPA1*03:01/DPB1*02:01 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 1570 331
HLA-DRB1*10:01 YTSNPTTFHLDGEVIT YTSNPTIFHLDGEVIT 2351 500
HLA-DRB1*01:02 PTTFHLDGEVITFDNLKTLL PTIFHLDGEVITFDNLKTLL 1796 389
HLA-DRB1*10:01 NPTTFHLDGEVITFD NPTIFHLDGEVITFD 686 156
HLA-DRB1*10:01 YTSNPTTFHLDGEVITF YTSNPTIFHLDGEVITF 1300 308
HLA-DRB1*10:01 TSNPTTFHLDGEVITF TSNPTIFHLDGEVITF 1350 320
HLA-DRB1*07:01 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 1611 384
HLA-DRB1*15:02 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 1550 371
HLA-DRB1*01:02 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 1301 312
HLA-DRB1*15:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 1669 403
HLA-DRB1*10:01 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 625 151
HLA-DRB1*07:01 FLKRGDKSVYYTSNPTT FLKRGDKSVYYTSNPTI 1852 461
HLA-DPA1*03:01/DPB1*02:01 TSNPTTFHLDGEVITF TSNPTIFHLDGEVITF 1480 369
HLA-DQA1*01:02/DQB1*05:01 YTSNPTTFHLDGEVI YTSNPTIFHLDGEVI 1290 323
HLA-DRB1*10:01 YYTSNPTTFHLDGEVIT YYTSNPTIFHLDGEVIT 1225 316
HLA-DRB1*01:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 532 140
HLA-DPA1*03:01/DPB1*02:01 YTSNPTTFHLDGEVITF YTSNPTIFHLDGEVITF 1535 404
HLA-DRB1*13:02 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 1199 317
HLA-DRB1*10:01 TSNPTTFHLDGEVITFD TSNPTIFHLDGEVITFD 1397 373
HLA-DRB1*13:02 DKSVYYTSNPTTFHLDGEV DKSVYYTSNPTIFHLDGEV 500 136
HLA-DRB1*10:01 SNPTTFHLDGEVITFD SNPTIFHLDGEVITFD 1332 363
HLA-DRB1*13:02 KRGDKSVYYTSNPTTFHLD KRGDKSVYYTSNPTIFHLD 443 121
HLA-DRB1*13:02 RGDKSVYYTSNPTTFHLDG RGDKSVYYTSNPTIFHLDG 443 121
HLA-DRB1*13:02 GDKSVYYTSNPTTFHLDGE GDKSVYYTSNPTIFHLDGE 461 126
HLA-DRB1*10:01 YYTSNPTTFHLDGEVI YYTSNPTIFHLDGEVI 1466 401
HLA-DRB1*10:01 YYTSNPTTFHLDGEVITFD YYTSNPTIFHLDGEVITFD 1178 324
HLA-DRB1*13:02 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 552 152
HLA-DRB1*13:02 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 277 77
HLA-DRB1*15:02 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 963 269
HLA-DRB1*13:02 RGDKSVYYTSNPTTF RGDKSVYYTSNPTIF 336 94
HLA-DPA1*03:01/DPB1*02:01 SNPTTFHLDGEVITFD SNPTIFHLDGEVITFD 1393 391
HLA-DPA1*03:01/DPB1*02:01 NPTTFHLDGEVITFD NPTIFHLDGEVITFD 1248 352
HLA-DRB1*13:02 KRGDKSVYYTSNPTTFH KRGDKSVYYTSNPTIFH 664 190
HLA-DRB1*13:02 KSVYYTSNPTTFHLDG KSVYYTSNPTIFHLDG 348 100
HLA-DRB1*07:01 GIEFLKRGDKSVYYTSNPTT GIEFLKRGDKSVYYTSNPTI 929 268
HLA-DRB1*13:02 KSVYYTSNPTTFHLDGEV KSVYYTSNPTIFHLDGEV 1429 413
HLA-DQA1*01:02/DQB1*05:01 YYTSNPTTFHLDGEVI YYTSNPTIFHLDGEVI 912 264
HLA-DRB1*13:02 KSVYYTSNPTTFHLDGE KSVYYTSNPTIFHLDGE 440 128
HLA-DRB1*13:02 LKRGDKSVYYTSNPTTFHL LKRGDKSVYYTSNPTIFHL 388 113
HLA-DPA1*03:01/DPB1*01:01 YTSNPTTFHLDGEVI YTSNPTIFHLDGEVI 1584 463
HLA-DRB1*10:01 SNPTTFHLDGEVITFDN SNPTIFHLDGEVITFDN 1223 358
HLA-DRB1*13:02 GDKSVYYTSNPTTFH GDKSVYYTSNPTIFH 208 61
HLA-DRB1*10:01 YTSNPTTFHLDGEVITFDN YTSNPTIFHLDGEVITFDN 1400 411
HLA-DRB1*13:02 DKSVYYTSNPTTFHLDG DKSVYYTSNPTIFHLDG 422 124
HLA-DPA1*03:01/DPB1*02:01 TSNPTTFHLDGEVITFD TSNPTIFHLDGEVITFD 1495 440
HLA-DRB1*13:02 RGDKSVYYTSNPTTFH RGDKSVYYTSNPTIFH 530 156
HLA-DPA1*03:01/DPB1*02:01 NPTTFHLDGEVITFDN NPTIFHLDGEVITFDN 1397 412
HLA-DRB1*13:02 NPTTFHLDGEVITFD NPTIFHLDGEVITFD 1298 383
HLA-DPA1*03:01/DPB1*02:01 SNPTTFHLDGEVITFDN SNPTIFHLDGEVITFDN 1532 453
HLA-DRB1*13:02 GDKSVYYTSNPTTFHLD GDKSVYYTSNPTIFHLD 400 119
HLA-DRB1*13:02 DKSVYYTSNPTTFHLD DKSVYYTSNPTIFHLD 335 100
HLA-DRB1*13:02 KRGDKSVYYTSNPTTF KRGDKSVYYTSNPTIF 833 249
HLA-DRB1*10:01 YTSNPTTFHLDGEVITFDNL YTSNPTIFHLDGEVITFDNL 773 232
HLA-DRB1*13:02 SVYYTSNPTTFHLDGE SVYYTSNPTIFHLDGE 716 216
HLA-DRB1*13:02 KSVYYTSNPTTFHLD KSVYYTSNPTIFHLD 135 41
HLA-DRB1*13:02 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 1050 319
HLA-DRB1*10:01 TTFHLDGEVITFDNL TIFHLDGEVITFDNL 633 193
HLA-DRB1*13:02 DKSVYYTSNPTTFHLDGE DKSVYYTSNPTIFHLDGE 1383 422
HLA-DRB1*10:01 NPTTFHLDGEVITFDN NPTIFHLDGEVITFDN 1170 358
HLA-DPA1*03:01/DPB1*02:01 YTSNPTTFHLDGEVITFDN YTSNPTIFHLDGEVITFDN 1215 373
HLA-DRB1*13:02 GDKSVYYTSNPTTFHLDG GDKSVYYTSNPTIFHLDG 1301 400
HLA-DQA1*01:02/DQB1*05:01 TSNPTTFHLDGEVIT TSNPTIFHLDGEVIT 775 239
HLA-DRB1*13:02 RGDKSVYYTSNPTTFHLD RGDKSVYYTSNPTIFHLD 1279 395
HLA-DRB1*13:02 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 233 72
HLA-DRB1*10:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 653 202
HLA-DRB1*13:02 SVYYTSNPTTFHLDGEV SVYYTSNPTIFHLDGEV 888 276
HLA-DRB1*13:02 RGDKSVYYTSNPTTFHL RGDKSVYYTSNPTIFHL 344 107
HLA-DRB1*13:02 KRGDKSVYYTSNPTTFHL KRGDKSVYYTSNPTIFHL 1162 363
HLA-DRB1*13:02 LKRGDKSVYYTSNPTTF LKRGDKSVYYTSNPTIF 939 294
HLA-DPA1*03:01/DPB1*02:01 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 731 229
HLA-DPA1*03:01/DPB1*02:01 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 1172 371
HLA-DRB1*13:02 FLKRGDKSVYYTSNPTTFH FLKRGDKSVYYTSNPTIFH 580 184
HLA-DQA1*01:02/DQB1*05:01 YTSNPTTFHLDGEVIT YTSNPTIFHLDGEVIT 726 231
HLA-DRB1*13:02 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 201 64
HLA-DPA1*03:01/DPB1*02:01 YYTSNPTTFHLDGEVITFD YYTSNPTIFHLDGEVITFD 1038 331
HLA-DRB1*13:02 GDKSVYYTSNPTTFHL GDKSVYYTSNPTIFHL 282 90
HLA-DRB1*10:01 NPTTFHLDGEVITFDNL NPTIFHLDGEVITFDNL 1126 360
HLA-DRB1*13:02 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 197 63
HLA-DRB1*10:01 TSNPTTFHLDGEVITFDNL TSNPTIFHLDGEVITFDNL 1308 419
HLA-DRB1*10:01 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 599 192
HLA-DRB1*13:02 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 212 68
HLA-DRB1*13:02 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 264 85
HLA-DRB1*13:02 LKRGDKSVYYTSNPTTFHLD LKRGDKSVYYTSNPTIFHLD 194 63
HLA-DRB1*10:01 TSNPTTFHLDGEVITFDNLK TSNPTIFHLDGEVITFDNLK 717 235
HLA-DRB1*13:02 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 795 261
HLA-DPA1*03:01/DPB1*02:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 874 288
