Summary

This strain contains 18 protein-level mutations:

  • 5 mutations in Spike protein: L452R, T478K, D614G, P681R, D950N
  • 3 mutations in N protein: D63G, R203M, G215C
  • 1 mutation in M protein: I82T
  • 1 mutation in NS3 protein: S26L
  • 2 mutations in NS7a protein: V82A, T120I
  • 1 mutation in NS9b protein: T60A
  • 1 mutation in NS9c protein: G50W
  • 2 mutations in NSP3 protein: A488S, P1469S
  • 1 mutation in NSP12 protein: P323L
  • 1 mutation in NSP14 protein: 413-415 GCD->LNY

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

L452R

Reference  DDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    DDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRL LDSKVGGNYNYRYRL 424 3666
HLA-DPA1*03:01/DPB1*02:01 WNSNNLDSKVGGNYNYLYRL WNSNNLDSKVGGNYNYRYRL 415 2864
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 144 966
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 249 1634
HLA-DPA1*03:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 113 734
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 392 2542
HLA-DPA1*03:01/DPB1*04:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 305 1960
HLA-DPA1*03:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 218 1391
HLA-DPA1*03:01/DPB1*04:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 256 1631
HLA-DPA1*03:01/DPB1*04:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 345 2181
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 173 1093
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 359 2266
HLA-DPA1*03:01/DPB1*04:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 401 2531
HLA-DPA1*03:01/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 172 1064
HLA-DPA1*03:01/DPB1*02:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 196 1212
HLA-DPA1*03:01/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 144 883
HLA-DPA1*03:01/DPB1*04:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 441 2693
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 218 1325
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLF DSKVGGNYNYRYRLF 261 1555
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLF NLDSKVGGNYNYRYRLF 361 2150
HLA-DPA1*03:01/DPB1*04:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 305 1801
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 309 1809
HLA-DPA1*03:01/DPB1*04:02 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 444 2598
HLA-DPA1*03:01/DPB1*105:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 444 2598
HLA-DPA1*03:01/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 143 835
HLA-DPA1*03:01/DPB1*02:01 SNNLDSKVGGNYNYLYRLF SNNLDSKVGGNYNYRYRLF 324 1887
HLA-DPA1*03:01/DPB1*02:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 252 1455
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 351 2010
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLF LDSKVGGNYNYRYRLF 295 1679
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLFR NLDSKVGGNYNYRYRLFR 455 2516
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLFRK LDSKVGGNYNYRYRLFRK 304 1659
HLA-DPA1*03:01/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 244 1247
HLA-DPA1*01:03/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 439 2221
HLA-DPA1*01:03/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 317 1603
HLA-DPA1*03:01/DPB1*01:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 342 1688
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 424 2025
HLA-DPA1*03:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 322 1525
HLA-DPA1*01:03/DPB1*02:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 457 2136
HLA-DPA1*04:01/DPB1*02:01 DSKVGGNYNYLYRLF DSKVGGNYNYRYRLF 449 2083
HLA-DPA1*04:01/DPB1*02:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 325 1506
HLA-DPA1*03:01/DPB1*01:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 422 1941
HLA-DPA1*04:01/DPB1*02:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 419 1926
HLA-DRB1*11:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 37 169
HLA-DRB1*11:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 72 326
HLA-DRB1*11:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 82 368
HLA-DPA1*03:01/DPB1*01:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 471 2092
HLA-DPA1*04:01/DPB1*02:01 LDSKVGGNYNYLYRLF LDSKVGGNYNYRYRLF 456 2007
HLA-DPA1*04:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 422 1855
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 364 1596
HLA-DPA1*03:01/DPB1*01:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 324 1420
HLA-DPA1*03:01/DPB1*01:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 478 2087
HLA-DPA1*03:01/DPB1*05:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 438 1903
HLA-DPA1*04:01/DPB1*04:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 445 1918
HLA-DPA1*04:01/DPB1*02:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 328 1408
HLA-DPA1*04:01/DPB1*04:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 499 2113
HLA-DRB1*11:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 64 271
HLA-DPA1*03:01/DPB1*01:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 337 1420
HLA-DPA1*04:01/DPB1*02:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 320 1347
HLA-DPA1*02:02/DPB1*01:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 483 2032
HLA-DPA1*04:01/DPB1*04:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 405 1699
HLA-DPA1*04:01/DPB1*02:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 380 1592
HLA-DPA1*04:01/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 306 1280
HLA-DPA1*01:03/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 390 1622
HLA-DPA1*01:03/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 458 1904
HLA-DPA1*03:01/DPB1*01:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 450 1858
HLA-DPA1*01:03/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 451 1862
HLA-DRB1*11:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 145 597
HLA-DPA1*04:01/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 275 1122
HLA-DPA1*04:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 228 928
HLA-DRB1*11:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 133 541
HLA-DPA1*04:01/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 255 1029
HLA-DRB1*11:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 144 581
HLA-DPA1*03:01/DPB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 321 1280
HLA-DPA1*04:01/DPB1*02:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 406 1598
HLA-DPA1*02:02/DPB1*01:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 384 1511
HLA-DPA1*02:02/DPB1*01:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 390 1497
HLA-DPA1*02:02/DPB1*01:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 354 1357
HLA-DRB1*11:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 357 1364
HLA-DRB1*11:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 281 1070
HLA-DPA1*02:02/DPB1*01:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 364 1384
HLA-DRB1*11:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 344 1295
HLA-DPA1*03:01/DPB1*05:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 489 1824
HLA-DPA1*04:01/DPB1*01:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 473 1751
HLA-DPA1*02:02/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 323 1186
HLA-DRB1*11:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 114 416
HLA-DRB1*11:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 134 485
HLA-DRB1*11:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 50 179
HLA-DRB1*11:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 102 357
HLA-DPA1*03:01/DPB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 479 1643
HLA-DPA1*03:01/DPB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 477 1634
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 216 735
HLA-DRB1*11:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 383 1300
HLA-DRB1*11:04 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 75 254
HLA-DPA1*02:02/DPB1*01:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 489 1656
HLA-DRB1*10:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 275 922
HLA-DRB1*11:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 83 278
HLA-DPA1*04:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 374 1238
HLA-DRB1*11:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 258 850
HLA-DRB1*10:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 417 1367
HLA-DPA1*04:01/DPB1*01:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 478 1566
HLA-DRB1*10:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 420 1370