HLA-DRB1*13:02 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 469 155
HLA-DRB1*13:02 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 1335 442
HLA-DRB1*01:01 TFHLDGEVITFDNLK IFHLDGEVITFDNLK 752 250
HLA-DRB1*13:02 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 1423 475
HLA-DRB1*01:01 VYYTSNPTTFHLDGEVI VYYTSNPTIFHLDGEVI 667 223
HLA-DRB1*13:02 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 1244 417
HLA-DQA1*01:02/DQB1*05:01 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 492 165
HLA-DRB1*13:02 DKSVYYTSNPTTFHL DKSVYYTSNPTIFHL 113 38
HLA-DQA1*01:02/DQB1*05:01 YTSNPTTFHLDGEVITF YTSNPTIFHLDGEVITF 599 202
HLA-DQA1*01:02/DQB1*05:01 VYYTSNPTTFHLDGEVI VYYTSNPTIFHLDGEVI 814 278
HLA-DRB1*10:01 PTTFHLDGEVITFDNL PTIFHLDGEVITFDNL 1106 378
HLA-DQA1*01:02/DQB1*05:01 YYTSNPTTFHLDGEVITF YYTSNPTIFHLDGEVITF 907 311
HLA-DPA1*03:01/DPB1*02:01 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 615 211
HLA-DQA1*01:03/DQB1*05:01 TSNPTTFHLDGEVITF TSNPTIFHLDGEVITF 1318 453
HLA-DPA1*03:01/DPB1*04:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 1034 358
HLA-DQA1*01:03/DQB1*05:01 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 1303 453
HLA-DPA1*03:01/DPB1*04:01 YYTSNPTTFHLDGEVITFD YYTSNPTIFHLDGEVITFD 1241 433
HLA-DQA1*01:02/DQB1*05:01 TSNPTTFHLDGEVITF TSNPTIFHLDGEVITF 467 163
HLA-DQA1*01:02/DQB1*05:01 YYTSNPTTFHLDGEVIT YYTSNPTIFHLDGEVIT 765 268
HLA-DQA1*01:02/DQB1*05:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 411 144
HLA-DRB1*10:01 SNPTTFHLDGEVITFDNLK SNPTIFHLDGEVITFDNLK 1166 413
HLA-DPA1*03:01/DPB1*02:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 511 181
HLA-DRB1*10:01 PTTFHLDGEVITFDNLK PTIFHLDGEVITFDNLK 1033 366
HLA-DQA1*01:02/DQB1*05:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 437 155
HLA-DPA1*03:01/DPB1*04:01 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 824 296
HLA-DQA1*01:02/DQB1*05:01 VYYTSNPTTFHLDGEVIT VYYTSNPTIFHLDGEVIT 1082 389
HLA-DRB1*15:02 DKSVYYTSNPTTFHLD DKSVYYTSNPTIFHLD 534 192
HLA-DQA1*01:03/DQB1*05:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 981 353
HLA-DPA1*03:01/DPB1*02:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 839 303
HLA-DQA1*01:03/DQB1*05:01 YYTSNPTTFHLDGEVITFD YYTSNPTIFHLDGEVITFD 1204 435
HLA-DQA1*01:02/DQB1*05:01 YTSNPTTFHLDGEVITFDN YTSNPTIFHLDGEVITFDN 478 173
HLA-DQA1*01:02/DQB1*05:01 SVYYTSNPTTFHLDGEVI SVYYTSNPTIFHLDGEVI 1008 366
HLA-DRB1*15:02 KSVYYTSNPTTFHLDG KSVYYTSNPTIFHLDG 603 219
HLA-DPA1*03:01/DPB1*04:01 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 825 300
HLA-DPA1*03:01/DPB1*04:01 YTSNPTTFHLDGEVITFDN YTSNPTIFHLDGEVITFDN 1284 467
HLA-DRB1*13:02 EFLKRGDKSVYYTSNPTTFH EFLKRGDKSVYYTSNPTIFH 246 90
HLA-DQA1*01:02/DQB1*05:01 YYTSNPTTFHLDGEVITFD YYTSNPTIFHLDGEVITFD 445 163
HLA-DRB1*15:02 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 914 335
HLA-DQA1*01:02/DQB1*05:01 NPTTFHLDGEVITFD NPTIFHLDGEVITFD 485 178
HLA-DRB1*07:01 EFLKRGDKSVYYTSNPTTF EFLKRGDKSVYYTSNPTIF 350 129
HLA-DRB1*13:02 VYYTSNPTTFHLDGE VYYTSNPTIFHLDGE 537 198
HLA-DPA1*03:01/DPB1*04:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 531 196
HLA-DPA1*03:01/DPB1*04:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 1065 394
HLA-DPA1*03:01/DPB1*02:01 YTSNPTTFHLDGEVITFDNL YTSNPTIFHLDGEVITFDNL 589 218
HLA-DQA1*01:03/DQB1*05:01 SNPTTFHLDGEVITFD SNPTIFHLDGEVITFD 1313 486
HLA-DPA1*03:01/DPB1*04:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 607 225
HLA-DPA1*03:01/DPB1*04:01 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 1327 492
HLA-DRB1*13:02 FLKRGDKSVYYTSNPTTFHL FLKRGDKSVYYTSNPTIFHL 167 62
HLA-DPA1*03:01/DPB1*01:01 YYTSNPTTFHLDGEVI YYTSNPTIFHLDGEVI 1081 403
HLA-DRB1*15:02 GDKSVYYTSNPTTFHL GDKSVYYTSNPTIFHL 472 176
HLA-DRB1*15:02 SNPTTFHLDGEVITFDNLKT SNPTIFHLDGEVITFDNLKT 1177 439
HLA-DRB1*07:01 KRGDKSVYYTSNPTTF KRGDKSVYYTSNPTIF 260 97
HLA-DRB1*01:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 150 56
HLA-DRB1*10:01 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 363 136
HLA-DRB1*15:02 RGDKSVYYTSNPTTFHLDG RGDKSVYYTSNPTIFHLDG 639 240
HLA-DRB1*13:02 EFLKRGDKSVYYTSNPTTF EFLKRGDKSVYYTSNPTIF 756 284
HLA-DRB1*10:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 460 173
HLA-DRB1*15:02 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 489 184
HLA-DQA1*01:02/DQB1*05:01 PTTFHLDGEVITFDN PTIFHLDGEVITFDN 480 181
HLA-DPA1*03:01/DPB1*02:01 VYYTSNPTTFHLDGEVI VYYTSNPTIFHLDGEVI 1252 473
HLA-DPA1*03:01/DPB1*04:01 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 704 266
HLA-DRB1*15:02 KRGDKSVYYTSNPTTFHLD KRGDKSVYYTSNPTIFHLD 610 231
HLA-DRB1*15:02 GDKSVYYTSNPTTFHLDGE GDKSVYYTSNPTIFHLDGE 680 258
HLA-DQA1*01:03/DQB1*05:01 YTSNPTTFHLDGEVITFDN YTSNPTIFHLDGEVITFDN 1251 475
HLA-DRB1*07:01 FLKRGDKSVYYTSNPTTF FLKRGDKSVYYTSNPTIF 1164 445
HLA-DRB1*15:02 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 399 153
HLA-DQA1*01:02/DQB1*05:01 SNPTTFHLDGEVITFD SNPTIFHLDGEVITFD 430 165
HLA-DPA1*03:01/DPB1*02:01 TSNPTTFHLDGEVITFDNL TSNPTIFHLDGEVITFDNL 849 327
HLA-DQA1*01:02/DQB1*05:01 TSNPTTFHLDGEVITFD TSNPTIFHLDGEVITFD 553 213
HLA-DQA1*01:02/DQB1*05:01 YTSNPTTFHLDGEVITFD YTSNPTIFHLDGEVITFD 908 350
HLA-DQA1*01:02/DQB1*05:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 215 83
HLA-DQA1*01:02/DQB1*05:01 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 261 101
HLA-DQA1*01:02/DQB1*05:01 TSNPTTFHLDGEVITFDN TSNPTIFHLDGEVITFDN 922 358
HLA-DRB1*15:02 DKSVYYTSNPTTFHLDGEV DKSVYYTSNPTIFHLDGEV 775 301
HLA-DRB1*01:01 TTFHLDGEVITFDNLKTLL TIFHLDGEVITFDNLKTLL 1019 396
HLA-DQA1*01:02/DQB1*05:01 NPTTFHLDGEVITFDN NPTIFHLDGEVITFDN 450 175
HLA-DRB1*15:02 RGDKSVYYTSNPTTFH RGDKSVYYTSNPTIFH 648 253
HLA-DPA1*03:01/DPB1*02:01 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 609 238
HLA-DQA1*01:02/DQB1*05:01 SNPTTFHLDGEVITFDN SNPTIFHLDGEVITFDN 554 217
HLA-DPA1*03:01/DPB1*04:01 GDKSVYYTSNPTTFHLD GDKSVYYTSNPTIFHLD 974 382
HLA-DRB1*15:02 LKRGDKSVYYTSNPTTFHL LKRGDKSVYYTSNPTIFHL 565 222
HLA-DRB1*07:01 LKRGDKSVYYTSNPTTF LKRGDKSVYYTSNPTIF 287 113
HLA-DRB1*15:02 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 768 303
HLA-DRB1*15:02 DKSVYYTSNPTTFHLDG DKSVYYTSNPTIFHLDG 631 249
HLA-DQA1*01:02/DQB1*05:01 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 354 140
HLA-DRB1*15:02 GDKSVYYTSNPTTFHLD GDKSVYYTSNPTIFHLD 575 229
HLA-DPA1*03:01/DPB1*04:01 DKSVYYTSNPTTFHLDG DKSVYYTSNPTIFHLDG 1016 405
HLA-DRB1*15:02 GDKSVYYTSNPTTFH GDKSVYYTSNPTIFH 336 134
HLA-DPA1*03:01/DPB1*04:01 KSVYYTSNPTTFHLD KSVYYTSNPTIFHLD 733 293
HLA-DPA1*03:01/DPB1*02:01 GDKSVYYTSNPTTFH GDKSVYYTSNPTIFH 818 327
HLA-DRB1*07:01 IEFLKRGDKSVYYTSNPTTF IEFLKRGDKSVYYTSNPTIF 175 70
HLA-DRB1*10:01 VYYTSNPTTFHLDGEVI VYYTSNPTIFHLDGEVI 550 220
HLA-DRB1*15:02 RGDKSVYYTSNPTTFHL RGDKSVYYTSNPTIFHL 529 212
HLA-DRB1*15:02 DKSVYYTSNPTTFHL DKSVYYTSNPTIFHL 244 98
HLA-DQA1*01:03/DQB1*05:01 TSNPTTFHLDGEVITFDNL TSNPTIFHLDGEVITFDNL 1216 489
HLA-DQA1*01:02/DQB1*05:01 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 228 92
HLA-DQA1*01:02/DQB1*05:01 YTSNPTTFHLDGEVITFDNL YTSNPTIFHLDGEVITFDNL 270 109
HLA-DQA1*01:02/DQB1*05:01 TSNPTTFHLDGEVITFDNL TSNPTIFHLDGEVITFDNL 421 170
HLA-DRB1*15:02 KSVYYTSNPTTFHLD KSVYYTSNPTIFHLD 267 108
HLA-DPA1*03:01/DPB1*04:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 494 200
HLA-DPA1*03:01/DPB1*02:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 385 156
HLA-DRB1*15:02 KSVYYTSNPTTFHLDGE KSVYYTSNPTIFHLDGE 700 284
HLA-DPA1*03:01/DPB1*04:01 RGDKSVYYTSNPTTFHLDG RGDKSVYYTSNPTIFHLDG 820 333
HLA-DPA1*03:01/DPB1*04:01 KSVYYTSNPTTFHLDGE KSVYYTSNPTIFHLDGE 1055 429
HLA-DQA1*01:03/DQB1*05:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 913 372
HLA-DRB1*15:02 KRGDKSVYYTSNPTTF KRGDKSVYYTSNPTIF 854 348
HLA-DQA1*01:02/DQB1*05:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 206 84
HLA-DPA1*03:01/DPB1*02:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 380 155
HLA-DPA1*03:01/DPB1*02:01 DKSVYYTSNPTTFHL DKSVYYTSNPTIFHL 497 203
HLA-DPA1*03:01/DPB1*04:01 DKSVYYTSNPTTFHLD DKSVYYTSNPTIFHLD 850 348
HLA-DPA1*03:01/DPB1*04:01 KRGDKSVYYTSNPTTFHLD KRGDKSVYYTSNPTIFHLD 788 324
HLA-DRB1*15:02 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 298 123
HLA-DQA1*01:03/DQB1*05:01 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 821 339
HLA-DPA1*03:01/DPB1*04:01 GDKSVYYTSNPTTFHLDGE GDKSVYYTSNPTIFHLDGE 842 348
HLA-DPA1*03:01/DPB1*04:01 KSVYYTSNPTTFHLDG KSVYYTSNPTIFHLDG 902 374
HLA-DRB1*10:01 SNPTTFHLDGEVITFDNLKT SNPTIFHLDGEVITFDNLKT 534 222
HLA-DRB1*15:02 LKRGDKSVYYTSNPTTFHLD LKRGDKSVYYTSNPTIFHLD 291 121
HLA-DPA1*03:01/DPB1*04:01 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 1196 499
HLA-DRB1*15:02 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 309 129
HLA-DPA1*03:01/DPB1*02:01 RGDKSVYYTSNPTTF RGDKSVYYTSNPTIF 982 410
HLA-DPA1*03:01/DPB1*01:01 TSNPTTFHLDGEVIT TSNPTIFHLDGEVIT 1105 462
HLA-DRB1*07:01 KSVYYTSNPTTFHLDGEV KSVYYTSNPTIFHLDGEV 638 267
HLA-DQA1*01:02/DQB1*05:01 NPTTFHLDGEVITFDNL NPTIFHLDGEVITFDNL 511 214
HLA-DRB1*15:02 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 334 140
HLA-DRB1*10:01 TTFHLDGEVITFDNLK TIFHLDGEVITFDNLK 1128 473
HLA-DRB1*15:02 KRGDKSVYYTSNPTTFH KRGDKSVYYTSNPTIFH 739 310
HLA-DPA1*03:01/DPB1*02:01 KSVYYTSNPTTFHLD KSVYYTSNPTIFHLD 464 195
HLA-DRB1*15:02 RGDKSVYYTSNPTTF RGDKSVYYTSNPTIF 409 172
HLA-DPA1*03:01/DPB1*02:01 NPTTFHLDGEVITFDNL NPTIFHLDGEVITFDNL 841 354
HLA-DRB1*15:02 FLKRGDKSVYYTSNPTTFHL FLKRGDKSVYYTSNPTIFHL 285 120
HLA-DQA1*01:03/DQB1*05:01 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 686 289
HLA-DPA1*03:01/DPB1*02:01 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 823 347
HLA-DRB1*14:04 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 923 390
HLA-DPA1*03:01/DPB1*01:01 YTSNPTTFHLDGEVIT YTSNPTIFHLDGEVIT 1001 423
HLA-DQA1*01:02/DQB1*05:01 SNPTTFHLDGEVITFDNL SNPTIFHLDGEVITFDNL 797 337
HLA-DPA1*03:01/DPB1*01:01 VYYTSNPTTFHLDGEVI VYYTSNPTIFHLDGEVI 825 349
HLA-DPA1*03:01/DPB1*02:01 DKSVYYTSNPTTFHLDG DKSVYYTSNPTIFHLDG 722 306
HLA-DPA1*03:01/DPB1*04:01 RGDKSVYYTSNPTTFHL RGDKSVYYTSNPTIFHL 896 380
HLA-DQA1*01:02/DQB1*05:01 TTFHLDGEVITFDNL TIFHLDGEVITFDNL 462 196
HLA-DPA1*03:01/DPB1*04:01 DKSVYYTSNPTTFHL DKSVYYTSNPTIFHL 690 293
HLA-DRB1*15:02 FLKRGDKSVYYTSNPTTFH FLKRGDKSVYYTSNPTIFH 767 326
HLA-DPA1*03:01/DPB1*01:01 SVYYTSNPTTFHLDGEVI SVYYTSNPTIFHLDGEVI 1140 485
HLA-DPA1*03:01/DPB1*02:01 GDKSVYYTSNPTTFHL GDKSVYYTSNPTIFHL 571 243
HLA-DPA1*03:01/DPB1*04:01 DKSVYYTSNPTTFHLDGEV DKSVYYTSNPTIFHLDGEV 813 346
HLA-DPA1*03:01/DPB1*02:01 RGDKSVYYTSNPTTFHL RGDKSVYYTSNPTIFHL 686 292
HLA-DPA1*03:01/DPB1*02:01 GDKSVYYTSNPTTFHLDGE GDKSVYYTSNPTIFHLDGE 622 265
HLA-DPA1*03:01/DPB1*02:01 KSVYYTSNPTTFHLDGE KSVYYTSNPTIFHLDGE 753 321
HLA-DPA1*03:01/DPB1*02:01 RGDKSVYYTSNPTTFH RGDKSVYYTSNPTIFH 914 391
HLA-DPA1*03:01/DPB1*02:01 KSVYYTSNPTTFHLDG KSVYYTSNPTIFHLDG 612 262
HLA-DPA1*03:01/DPB1*02:01 GDKSVYYTSNPTTFHLD GDKSVYYTSNPTIFHLD 675 289
HLA-DRB1*07:01 RGDKSVYYTSNPTTF RGDKSVYYTSNPTIF 91 39
HLA-DRB1*10:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 245 105
HLA-DPA1*03:01/DPB1*04:01 GDKSVYYTSNPTTFHL GDKSVYYTSNPTIFHL 800 344
HLA-DRB1*10:01 YYTSNPTTFHLDGEV YYTSNPTIFHLDGEV 793 341
HLA-DPA1*03:01/DPB1*04:01 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 523 225
HLA-DPA1*03:01/DPB1*02:01 RGDKSVYYTSNPTTFHLDG RGDKSVYYTSNPTIFHLDG 595 256
HLA-DPA1*03:01/DPB1*04:01 LKRGDKSVYYTSNPTTFHLD LKRGDKSVYYTSNPTIFHLD 511 220
HLA-DPA1*03:01/DPB1*04:01 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 537 232
HLA-DRB1*07:01 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 199 86