HLA-DPA1*04:01/DPB1*01:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 342 1101
HLA-DPA1*04:01/DPB1*01:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 372 1195
HLA-DRB1*16:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 189 605
HLA-DPA1*04:01/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 291 929
HLA-DPA1*02:02/DPB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 351 1116
HLA-DPA1*04:01/DPB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 486 1541
HLA-DRB1*11:04 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 32 101
HLA-DPA1*02:02/DPB1*05:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 425 1331
HLA-DRB1*16:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 482 1504
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 164 508
HLA-DPA1*04:01/DPB1*01:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 433 1339
HLA-DPA1*02:02/DPB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 446 1378
HLA-DPA1*03:01/DPB1*04:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 200 617
HLA-DPA1*04:01/DPB1*01:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 408 1253
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 193 592
HLA-DRB1*10:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 447 1369
HLA-DRB1*11:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 185 559
HLA-DPA1*02:02/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 498 1503
HLA-DPA1*04:01/DPB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 449 1354
HLA-DQA1*01:02/DQB1*05:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 332 1000
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 314 944
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 233 699
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 356 1062
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 366 1087
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 169 501
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLFRK LDSKVGGNYNYRYRLFRK 352 1027
HLA-DQA1*01:02/DQB1*05:03 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 403 1175
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 318 923
HLA-DPA1*03:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 191 551
HLA-DQA1*01:02/DQB1*05:03 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 410 1181
HLA-DPA1*02:02/DPB1*02:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 463 1330
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 310 890
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 202 575
HLA-DRB1*11:04 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 268 759
HLA-DRB1*11:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 176 498
HLA-DPA1*04:01/DPB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 382 1077
HLA-DPA1*02:02/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 356 999
HLA-DRB1*11:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 118 331
HLA-DRB1*11:04 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 70 196
HLA-DPA1*03:01/DPB1*01:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 247 691
HLA-DRB1*01:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 237 663
HLA-DRB1*16:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 400 1110
HLA-DPA1*03:01/DPB1*04:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 191 530
HLA-DQA1*01:03/DQB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 294 813
HLA-DPA1*03:01/DPB1*04:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 174 481
HLA-DPA1*03:01/DPB1*01:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 180 493
HLA-DPA1*02:02/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 442 1208
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 224 610
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 209 569
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 317 859
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 192 520
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 423 1140
HLA-DPA1*03:01/DPB1*01:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 422 1133
HLA-DRB1*16:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 416 1115
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 250 668
HLA-DPA1*02:02/DPB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 347 927