HLA-DRB1*13:02 IEFLKRGDKSVYYTSNPTTF IEFLKRGDKSVYYTSNPTIF 317 137
HLA-DQA1*01:02/DQB1*05:01 TSNPTTFHLDGEVITFDNLK TSNPTIFHLDGEVITFDNLK 252 109
HLA-DPA1*03:01/DPB1*04:01 GDKSVYYTSNPTTFH GDKSVYYTSNPTIFH 1085 470
HLA-DPA1*03:01/DPB1*02:01 DKSVYYTSNPTTFHLDGEV DKSVYYTSNPTIFHLDGEV 602 261
HLA-DQA1*01:02/DQB1*05:01 PTTFHLDGEVITFDNL PTIFHLDGEVITFDNL 399 173
HLA-DQA1*01:03/DQB1*05:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 551 239
HLA-DRB1*14:04 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 851 370
HLA-DRB1*14:04 GDKSVYYTSNPTTFHLD GDKSVYYTSNPTIFHLD 1039 453
HLA-DRB1*14:04 RGDKSVYYTSNPTTFHLDG RGDKSVYYTSNPTIFHLDG 1126 491
HLA-DPA1*03:01/DPB1*02:01 KRGDKSVYYTSNPTTFHLD KRGDKSVYYTSNPTIFHLD 571 249
HLA-DPA1*03:01/DPB1*02:01 PTTFHLDGEVITFDNL PTIFHLDGEVITFDNL 761 332
HLA-DPA1*03:01/DPB1*04:01 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 527 230
HLA-DRB1*14:04 KSVYYTSNPTTFHLD KSVYYTSNPTIFHLD 577 252
HLA-DRB1*07:01 FLKRGDKSVYYTSNPTTFH FLKRGDKSVYYTSNPTIFH 206 90
HLA-DRB1*14:04 KRGDKSVYYTSNPTTFHLD KRGDKSVYYTSNPTIFHLD 1094 478
HLA-DPA1*03:01/DPB1*01:01 SNPTTFHLDGEVITF SNPTIFHLDGEVITF 755 330
HLA-DPA1*03:01/DPB1*01:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 311 136
HLA-DPA1*03:01/DPB1*02:01 SVYYTSNPTTFHLDGE SVYYTSNPTIFHLDGE 1026 449
HLA-DPA1*03:01/DPB1*04:01 LKRGDKSVYYTSNPTTFHL LKRGDKSVYYTSNPTIFHL 740 324
HLA-DQA1*01:03/DQB1*05:01 SNPTTFHLDGEVITFDNLK SNPTIFHLDGEVITFDNLK 1100 482
HLA-DQA1*01:02/DQB1*05:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 205 90
HLA-DRB1*14:04 DKSVYYTSNPTTFHLDG DKSVYYTSNPTIFHLDG 1100 484
HLA-DPA1*03:01/DPB1*02:01 DKSVYYTSNPTTFHLD DKSVYYTSNPTIFHLD 570 251
HLA-DRB1*07:01 KRGDKSVYYTSNPTTFHLD KRGDKSVYYTSNPTIFHLD 143 63
HLA-DRB1*14:04 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 988 436
HLA-DPA1*03:01/DPB1*01:01 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 441 195
HLA-DRB1*07:01 GDKSVYYTSNPTTFHLDGE GDKSVYYTSNPTIFHLDGE 156 69
HLA-DRB1*07:01 SVYYTSNPTTFHLDGE SVYYTSNPTIFHLDGE 305 135
HLA-DQA1*01:02/DQB1*05:01 PTTFHLDGEVITFDNLK PTIFHLDGEVITFDNLK 474 210
HLA-DQA1*01:02/DQB1*05:01 SNPTTFHLDGEVITFDNLK SNPTIFHLDGEVITFDNLK 379 168
HLA-DRB1*15:02 EFLKRGDKSVYYTSNPTTFH EFLKRGDKSVYYTSNPTIFH 381 169
HLA-DRB1*15:02 KRGDKSVYYTSNPTT KRGDKSVYYTSNPTI 1021 453
HLA-DRB1*07:01 DKSVYYTSNPTTFHLDGEV DKSVYYTSNPTIFHLDGEV 171 76
HLA-DRB1*14:04 DKSVYYTSNPTTFHLD DKSVYYTSNPTIFHLD 1086 483
HLA-DRB1*15:02 LKRGDKSVYYTSNPTTF LKRGDKSVYYTSNPTIF 896 399
HLA-DPA1*03:01/DPB1*01:01 TSNPTTFHLDGEVITF TSNPTIFHLDGEVITF 709 316
HLA-DPA1*03:01/DPB1*02:01 KRGDKSVYYTSNPTTFH KRGDKSVYYTSNPTIFH 1043 465
HLA-DRB1*07:01 LKRGDKSVYYTSNPTTFH LKRGDKSVYYTSNPTIFH 716 320
HLA-DRB1*14:04 LKRGDKSVYYTSNPTTFHL LKRGDKSVYYTSNPTIFHL 1001 448
HLA-DRB1*14:04 GDKSVYYTSNPTTFHL GDKSVYYTSNPTIFHL 975 437
HLA-DRB1*14:04 RGDKSVYYTSNPTTFHL RGDKSVYYTSNPTIFHL 936 420
HLA-DRB1*07:01 RGDKSVYYTSNPTTFHLDG RGDKSVYYTSNPTIFHLDG 147 66
HLA-DPA1*03:01/DPB1*01:01 YYTSNPTTFHLDGEVIT YYTSNPTIFHLDGEVIT 846 380
HLA-DPA1*03:01/DPB1*02:01 LKRGDKSVYYTSNPTTFHL LKRGDKSVYYTSNPTIFHL 567 256
HLA-DRB1*07:01 KRGDKSVYYTSNPTTFHL KRGDKSVYYTSNPTIFHL 429 194
HLA-DRB1*07:01 RGDKSVYYTSNPTTFHLD RGDKSVYYTSNPTIFHLD 497 225
HLA-DQA1*01:03/DQB1*05:01 YTSNPTTFHLDGEVITFDNL YTSNPTIFHLDGEVITFDNL 804 364
HLA-DRB1*14:04 RGDKSVYYTSNPTTF RGDKSVYYTSNPTIF 868 393
HLA-DRB1*11:02 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 952 432
HLA-DRB1*13:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 952 432
HLA-DRB1*07:01 EFLKRGDKSVYYTSNPTTFH EFLKRGDKSVYYTSNPTIFH 99 45
HLA-DQA1*01:02/DQB1*05:01 NPTTFHLDGEVITFDNLK NPTIFHLDGEVITFDNLK 763 347
HLA-DPA1*03:01/DPB1*02:01 KRGDKSVYYTSNPTTF KRGDKSVYYTSNPTIF 1087 496
HLA-DQA1*01:03/DQB1*05:01 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 679 310
HLA-DRB1*14:04 GDKSVYYTSNPTTFH GDKSVYYTSNPTIFH 683 312
HLA-DRB1*14:01 RGDKSVYYTSNPTTF RGDKSVYYTSNPTIF 963 440
HLA-DRB1*14:01 GDKSVYYTSNPTTFH GDKSVYYTSNPTIFH 676 309
HLA-DPA1*03:01/DPB1*04:01 EFLKRGDKSVYYTSNPTTFH EFLKRGDKSVYYTSNPTIFH 735 336
HLA-DPA1*03:01/DPB1*02:01 SNPTTFHLDGEVITFDNLK SNPTIFHLDGEVITFDNLK 612 280
HLA-DPA1*03:01/DPB1*01:01 YTSNPTTFHLDGEVITF YTSNPTIFHLDGEVITF 756 346
HLA-DPA1*03:01/DPB1*05:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 1024 470
HLA-DRB1*07:01 RGDKSVYYTSNPTTFH RGDKSVYYTSNPTIFH 161 74
HLA-DPA1*03:01/DPB1*02:01 TSNPTTFHLDGEVITFDNLK TSNPTIFHLDGEVITFDNLK 426 196
HLA-DRB1*07:01 GDKSVYYTSNPTTFHLDG GDKSVYYTSNPTIFHLDG 517 238
HLA-DRB1*14:01 KSVYYTSNPTTFHLD KSVYYTSNPTIFHLD 519 239
HLA-DRB1*07:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 436 201
HLA-DRB1*15:02 EFLKRGDKSVYYTSNPTTF EFLKRGDKSVYYTSNPTIF 988 456
HLA-DRB1*14:01 DKSVYYTSNPTTFHL DKSVYYTSNPTIFHL 457 211
HLA-DRB1*15:01 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 904 418
HLA-DRB1*14:04 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 786 364
HLA-DRB1*07:01 KSVYYTSNPTTFHLDG KSVYYTSNPTIFHLDG 136 63
HLA-DRB1*14:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 926 429
HLA-DRB1*15:03 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 958 444
HLA-DRB1*07:01 DKSVYYTSNPTTFHLDGE DKSVYYTSNPTIFHLDGE 565 262
HLA-DPA1*03:01/DPB1*01:01 SVYYTSNPTTFHLDGE SVYYTSNPTIFHLDGE 718 333
HLA-DPA1*03:01/DPB1*01:01 RGDKSVYYTSNPTTFHLDG RGDKSVYYTSNPTIFHLDG 519 241
HLA-DPA1*03:01/DPB1*01:01 GDKSVYYTSNPTTFHLDGE GDKSVYYTSNPTIFHLDGE 516 240
HLA-DRB1*14:04 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 763 355
HLA-DRB1*14:04 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 816 380
HLA-DRB1*10:01 NPTTFHLDGEVITFDNLKT NPTIFHLDGEVITFDNLKT 822 383
HLA-DRB1*14:04 DKSVYYTSNPTTFHL DKSVYYTSNPTIFHL 499 233
HLA-DPA1*03:01/DPB1*01:01 DKSVYYTSNPTTFHLDG DKSVYYTSNPTIFHLDG 581 272
HLA-DRB1*14:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 1012 474