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 234 625
HLA-DPA1*03:01/DPB1*04:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 166 442
HLA-DPA1*03:01/DPB1*01:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 232 617
HLA-DQA1*01:03/DQB1*05:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 389 1032
HLA-DRB1*08:04 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 141 374
HLA-DPA1*03:01/DPB1*01:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 250 663
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 188 496
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 318 838
HLA-DPA1*03:01/DPB1*04:02 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 358 941
HLA-DPA1*03:01/DPB1*105:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 358 941
HLA-DQA1*01:03/DQB1*05:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 409 1074
HLA-DRB1*11:04 GGNYNYLYRLFRKSNLKP GGNYNYRYRLFRKSNLKP 80 210
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 275 719
HLA-DQA1*01:03/DQB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 321 837
HLA-DPA1*02:02/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 360 937
HLA-DRB1*08:02 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 293 762
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 235 611
HLA-DQA1*01:03/DQB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 324 842
HLA-DQA1*01:03/DQB1*05:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 384 997
HLA-DRB1*12:02 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 472 1222
HLA-DPA1*03:01/DPB1*01:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 256 662
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 212 546
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 210 539
HLA-DQA1*01:02/DQB1*05:03 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 482 1236
HLA-DPA1*03:01/DPB1*04:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 214 546
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRLFR NLDSKVGGNYNYRYRLFR 492 1251
HLA-DPA1*03:01/DPB1*04:02 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 339 858
HLA-DPA1*03:01/DPB1*105:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 339 858
HLA-DQA1*01:02/DQB1*05:03 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 443 1116
HLA-DRB1*12:02 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 237 597
HLA-DQA1*01:02/DQB1*05:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 273 687
HLA-DQA1*01:02/DQB1*05:03 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 437 1099
HLA-DRB1*08:04 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 305 767
HLA-DRB1*11:04 KVGGNYNYLYRLFRKSNL KVGGNYNYRYRLFRKSNL 138 346
HLA-DRB1*16:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 139 348
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 252 629
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKSNL KVGGNYNYRYRLFRKSNL 249 621
HLA-DPA1*03:01/DPB1*04:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 215 536
HLA-DQA1*01:02/DQB1*05:01 GGNYNYLYRLFRKSNL GGNYNYRYRLFRKSNL 225 560
HLA-DRB1*10:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 426 1052
HLA-DPA1*03:01/DPB1*04:02 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 316 779
HLA-DPA1*03:01/DPB1*105:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 316 779
HLA-DPA1*02:02/DPB1*01:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 248 611
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 311 766
HLA-DRB1*01:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 366 900
HLA-DQA1*01:03/DQB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 346 849
HLA-DRB1*16:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 382 933
HLA-DRB1*10:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 222 539
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 353 857
HLA-DRB1*16:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 137 332
HLA-DRB1*11:04 GGNYNYLYRLFRKSNL GGNYNYRYRLFRKSNL 43 104
HLA-DRB1*11:04 VGGNYNYLYRLFRKSNLK VGGNYNYRYRLFRKSNLK 82 197
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLF LDSKVGGNYNYRYRLF 259 621
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKSNLK VGGNYNYRYRLFRKSNLK 304 728
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRL LDSKVGGNYNYRYRL 446 1065
HLA-DQA1*01:02/DQB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 166 394
HLA-DPA1*03:01/DPB1*01:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 268 633
HLA-DRB1*10:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 321 758
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKSNL VGGNYNYRYRLFRKSNL 208 491
HLA-DQA1*01:03/DQB1*06:09 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 465 1087
HLA-DPA1*03:01/DPB1*04:02 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 259 605
HLA-DPA1*03:01/DPB1*105:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 259 605
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLF DSKVGGNYNYRYRLF 283 660
HLA-DRB1*11:04 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 128 298
HLA-DRB1*08:04 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 272 633
HLA-DQA1*01:03/DQB1*06:09 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 462 1070
HLA-DQA1*01:02/DQB1*05:01 GNYNYLYRLFRKSNLK GNYNYRYRLFRKSNLK 254 588
HLA-DQA1*01:03/DQB1*06:09 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 477 1104
HLA-DPA1*02:02/DPB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 240 555
HLA-DRB1*10:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 197 455
HLA-DQA1*01:02/DQB1*05:01 SNNLDSKVGGNYNYLYRLF SNNLDSKVGGNYNYRYRLF 324 748
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKSNLK KVGGNYNYRYRLFRKSNLK 179 413
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 150 345
HLA-DRB1*11:04 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 64 147
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRKSNL SKVGGNYNYRYRLFRKSNL 163 374
HLA-DRB1*11:04 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 154 353
HLA-DQA1*01:02/DQB1*05:01 GGNYNYLYRLFRKSNLKP GGNYNYRYRLFRKSNLKP 401 919
HLA-DRB1*16:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 271 618
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRLF NLDSKVGGNYNYRYRLF 359 818
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 151 344
HLA-DRB1*01:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 380 865
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 71 161
HLA-DRB1*10:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 291 658
HLA-DPA1*03:01/DPB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 345 780
HLA-DPA1*02:02/DPB1*01:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 204 461
HLA-DRB1*11:04 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 171 386
HLA-DPA1*02:01/DPB1*01:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 450 1014
HLA-DPA1*03:01/DPB1*02:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 130 292
HLA-DQA1*01:03/DQB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 327 733
HLA-DRB1*01:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 383 858
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRL NLDSKVGGNYNYRYRL 451 1009
HLA-DRB1*12:02 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 447 992
HLA-DPA1*02:01/DPB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 461 1023
HLA-DRB1*15:02 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 415 920
HLA-DRB1*01:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 207 458
HLA-DQA1*01:02/DQB1*05:03 DSKVGGNYNYLYRLFRKSNL DSKVGGNYNYRYRLFRKSNL 410 906
HLA-DRB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 393 868
HLA-DQA1*01:02/DQB1*05:03 SKVGGNYNYLYRLFRKSNLK SKVGGNYNYRYRLFRKSNLK 413 912
HLA-DQA1*01:03/DQB1*05:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 282 622
HLA-DQA1*01:02/DQB1*05:01 GGNYNYLYRLFRKSNLK GGNYNYRYRLFRKSNLK 275 606
HLA-DPA1*03:01/DPB1*04:02 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 233 513
HLA-DPA1*03:01/DPB1*105:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 233 513
HLA-DRB1*11:04 NYNYLYRLFRKSNLKP NYNYRYRLFRKSNLKP 30 66
HLA-DQA1*01:03/DQB1*05:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 280 615
HLA-DRB1*16:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 255 560
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKSNLKP VGGNYNYRYRLFRKSNLKP 218 478
HLA-DPA1*02:01/DPB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 444 973
HLA-DRB1*01:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 214 468
HLA-DPA1*02:02/DPB1*01:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 181 395
HLA-DRB1*10:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 325 709