HLA-DPA1*03:01/DPB1*01:01 KSVYYTSNPTTFHLDGE KSVYYTSNPTIFHLDGE 602 282
HLA-DPA1*02:02/DPB1*01:01 VYYTSNPTTFHLDGEVITFD VYYTSNPTIFHLDGEVITFD 713 334
HLA-DPA1*03:01/DPB1*01:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 510 239
HLA-DPA1*03:01/DPB1*02:01 LKRGDKSVYYTSNPTTFHLD LKRGDKSVYYTSNPTIFHLD 354 166
HLA-DRB1*07:01 LKRGDKSVYYTSNPTTFHL LKRGDKSVYYTSNPTIFHL 117 55
HLA-DPA1*03:01/DPB1*04:01 FLKRGDKSVYYTSNPTTFHL FLKRGDKSVYYTSNPTIFHL 487 229
HLA-DRB1*07:01 LKRGDKSVYYTSNPTTFHLD LKRGDKSVYYTSNPTIFHLD 68 32
HLA-DRB1*07:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 85 40
HLA-DPA1*03:01/DPB1*04:01 YTSNPTTFHLDGEVITFDNL YTSNPTIFHLDGEVITFDNL 612 288
HLA-DPA1*03:01/DPB1*02:01 SVYYTSNPTTFHLDGEV SVYYTSNPTIFHLDGEV 1041 490
HLA-DRB1*07:01 KRGDKSVYYTSNPTTFH KRGDKSVYYTSNPTIFH 172 81
HLA-DRB1*11:02 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 889 419
HLA-DRB1*13:01 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 889 419
HLA-DRB1*11:02 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 876 413
HLA-DRB1*13:01 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 876 413
HLA-DPA1*02:02/DPB1*01:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 1056 498
HLA-DPA1*03:01/DPB1*01:01 KRGDKSVYYTSNPTTFHLD KRGDKSVYYTSNPTIFHLD 511 241
HLA-DRB1*07:01 SVYYTSNPTTFHLDGEV SVYYTSNPTIFHLDGEV 337 159
HLA-DPA1*02:02/DPB1*01:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 625 295
HLA-DRB1*07:01 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 72 34
HLA-DPA1*03:01/DPB1*02:01 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 360 170
HLA-DPA1*03:01/DPB1*01:01 KSVYYTSNPTTFHLDG KSVYYTSNPTIFHLDG 504 238
HLA-DRB1*07:01 KSVYYTSNPTTFHLDGE KSVYYTSNPTIFHLDGE 148 70
HLA-DRB1*10:01 VYYTSNPTTFHLDGEV VYYTSNPTIFHLDGEV 537 254
HLA-DQA1*01:02/DQB1*05:01 TTFHLDGEVITFDNLK TIFHLDGEVITFDNLK 410 194
HLA-DPA1*03:01/DPB1*02:01 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 376 178
HLA-DPA1*03:01/DPB1*01:01 DKSVYYTSNPTTFHLDGEV DKSVYYTSNPTIFHLDGEV 489 232
HLA-DPA1*03:01/DPB1*02:01 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 372 177
HLA-DPA1*03:01/DPB1*01:01 GDKSVYYTSNPTTFHLD GDKSVYYTSNPTIFHLD 552 263
HLA-DPA1*03:01/DPB1*01:01 RGDKSVYYTSNPTTFHL RGDKSVYYTSNPTIFHL 577 275
HLA-DQA1*01:03/DQB1*05:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 436 208
HLA-DPA1*03:01/DPB1*02:01 FLKRGDKSVYYTSNPTTFH FLKRGDKSVYYTSNPTIFH 853 407
HLA-DPA1*03:01/DPB1*01:01 SVYYTSNPTTFHLDGEV SVYYTSNPTIFHLDGEV 758 362
HLA-DRB1*11:02 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 912 436
HLA-DRB1*13:01 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 912 436
HLA-DRB1*07:01 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 69 33
HLA-DRB1*14:01 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 930 445
HLA-DPA1*02:02/DPB1*01:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 522 250
HLA-DPA1*03:01/DPB1*01:01 LKRGDKSVYYTSNPTTFHLD LKRGDKSVYYTSNPTIFHLD 359 172
HLA-DRB1*07:01 DKSVYYTSNPTTFHLD DKSVYYTSNPTIFHLD 125 60
HLA-DRB1*14:04 LKRGDKSVYYTSNPTTFHLD LKRGDKSVYYTSNPTIFHLD 729 350
HLA-DRB1*01:01 YYTSNPTTFHLDGEV YYTSNPTIFHLDGEV 662 318
HLA-DRB1*07:01 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 77 37
HLA-DRB1*07:01 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 106 51
HLA-DPA1*03:01/DPB1*01:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 288 139
HLA-DPA1*03:01/DPB1*01:01 GDKSVYYTSNPTTFHLDG GDKSVYYTSNPTIFHLDG 985 476
HLA-DPA1*03:01/DPB1*01:01 KSVYYTSNPTTFHLDGEV KSVYYTSNPTIFHLDGEV 931 450
HLA-DPA1*03:01/DPB1*04:01 TSNPTTFHLDGEVITFDNL TSNPTIFHLDGEVITFDNL 819 396
HLA-DPA1*03:01/DPB1*01:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 326 158
HLA-DPA1*03:01/DPB1*04:01 IEFLKRGDKSVYYTSNPTTF IEFLKRGDKSVYYTSNPTIF 957 464
HLA-DPA1*03:01/DPB1*01:01 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 365 177
HLA-DPA1*02:02/DPB1*01:01 KSVYYTSNPTTFHLDGEVI KSVYYTSNPTIFHLDGEVI 793 385
HLA-DRB1*15:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 457 222
HLA-DRB1*14:01 RGDKSVYYTSNPTTFHL RGDKSVYYTSNPTIFHL 934 454
HLA-DRB1*11:02 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 956 465
HLA-DRB1*13:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 956 465
HLA-DPA1*03:01/DPB1*01:01 DKSVYYTSNPTTFHLDGE DKSVYYTSNPTIFHLDGE 980 479
HLA-DPA1*03:01/DPB1*04:01 PTTFHLDGEVITFDNL PTIFHLDGEVITFDNL 807 395
HLA-DRB1*14:01 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 819 401
HLA-DQA1*01:03/DQB1*05:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 461 226
HLA-DPA1*03:01/DPB1*01:01 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 693 340
HLA-DRB1*14:01 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 862 423
HLA-DRB1*10:01 NPTTFHLDGEVITFDNLKTL NPTIFHLDGEVITFDNLKTL 432 212
HLA-DPA1*03:01/DPB1*01:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 487 239
HLA-DPA1*03:01/DPB1*01:01 KRGDKSVYYTSNPTTFH KRGDKSVYYTSNPTIFH 806 396
HLA-DPA1*03:01/DPB1*01:01 GDKSVYYTSNPTTFHLDGEV GDKSVYYTSNPTIFHLDGEV 346 170
HLA-DPA1*03:01/DPB1*01:01 DKSVYYTSNPTTFHLD DKSVYYTSNPTIFHLD 464 228
HLA-DRB1*14:01 KRGDKSVYYTSNPTTFHLDG KRGDKSVYYTSNPTIFHLDG 785 386
HLA-DPA1*03:01/DPB1*01:01 RGDKSVYYTSNPTTFHLDGE RGDKSVYYTSNPTIFHLDGE 370 182
HLA-DRB1*14:01 LKRGDKSVYYTSNPTTFHLD LKRGDKSVYYTSNPTIFHLD 739 364
HLA-DQA1*01:03/DQB1*05:01 KSVYYTSNPTTFHLDG KSVYYTSNPTIFHLDG 730 360
HLA-DPA1*02:02/DPB1*01:01 SVYYTSNPTTFHLDGEVIT SVYYTSNPTIFHLDGEVIT 1005 496
HLA-DPA1*03:01/DPB1*01:01 RGDKSVYYTSNPTTFHLD RGDKSVYYTSNPTIFHLD 955 472
HLA-DQA1*01:02/DQB1*05:01 VYYTSNPTTFHLDGEV VYYTSNPTIFHLDGEV 886 438
HLA-DRB1*14:01 GDKSVYYTSNPTTFHL GDKSVYYTSNPTIFHL 993 491
HLA-DRB1*15:02 IEFLKRGDKSVYYTSNPTTF IEFLKRGDKSVYYTSNPTIF 469 232
HLA-DPA1*02:02/DPB1*01:01 KSVYYTSNPTTFHLDGEVIT KSVYYTSNPTIFHLDGEVIT 489 242
HLA-DPA1*02:02/DPB1*01:01 YYTSNPTTFHLDGEVITFDN YYTSNPTIFHLDGEVITFDN 794 393
HLA-DQA1*01:03/DQB1*05:01 TSNPTTFHLDGEVITFDNLK TSNPTIFHLDGEVITFDNLK 754 374
HLA-DRB1*07:01 VYYTSNPTTFHLDGEVI VYYTSNPTIFHLDGEVI 672 334
HLA-DPA1*03:01/DPB1*02:01 EFLKRGDKSVYYTSNPTTFH EFLKRGDKSVYYTSNPTIFH 523 260
HLA-DRB1*07:01 VYYTSNPTTFHLDGEVITF VYYTSNPTIFHLDGEVITF 806 401
HLA-DRB1*04:01 VYYTSNPTTFHLDGEV VYYTSNPTIFHLDGEV 426 212
HLA-DRB1*07:01 SVYYTSNPTTFHLDGEVITF SVYYTSNPTIFHLDGEVITF 229 114
HLA-DPA1*03:01/DPB1*01:01 LKRGDKSVYYTSNPTTFHL LKRGDKSVYYTSNPTIFHL 492 245
HLA-DRB1*14:04 FLKRGDKSVYYTSNPTTFHL FLKRGDKSVYYTSNPTIFHL 656 327
HLA-DRB1*15:01 DKSVYYTSNPTTFHLD DKSVYYTSNPTIFHLD 443 221
HLA-DRB1*07:01 GDKSVYYTSNPTTFH GDKSVYYTSNPTIFH 64 32
HLA-DRB1*07:01 GDKSVYYTSNPTTFHL GDKSVYYTSNPTIFHL 96 48
HLA-DRB1*07:01 GDKSVYYTSNPTTFHLD GDKSVYYTSNPTIFHLD 128 64
HLA-DPA1*01:03/DPB1*01:01 DKSVYYTSNPTTFHLDGEVI DKSVYYTSNPTIFHLDGEVI 698 349
HLA-DQA1*01:02/DQB1*05:01 SVYYTSNPTTFHLDGEV SVYYTSNPTIFHLDGEV 714 357
HLA-DRB1*11:02 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 886 443
HLA-DRB1*13:01 SVYYTSNPTTFHLDG SVYYTSNPTIFHLDG 886 443

P1469S

Reference  YCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITIS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    YCTGYREGYLNSTNVTIATYCTGSISCSVCLSGLDSLDTYPSLETIQITIS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*07:01 ATYCTGSIPCSVCLS ATYCTGSISCSVCLS 932 368

F1569V

Reference  SWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMC
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SWLMWLIINLVQMAPISAMVRMYIFVASFYYVWKSYVHVVDGCNSSTCMMC

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*01:03/DPB1*14:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 1759 418
HLA-DPA1*01:03/DPB1*14:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 1522 368
HLA-DPA1*01:03/DPB1*03:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 1402 359
HLA-DPA1*01:03/DPB1*14:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 1533 411
HLA-DPA1*01:03/DPB1*03:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 1447 389
HLA-DPA1*01:03/DPB1*03:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 1550 423
HLA-DPA1*04:01/DPB1*14:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 986 283
HLA-DPA1*01:03/DPB1*03:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 1578 465
HLA-DPA1*01:03/DPB1*03:01 SAMVRMYIFFASFYYV SAMVRMYIFVASFYYV 1581 472
HLA-DPA1*04:01/DPB1*14:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 855 258
HLA-DPA1*01:03/DPB1*03:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 1368 428
HLA-DPA1*01:03/DPB1*03:01 ISAMVRMYIFFASFYYV ISAMVRMYIFVASFYYV 1415 444
HLA-DPA1*04:01/DPB1*14:01 MVRMYIFFASFYYVW MVRMYIFVASFYYVW 1056 333
HLA-DPA1*03:01/DPB1*03:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 1401 445
HLA-DPA1*03:01/DPB1*03:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 1425 453
HLA-DPA1*04:01/DPB1*03:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 672 215
HLA-DPA1*01:03/DPB1*03:01 PISAMVRMYIFFASFY PISAMVRMYIFVASFY 1529 498
HLA-DPA1*04:01/DPB1*14:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 832 271
HLA-DPA1*01:03/DPB1*03:01 SAMVRMYIFFASFYYVW SAMVRMYIFVASFYYVW 1383 451
HLA-DPA1*04:01/DPB1*03:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 691 230
HLA-DPA1*04:01/DPB1*14:01 AMVRMYIFFASFYYVW AMVRMYIFVASFYYVW 1037 348
HLA-DPA1*04:01/DPB1*03:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 766 260
HLA-DPA1*04:01/DPB1*14:01 SAMVRMYIFFASFYYV SAMVRMYIFVASFYYV 985 337
HLA-DPA1*01:03/DPB1*14:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 1437 495
HLA-DPA1*04:01/DPB1*14:01 ISAMVRMYIFFASFYYV ISAMVRMYIFVASFYYV 881 308
HLA-DPA1*03:01/DPB1*03:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 1280 449
HLA-DPA1*04:01/DPB1*14:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 949 335
HLA-DPA1*04:01/DPB1*03:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 762 270
HLA-DPA1*01:03/DPB1*26:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 884 315
HLA-DPA1*03:01/DPB1*03:01 PISAMVRMYIFFASFY PISAMVRMYIFVASFY 1369 489
HLA-DPA1*04:01/DPB1*03:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 644 232
HLA-DPA1*01:03/DPB1*26:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 877 316
HLA-DPA1*04:01/DPB1*03:01 ISAMVRMYIFFASFYYV ISAMVRMYIFVASFYYV 727 263
HLA-DPA1*01:03/DPB1*03:01 APISAMVRMYIFFASFY APISAMVRMYIFVASFY 1257 455
HLA-DPA1*01:03/DPB1*26:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 1003 364
HLA-DPA1*03:01/DPB1*03:01 APISAMVRMYIFFASFY APISAMVRMYIFVASFY 1167 424
HLA-DPA1*04:01/DPB1*03:01 AMVRMYIFFASFYYVW AMVRMYIFVASFYYVW 904 329
HLA-DPA1*04:01/DPB1*14:01 SAMVRMYIFFASFYYVW SAMVRMYIFVASFYYVW 820 300
HLA-DPA1*04:01/DPB1*14:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 785 288
HLA-DPA1*03:01/DPB1*03:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 1256 461
HLA-DPA1*04:01/DPB1*03:01 MVRMYIFFASFYYVW MVRMYIFVASFYYVW 881 324
HLA-DPA1*01:03/DPB1*26:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 945 353
HLA-DPA1*04:01/DPB1*03:01 SAMVRMYIFFASFYYVW SAMVRMYIFVASFYYVW 687 258
HLA-DPA1*01:03/DPB1*03:01 AMVRMYIFFASFYYVWK AMVRMYIFVASFYYVWK 1304 490
HLA-DPA1*03:01/DPB1*14:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 1244 468
HLA-DPA1*04:01/DPB1*03:01 PISAMVRMYIFFASFY PISAMVRMYIFVASFY 671 253
HLA-DPA1*04:01/DPB1*03:01 SAMVRMYIFFASFYYV SAMVRMYIFVASFYYV 759 288
HLA-DPA1*03:01/DPB1*14:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 1183 450
HLA-DPA1*01:03/DPB1*26:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 940 364
HLA-DPA1*01:03/DPB1*26:01 PISAMVRMYIFFASFY PISAMVRMYIFVASFY 958 373
HLA-DPA1*04:01/DPB1*03:01 PISAMVRMYIFFASFYYVWK PISAMVRMYIFVASFYYVWK 968 377
HLA-DPA1*01:03/DPB1*26:01 SAMVRMYIFFASFYYV SAMVRMYIFVASFYYV 996 388