HLA-DRB1*11:04 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 50 109
HLA-DRB1*10:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 367 799
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRKSNL KVGGNYNYRYRLFRKSNL 416 904
HLA-DRB1*16:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 293 636
HLA-DPA1*02:02/DPB1*01:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 218 473
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 77 167
HLA-DPA1*03:01/DPB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 336 728
HLA-DQA1*01:02/DQB1*05:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 212 459
HLA-DRB1*08:02 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 404 869
HLA-DPA1*02:02/DPB1*01:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 220 473
HLA-DPA1*03:01/DPB1*04:02 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 350 752
HLA-DPA1*03:01/DPB1*105:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 350 752
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKSNLK VGGNYNYRYRLFRKSNLK 446 958
HLA-DQA1*01:03/DQB1*06:09 DSKVGGNYNYLYRLFRKSNL DSKVGGNYNYRYRLFRKSNL 427 917
HLA-DRB1*11:04 VGGNYNYLYRLFRKSNL VGGNYNYRYRLFRKSNL 41 88
HLA-DRB1*01:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 462 991
HLA-DQA1*01:02/DQB1*05:03 KVGGNYNYLYRLFRKSNLKP KVGGNYNYRYRLFRKSNLKP 434 930
HLA-DRB1*11:04 GNYNYLYRLFRKSNLKPF GNYNYRYRLFRKSNLKPF 71 152
HLA-DQA1*01:02/DQB1*05:01 GNYNYLYRLFRKSNL GNYNYRYRLFRKSNL 268 573
HLA-DRB1*11:04 GNYNYLYRLFRKSNLK GNYNYRYRLFRKSNLK 29 62
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKSNL VGGNYNYRYRLFRKSNL 276 589
HLA-DPA1*03:01/DPB1*04:02 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 345 736
HLA-DPA1*03:01/DPB1*105:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 345 736
HLA-DPA1*04:01/DPB1*04:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 274 583
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRKSNLK KVGGNYNYRYRLFRKSNLK 243 517
HLA-DRB1*10:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 356 756
HLA-DRB1*16:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 279 592
HLA-DPA1*03:01/DPB1*01:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 273 579
HLA-DRB1*11:04 GNYNYLYRLFRKSNLKP GNYNYRYRLFRKSNLKP 25 53
HLA-DRB1*10:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 419 887
HLA-DPA1*02:02/DPB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 294 622
HLA-DPA1*02:01/DPB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 371 782
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRKSNLK SKVGGNYNYRYRLFRKSNLK 140 295
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKSNLKP KVGGNYNYRYRLFRKSNLKP 154 324
HLA-DPA1*02:01/DPB1*05:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 388 815
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 143 300
HLA-DPA1*03:01/DPB1*04:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 198 415
HLA-DPA1*02:02/DPB1*01:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 418 876
HLA-DPA1*03:01/DPB1*04:02 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 295 618
HLA-DPA1*03:01/DPB1*105:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 295 618
HLA-DQA1*01:03/DQB1*05:01 SKVGGNYNYLYRLFRKSNL SKVGGNYNYRYRLFRKSNL 238 498
HLA-DPA1*02:01/DPB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 423 885
HLA-DRB1*16:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 198 414
HLA-DQA1*01:03/DQB1*05:01 GGNYNYLYRLFRKSNL GGNYNYRYRLFRKSNL 276 575
HLA-DQA1*01:02/DQB1*05:01 GNYNYLYRLFRKSNLKP GNYNYRYRLFRKSNLKP 297 618
HLA-DPA1*02:02/DPB1*01:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 384 799
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKSNLKP VGGNYNYRYRLFRKSNLKP 274 570
HLA-DQA1*01:03/DQB1*05:01 GNYNYLYRLFRKSNL GNYNYRYRLFRKSNL 304 632
HLA-DRB1*08:04 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 311 646
HLA-DQA1*01:03/DQB1*06:09 SKVGGNYNYLYRLFRKSNLK SKVGGNYNYRYRLFRKSNLK 444 919
HLA-DPA1*02:01/DPB1*05:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 304 629
HLA-DRB1*11:04 NYNYLYRLFRKSNLKPFE NYNYRYRLFRKSNLKPFE 75 155
HLA-DRB1*11:04 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 129 266
HLA-DPA1*02:02/DPB1*01:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 216 445
HLA-DPA1*03:01/DPB1*05:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 250 515