HLA-DPA1*04:01/DPB1*03:01 AMVRMYIFFASFYYVWK AMVRMYIFVASFYYVWK 715 279
HLA-DPA1*04:01/DPB1*14:01 AMVRMYIFFASFYYVWK AMVRMYIFVASFYYVWK 824 323
HLA-DPA1*04:01/DPB1*03:01 APISAMVRMYIFFASFYYVW APISAMVRMYIFVASFYYVW 903 354
HLA-DPA1*04:01/DPB1*03:01 PISAMVRMYIFFASFYYVW PISAMVRMYIFVASFYYVW 1112 438
HLA-DPA1*01:03/DPB1*26:01 ISAMVRMYIFFASFYYV ISAMVRMYIFVASFYYV 961 380
HLA-DPA1*04:01/DPB1*03:01 ISAMVRMYIFFASFYYVWKS ISAMVRMYIFVASFYYVWKS 974 390
HLA-DPA1*04:01/DPB1*14:01 ISAMVRMYIFFASFYYVWKS ISAMVRMYIFVASFYYVWKS 1018 408
HLA-DPA1*01:03/DPB1*26:01 APISAMVRMYIFFASFY APISAMVRMYIFVASFY 933 374
HLA-DPA1*04:01/DPB1*03:01 SAMVRMYIFFASFYYVWKSY SAMVRMYIFVASFYYVWKSY 1006 405
HLA-DRB1*07:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 844 341
HLA-DPA1*04:01/DPB1*03:01 APISAMVRMYIFFASFY APISAMVRMYIFVASFY 590 239
HLA-DPA1*04:01/DPB1*14:01 SAMVRMYIFFASFYYVWKSY SAMVRMYIFVASFYYVWKSY 1044 423
HLA-DPA1*03:01/DPB1*14:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 1184 480
HLA-DPA1*04:01/DPB1*14:01 PISAMVRMYIFFASFYYVWK PISAMVRMYIFVASFYYVWK 937 381
HLA-DPA1*04:01/DPB1*14:01 PISAMVRMYIFFASFY PISAMVRMYIFVASFY 814 334
HLA-DPA1*04:01/DPB1*14:01 PISAMVRMYIFFASFYYVW PISAMVRMYIFVASFYYVW 1154 474
HLA-DPA1*04:01/DPB1*03:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 657 270
HLA-DPA1*04:01/DPB1*14:01 APISAMVRMYIFFASFYYVW APISAMVRMYIFVASFYYVW 873 359
HLA-DPA1*01:03/DPB1*26:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 890 368
HLA-DPA1*01:03/DPB1*02:01 SAMVRMYIFFASFYYV SAMVRMYIFVASFYYV 207 500
HLA-DPA1*04:01/DPB1*26:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 511 212
HLA-DPA1*04:01/DPB1*14:01 ISAMVRMYIFFASFYYVWK ISAMVRMYIFVASFYYVWK 1181 490
HLA-DPA1*04:01/DPB1*26:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 525 219
HLA-DPA1*04:01/DPB1*03:01 ISAMVRMYIFFASFYYVWK ISAMVRMYIFVASFYYVWK 1098 459
HLA-DPA1*04:01/DPB1*26:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 513 215
HLA-DRB1*07:01 ISAMVRMYIFFASFYYVWKS ISAMVRMYIFVASFYYVWKS 1185 497
HLA-DPA1*04:01/DPB1*14:01 VRMYIFFASFYYVWK VRMYIFVASFYYVWK 913 383
HLA-DPA1*04:01/DPB1*03:01 AMVRMYIFFASFYYVWKSYV AMVRMYIFVASFYYVWKSYV 1101 462
HLA-DRB1*07:01 AMVRMYIFFASFYYVWK AMVRMYIFVASFYYVWK 868 365
HLA-DPA1*04:01/DPB1*14:01 MVRMYIFFASFYYVWK MVRMYIFVASFYYVWK 958 404
HLA-DPA1*04:01/DPB1*03:01 APISAMVRMYIFFASFYYV APISAMVRMYIFVASFYYV 986 421
HLA-DPA1*04:01/DPB1*14:01 APISAMVRMYIFFASFY APISAMVRMYIFVASFY 683 292
HLA-DPA1*04:01/DPB1*14:01 SAMVRMYIFFASFYYVWKS SAMVRMYIFVASFYYVWKS 1167 499
HLA-DPA1*03:01/DPB1*14:01 APISAMVRMYIFFASFY APISAMVRMYIFVASFY 1095 472
HLA-DPA1*01:03/DPB1*26:01 MVRMYIFFASFYYVW MVRMYIFVASFYYVW 970 419
HLA-DPA1*04:01/DPB1*03:01 MVRMYIFFASFYYVWK MVRMYIFVASFYYVWK 874 378
HLA-DPA1*04:01/DPB1*03:01 MVRMYIFFASFYYVWKS MVRMYIFVASFYYVWKS 792 345
HLA-DPA1*04:01/DPB1*26:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 573 250
HLA-DPA1*04:01/DPB1*03:01 SAMVRMYIFFASFYYVWKS SAMVRMYIFVASFYYVWKS 1058 462
HLA-DPA1*03:01/DPB1*03:01 MAPISAMVRMYIFFASF MAPISAMVRMYIFVASF 1045 457
HLA-DPA1*04:01/DPB1*14:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 742 325
HLA-DPA1*04:01/DPB1*03:01 MAPISAMVRMYIFFASFYYV MAPISAMVRMYIFVASFYYV 728 319
HLA-DPA1*01:03/DPB1*26:01 AMVRMYIFFASFYYVW AMVRMYIFVASFYYVW 951 417
HLA-DPA1*04:01/DPB1*14:01 AMVRMYIFFASFYYVWKSYV AMVRMYIFVASFYYVWKSYV 1076 473
HLA-DPA1*04:01/DPB1*14:01 MVRMYIFFASFYYVWKS MVRMYIFVASFYYVWKS 877 386
HLA-DRB1*07:01 MVRMYIFFASFYYVWKS MVRMYIFVASFYYVWKS 840 370
HLA-DRB1*07:01 VRMYIFFASFYYVWK VRMYIFVASFYYVWK 463 204
HLA-DPA1*04:01/DPB1*14:01 MAPISAMVRMYIFFASFYYV MAPISAMVRMYIFVASFYYV 733 323
HLA-DPA1*04:01/DPB1*14:01 APISAMVRMYIFFASFYYV APISAMVRMYIFVASFYYV 1058 468
HLA-DPA1*04:01/DPB1*26:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 559 248
HLA-DPA1*03:01/DPB1*14:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 1118 496
HLA-DPA1*04:01/DPB1*03:01 APISAMVRMYIFFASF APISAMVRMYIFVASF 659 293
HLA-DPA1*01:03/DPB1*26:01 SAMVRMYIFFASFYYVW SAMVRMYIFVASFYYVW 849 379
HLA-DPA1*04:01/DPB1*26:01 ISAMVRMYIFFASFYYV ISAMVRMYIFVASFYYV 513 230
HLA-DPA1*01:03/DPB1*02:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 147 326
HLA-DPA1*01:03/DPB1*02:01 PISAMVRMYIFFASFYYV PISAMVRMYIFVASFYYV 351 778
HLA-DPA1*01:03/DPB1*11:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 263 119
HLA-DPA1*04:01/DPB1*03:01 MAPISAMVRMYIFFASFYY MAPISAMVRMYIFVASFYY 830 376
HLA-DPA1*01:03/DPB1*04:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 269 588
HLA-DRB1*07:01 MVRMYIFFASFYYVW MVRMYIFVASFYYVW 699 320
HLA-DPA1*01:03/DPB1*04:01 PISAMVRMYIFFASFYYV PISAMVRMYIFVASFYYV 478 1043
HLA-DPA1*04:01/DPB1*26:01 SAMVRMYIFFASFYYV SAMVRMYIFVASFYYV 576 264
HLA-DPA1*01:03/DPB1*11:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 294 135
HLA-DRB1*07:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 779 358
HLA-DRB1*07:01 VRMYIFFASFYYVWKSY VRMYIFVASFYYVWKSY 857 395
HLA-DPA1*01:03/DPB1*02:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 319 692
HLA-DPA1*01:03/DPB1*04:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 263 569
HLA-DPA1*04:01/DPB1*26:01 PISAMVRMYIFFASFY PISAMVRMYIFVASFY 543 251
HLA-DPA1*01:03/DPB1*11:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 335 155
HLA-DPA1*01:03/DPB1*04:01 AMVRMYIFFASFYYV AMVRMYIFVASFYYV 180 389
HLA-DPA1*01:03/DPB1*10:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 1039 481
HLA-DPA1*01:03/DPB1*02:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 216 466
HLA-DPA1*01:03/DPB1*04:01 PISAMVRMYIFFASFY PISAMVRMYIFVASFY 369 793
HLA-DPA1*01:03/DPB1*02:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 221 474
HLA-DPA1*01:03/DPB1*26:01 APISAMVRMYIFFASF APISAMVRMYIFVASF 996 465
HLA-DPA1*03:01/DPB1*26:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 873 408