HLA-DRB1*01:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 490 1009
HLA-DPA1*01:03/DPB1*01:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 374 770
HLA-DRB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 484 996
HLA-DPA1*03:01/DPB1*04:02 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 336 690
HLA-DPA1*03:01/DPB1*105:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 336 690
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFRKSNL DSKVGGNYNYRYRLFRKSNL 134 275
HLA-DRB1*08:04 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 212 435
HLA-DPA1*02:02/DPB1*05:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 240 492
HLA-DPA1*03:01/DPB1*02:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 69 141
HLA-DPA1*03:01/DPB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 343 699
HLA-DRB1*16:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 354 721
HLA-DQA1*01:02/DQB1*05:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 247 503
HLA-DPA1*02:01/DPB1*01:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 325 661
HLA-DPA1*02:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 360 732
HLA-DPA1*02:02/DPB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 224 454
HLA-DPA1*02:02/DPB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 265 537
HLA-DRB1*16:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 222 449
HLA-DRB1*11:04 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 480 969
HLA-DRB1*16:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 381 768
HLA-DQA1*01:03/DQB1*05:01 GGNYNYLYRLFRKSNLK GGNYNYRYRLFRKSNLK 329 663
HLA-DPA1*02:02/DPB1*05:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 198 399
HLA-DPA1*02:01/DPB1*05:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 306 616
HLA-DPA1*04:01/DPB1*04:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 265 533
HLA-DPA1*01:03/DPB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 368 739
HLA-DRB1*10:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 241 483
HLA-DRB1*11:04 GNYNYLYRLFRKSNL GNYNYRYRLFRKSNL 21 42
HLA-DPA1*02:02/DPB1*05:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 184 368
HLA-DRB1*11:04 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 440 880

T478K

Reference  YRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    YRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*05:01/DQB1*03:01 DISTEIYQAGSTPCN DISTEIYQAGSKPCN 251 990
HLA-DQA1*05:01/DQB1*03:19 DISTEIYQAGSTPCN DISTEIYQAGSKPCN 251 990
HLA-DQA1*02:01/DQB1*03:01 DISTEIYQAGSTPCN DISTEIYQAGSKPCN 202 669
HLA-DQA1*02:01/DQB1*03:19 DISTEIYQAGSTPCN DISTEIYQAGSKPCN 202 669
HLA-DQA1*05:01/DQB1*03:01 ERDISTEIYQAGSTPCN ERDISTEIYQAGSKPCN 490 1575
HLA-DQA1*05:01/DQB1*03:19 ERDISTEIYQAGSTPCN ERDISTEIYQAGSKPCN 490 1575
HLA-DQA1*02:01/DQB1*03:01 ERDISTEIYQAGSTPCN ERDISTEIYQAGSKPCN 329 1014
HLA-DQA1*02:01/DQB1*03:19 ERDISTEIYQAGSTPCN ERDISTEIYQAGSKPCN 329 1014
HLA-DQA1*05:01/DQB1*03:01 RDISTEIYQAGSTPCN RDISTEIYQAGSKPCN 357 1082
HLA-DQA1*05:01/DQB1*03:19 RDISTEIYQAGSTPCN RDISTEIYQAGSKPCN 357 1082
HLA-DRB1*10:01 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 404 1193
HLA-DQA1*02:01/DQB1*03:01 TEIYQAGSTPCNGVEGFNC TEIYQAGSKPCNGVEGFNC 154 446
HLA-DQA1*02:01/DQB1*03:19 TEIYQAGSTPCNGVEGFNC TEIYQAGSKPCNGVEGFNC 154 446
HLA-DQA1*02:01/DQB1*03:01 IYQAGSTPCNGVEGFN IYQAGSKPCNGVEGFN 138 392
HLA-DQA1*02:01/DQB1*03:19 IYQAGSTPCNGVEGFN IYQAGSKPCNGVEGFN 138 392
HLA-DQA1*02:01/DQB1*03:01 STEIYQAGSTPCNGVEGFN STEIYQAGSKPCNGVEGFN 144 406
HLA-DQA1*02:01/DQB1*03:19 STEIYQAGSTPCNGVEGFN STEIYQAGSKPCNGVEGFN 144 406
HLA-DQA1*02:01/DQB1*03:01 TEIYQAGSTPCNGVEGFN TEIYQAGSKPCNGVEGFN 273 766
HLA-DQA1*02:01/DQB1*03:19 TEIYQAGSTPCNGVEGFN TEIYQAGSKPCNGVEGFN 273 766
HLA-DRB1*10:01 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 354 993
HLA-DQA1*02:01/DQB1*03:01 EIYQAGSTPCNGVEGFNC EIYQAGSKPCNGVEGFNC 326 902
HLA-DQA1*02:01/DQB1*03:19 EIYQAGSTPCNGVEGFNC EIYQAGSKPCNGVEGFNC 326 902
HLA-DQA1*02:01/DQB1*03:01 IYQAGSTPCNGVEGF IYQAGSKPCNGVEGF 98 270
HLA-DQA1*02:01/DQB1*03:19 IYQAGSTPCNGVEGF IYQAGSKPCNGVEGF 98 270
HLA-DQA1*02:01/DQB1*03:01 TEIYQAGSTPCNGVEGF TEIYQAGSKPCNGVEGF 118 324
HLA-DQA1*02:01/DQB1*03:19 TEIYQAGSTPCNGVEGF TEIYQAGSKPCNGVEGF 118 324
HLA-DQA1*02:01/DQB1*03:01 ISTEIYQAGSTPCNGVEGF ISTEIYQAGSKPCNGVEGF 140 384