HLA-DPA1*01:03/DPB1*11:01 MVRMYIFFASFYYVW MVRMYIFVASFYYVW 323 151
HLA-DPA1*04:01/DPB1*26:01 APISAMVRMYIFFASFY APISAMVRMYIFVASFY 483 226
HLA-DPA1*01:03/DPB1*04:01 APISAMVRMYIFFASF APISAMVRMYIFVASF 366 780
HLA-DPA1*04:01/DPB1*03:01 VRMYIFFASFYYVWK VRMYIFVASFYYVWK 816 383
HLA-DPA1*01:03/DPB1*04:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 386 821
HLA-DRB1*07:01 MVRMYIFFASFYYVWK MVRMYIFVASFYYVWK 1029 485
HLA-DPA1*04:01/DPB1*26:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 507 239
HLA-DPA1*04:01/DPB1*10:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 526 249
HLA-DPA1*03:01/DPB1*26:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 840 400
HLA-DPA1*04:01/DPB1*26:01 SAMVRMYIFFASFYYVW SAMVRMYIFVASFYYVW 477 228
HLA-DPA1*04:01/DPB1*09:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 637 305
HLA-DPA1*01:03/DPB1*04:01 SAMVRMYIFFASFYYV SAMVRMYIFVASFYYV 264 551
HLA-DPA1*04:01/DPB1*11:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 229 110
HLA-DPA1*01:03/DPB1*02:01 ISAMVRMYIFFASFYYV ISAMVRMYIFVASFYYV 203 419
HLA-DPA1*04:01/DPB1*10:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 531 258
HLA-DPA1*01:03/DPB1*11:01 SAMVRMYIFFASFYYV SAMVRMYIFVASFYYV 333 163
HLA-DPA1*03:01/DPB1*14:01 MAPISAMVRMYIFFASF MAPISAMVRMYIFVASF 988 484
HLA-DPA1*04:01/DPB1*09:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 541 266
HLA-DPA1*04:01/DPB1*85:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 378 186
HLA-DPA1*01:03/DPB1*11:01 ISAMVRMYIFFASFY ISAMVRMYIFVASFY 258 127
HLA-DPA1*04:01/DPB1*85:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 388 191
HLA-DPA1*04:01/DPB1*14:01 VRMYIFFASFYYVWKSY VRMYIFVASFYYVWKSY 981 483
HLA-DPA1*04:01/DPB1*11:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 219 108
HLA-DPA1*04:01/DPB1*26:01 AMVRMYIFFASFYYVW AMVRMYIFVASFYYVW 571 282
HLA-DPA1*01:03/DPB1*11:01 AMVRMYIFFASFYYVW AMVRMYIFVASFYYVW 342 169
HLA-DPA1*04:01/DPB1*85:01 ISAMVRMYIFFASFYY ISAMVRMYIFVASFYY 431 213
HLA-DPA1*01:03/DPB1*26:01 MAPISAMVRMYIFFASF MAPISAMVRMYIFVASF 961 475
HLA-DPA1*04:01/DPB1*14:01 MAPISAMVRMYIFFASFYY MAPISAMVRMYIFVASFYY 869 430
HLA-DPA1*04:01/DPB1*85:01 ISAMVRMYIFFASFYYV ISAMVRMYIFVASFYYV 392 194
HLA-DPA1*01:03/DPB1*11:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 319 158
HLA-DPA1*01:03/DPB1*04:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 272 549
HLA-DPA1*01:03/DPB1*11:01 APISAMVRMYIFFASFYY APISAMVRMYIFVASFYY 771 382
HLA-DPA1*01:03/DPB1*11:01 ISAMVRMYIFFASFYYV ISAMVRMYIFVASFYYV 335 166
HLA-DPA1*04:01/DPB1*03:01 VRMYIFFASFYYVWKSY VRMYIFVASFYYVWKSY 916 454
HLA-DRB1*01:01 AMVRMYIFFASFYYVWK AMVRMYIFVASFYYVWK 617 306
HLA-DRB1*07:01 VRMYIFFASFYYVWKS VRMYIFVASFYYVWKS 980 487
HLA-DPA1*04:01/DPB1*04:01 PISAMVRMYIFFASF PISAMVRMYIFVASF 164 330
HLA-DRB1*10:01 SAMVRMYIFFASFYYVW SAMVRMYIFVASFYYVW 372 185
HLA-DPA1*04:01/DPB1*26:01 APISAMVRMYIFFASFYY APISAMVRMYIFVASFYY 987 491
HLA-DPA1*04:01/DPB1*11:01 AMVRMYIFFASFYYVW AMVRMYIFVASFYYVW 251 125
HLA-DPA1*01:03/DPB1*09:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 939 468
HLA-DPA1*01:03/DPB1*11:01 PISAMVRMYIFFASFY PISAMVRMYIFVASFY 331 165
HLA-DPA1*04:01/DPB1*03:01 VRMYIFFASFYYVWKS VRMYIFVASFYYVWKS 976 487
HLA-DRB1*07:01 RMYIFFASFYYVWKS RMYIFVASFYYVWKS 430 215
HLA-DPA1*01:03/DPB1*02:01 PISAMVRMYIFFASFYY PISAMVRMYIFVASFYY 281 562
HLA-DPA1*01:03/DPB1*11:01 PISAMVRMYIFFASFYYVW PISAMVRMYIFVASFYYVW 580 290
HLA-DRB1*04:04 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 636 318
HLA-DPA1*03:01/DPB1*09:01 SAMVRMYIFFASFYY SAMVRMYIFVASFYY 702 351

NSP4 protein

NSP4

L438P

Reference  EEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSY
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    EEAALCTFLLNKEMYLKLRSDVLLPPTQYNRYLALYNKYKYFSGAMDTTSY

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*01:03/DPB1*04:01 LKLRSDVLLPLTQYN LKLRSDVLLPPTQYN 57 780
HLA-DPA1*01:03/DPB1*04:01 KLRSDVLLPLTQYNR KLRSDVLLPPTQYNR 110 1487
HLA-DRB1*11:04 SDVLLPLTQYNRYLA SDVLLPPTQYNRYLA 141 1796
HLA-DPA1*01:03/DPB1*04:01 LKLRSDVLLPLTQYNR LKLRSDVLLPPTQYNR 73 927
HLA-DPA1*03:01/DPB1*04:01 KLRSDVLLPLTQYNRYLA KLRSDVLLPPTQYNRYLA 66 823
HLA-DPA1*01:03/DPB1*04:01 KLRSDVLLPLTQYNRY KLRSDVLLPPTQYNRY 136 1624
HLA-DPA1*01:03/DPB1*04:01 LKLRSDVLLPLTQYNRY LKLRSDVLLPPTQYNRY 85 1008
HLA-DPA1*01:03/DPB1*04:01 MYLKLRSDVLLPLTQ MYLKLRSDVLLPPTQ 35 407
HLA-DRB1*11:02 SDVLLPLTQYNRYLA SDVLLPPTQYNRYLA 106 1220
HLA-DRB1*13:01 SDVLLPLTQYNRYLA SDVLLPPTQYNRYLA 106 1220
HLA-DPA1*01:03/DPB1*04:01 YLKLRSDVLLPLTQY YLKLRSDVLLPPTQY 32 366
HLA-DPA1*01:03/DPB1*04:01 YLKLRSDVLLPLTQYN YLKLRSDVLLPPTQYN 40 455
HLA-DPA1*03:01/DPB1*04:01 KLRSDVLLPLTQYNR KLRSDVLLPPTQYNR 30 339
HLA-DPA1*01:03/DPB1*04:01 KLRSDVLLPLTQYNRYL KLRSDVLLPPTQYNRYL 156 1711
HLA-DPA1*03:01/DPB1*04:01 LKLRSDVLLPLTQYNRYL LKLRSDVLLPPTQYNRYL 41 446
HLA-DPA1*01:03/DPB1*04:01 YLKLRSDVLLPLTQYNR YLKLRSDVLLPPTQYNR 47 511
HLA-DPA1*01:03/DPB1*04:01 YLKLRSDVLLPLTQYNRY YLKLRSDVLLPPTQYNRY 99 1073
HLA-DPA1*03:01/DPB1*04:01 LRSDVLLPLTQYNRY LRSDVLLPPTQYNRY 95 1023
HLA-DPA1*01:03/DPB1*04:01 MYLKLRSDVLLPLTQYNR MYLKLRSDVLLPPTQYNR 88 946
HLA-DPA1*01:03/DPB1*04:01 EMYLKLRSDVLLPLTQ EMYLKLRSDVLLPPTQ 42 447
HLA-DRB1*11:04 DVLLPLTQYNRYLAL DVLLPPTQYNRYLAL 119 1265
HLA-DPA1*01:03/DPB1*04:01 LKLRSDVLLPLTQYNRYL LKLRSDVLLPPTQYNRYL 192 2036
HLA-DPA1*01:03/DPB1*04:01 MYLKLRSDVLLPLTQY MYLKLRSDVLLPPTQY 36 377
HLA-DPA1*01:03/DPB1*04:01 EMYLKLRSDVLLPLTQYN EMYLKLRSDVLLPPTQYN 83 863
HLA-DPA1*03:01/DPB1*04:01 KLRSDVLLPLTQYNRY KLRSDVLLPPTQYNRY 35 359
HLA-DPA1*01:03/DPB1*04:01 LKLRSDVLLPLTQYNRYLA LKLRSDVLLPPTQYNRYLA 111 1135
HLA-DPA1*01:03/DPB1*04:01 EMYLKLRSDVLLPLT EMYLKLRSDVLLPPT 40 409
HLA-DPA1*03:01/DPB1*04:01 KLRSDVLLPLTQYNRYL KLRSDVLLPPTQYNRYL 39 398
HLA-DPA1*01:03/DPB1*04:01 MYLKLRSDVLLPLTQYN MYLKLRSDVLLPPTQYN 42