HLA-DQA1*02:01/DQB1*03:19 ISTEIYQAGSTPCNGVEGF ISTEIYQAGSKPCNGVEGF 140 384
HLA-DQA1*02:01/DQB1*03:01 EIYQAGSTPCNGVEGF EIYQAGSKPCNGVEGF 102 278
HLA-DQA1*02:01/DQB1*03:19 EIYQAGSTPCNGVEGF EIYQAGSKPCNGVEGF 102 278
HLA-DQA1*02:01/DQB1*03:01 EIYQAGSTPCNGVEGFN EIYQAGSKPCNGVEGFN 136 370
HLA-DQA1*02:01/DQB1*03:19 EIYQAGSTPCNGVEGFN EIYQAGSKPCNGVEGFN 136 370
HLA-DQA1*02:01/DQB1*03:01 STEIYQAGSTPCNGVEGF STEIYQAGSKPCNGVEGF 257 698
HLA-DQA1*02:01/DQB1*03:19 STEIYQAGSTPCNGVEGF STEIYQAGSKPCNGVEGF 257 698
HLA-DQA1*02:01/DQB1*03:01 IYQAGSTPCNGVEGFNC IYQAGSKPCNGVEGFNC 180 488
HLA-DQA1*02:01/DQB1*03:19 IYQAGSTPCNGVEGFNC IYQAGSKPCNGVEGFNC 180 488
HLA-DQA1*02:01/DQB1*03:01 RDISTEIYQAGSTPCN RDISTEIYQAGSKPCN 238 644
HLA-DQA1*02:01/DQB1*03:19 RDISTEIYQAGSTPCN RDISTEIYQAGSKPCN 238 644
HLA-DQA1*02:01/DQB1*03:01 EIYQAGSTPCNGVEGFNCY EIYQAGSKPCNGVEGFNCY 183 495
HLA-DQA1*02:01/DQB1*03:19 EIYQAGSTPCNGVEGFNCY EIYQAGSKPCNGVEGFNCY 183 495
HLA-DQA1*02:01/DQB1*03:03 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 498 1339
HLA-DQA1*05:01/DQB1*03:03 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 367 980
HLA-DQA1*02:01/DQB1*03:01 STEIYQAGSTPCNGVEG STEIYQAGSKPCNGVEG 114 303
HLA-DQA1*02:01/DQB1*03:19 STEIYQAGSTPCNGVEG STEIYQAGSKPCNGVEG 114 303
HLA-DQA1*05:01/DQB1*03:03 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 483 1275
HLA-DQA1*02:01/DQB1*03:01 IYQAGSTPCNGVEGFNCY IYQAGSKPCNGVEGFNCY 449 1177
HLA-DQA1*02:01/DQB1*03:19 IYQAGSTPCNGVEGFNCY IYQAGSKPCNGVEGFNCY 449 1177
HLA-DQA1*02:01/DQB1*03:01 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 90 235
HLA-DQA1*02:01/DQB1*03:19 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 90 235
HLA-DQA1*02:01/DQB1*03:01 DISTEIYQAGSTPCNGVEG DISTEIYQAGSKPCNGVEG 140 365
HLA-DQA1*02:01/DQB1*03:19 DISTEIYQAGSTPCNGVEG DISTEIYQAGSKPCNGVEG 140 365
HLA-DQA1*02:01/DQB1*03:01 TEIYQAGSTPCNGVEGFNCY TEIYQAGSKPCNGVEGFNCY 118 306
HLA-DQA1*02:01/DQB1*03:19 TEIYQAGSTPCNGVEGFNCY TEIYQAGSKPCNGVEGFNCY 118 306
HLA-DQA1*02:01/DQB1*03:01 YQAGSTPCNGVEGFN YQAGSKPCNGVEGFN 205 531
HLA-DQA1*02:01/DQB1*03:19 YQAGSTPCNGVEGFN YQAGSKPCNGVEGFN 205 531
HLA-DQA1*02:01/DQB1*03:01 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 78 202
HLA-DQA1*02:01/DQB1*03:19 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 78 202
HLA-DQA1*02:01/DQB1*03:01 ISTEIYQAGSTPCNGVEG ISTEIYQAGSKPCNGVEG 254 657
HLA-DQA1*02:01/DQB1*03:19 ISTEIYQAGSTPCNGVEG ISTEIYQAGSKPCNGVEG 254 657
HLA-DQA1*02:01/DQB1*03:01 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 107 276
HLA-DQA1*02:01/DQB1*03:19 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 107 276
HLA-DQA1*05:01/DQB1*03:03 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 394 1015
HLA-DQA1*03:01/DQB1*03:01 TEIYQAGSTPCNGVEGFNC TEIYQAGSKPCNGVEGFNC 483 1236
HLA-DQA1*03:01/DQB1*03:19 TEIYQAGSTPCNGVEGFNC TEIYQAGSKPCNGVEGFNC 483 1236
HLA-DRB1*10:01 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 494 1264
HLA-DQA1*02:01/DQB1*03:01 ISTEIYQAGSTPCNGVE ISTEIYQAGSKPCNGVE 111 283
HLA-DQA1*02:01/DQB1*03:19 ISTEIYQAGSTPCNGVE ISTEIYQAGSKPCNGVE 111 283
HLA-DQA1*03:01/DQB1*03:01 STEIYQAGSTPCNGVEGFN STEIYQAGSKPCNGVEGFN 445 1131
HLA-DQA1*03:01/DQB1*03:19 STEIYQAGSTPCNGVEGFN STEIYQAGSKPCNGVEGFN 445 1131
HLA-DQA1*05:01/DQB1*03:03 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 497 1247
HLA-DQA1*02:01/DQB1*03:01 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 68 170
HLA-DQA1*02:01/DQB1*03:19 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 68 170
HLA-DQA1*02:01/DQB1*03:01 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 102 254
HLA-DQA1*02:01/DQB1*03:19 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 102 254
HLA-DQA1*02:01/DQB1*03:01 DISTEIYQAGSTPCNGV DISTEIYQAGSKPCNGV 116 288
HLA-DQA1*02:01/DQB1*03:19 DISTEIYQAGSTPCNGV DISTEIYQAGSKPCNGV 116 288
HLA-DRB1*10:01 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 442 1096
HLA-DQA1*03:01/DQB1*03:01 ISTEIYQAGSTPCNGVEGF ISTEIYQAGSKPCNGVEGF 425 1052
HLA-DQA1*03:01/DQB1*03:19 ISTEIYQAGSTPCNGVEGF ISTEIYQAGSKPCNGVEGF 425 1052
HLA-DQA1*02:01/DQB1*03:01 PFERDISTEIYQAGSTPCN PFERDISTEIYQAGSKPCN 393 972
HLA-DQA1*02:01/DQB1*03:19 PFERDISTEIYQAGSTPCN PFERDISTEIYQAGSKPCN 393 972
HLA-DQA1*02:01/DQB1*03:01 IYQAGSTPCNGVEGFNCYF IYQAGSKPCNGVEGFNCYF 263 650
HLA-DQA1*02:01/DQB1*03:19 IYQAGSTPCNGVEGFNCYF IYQAGSKPCNGVEGFNCYF 263 650
HLA-DQA1*02:01/DQB1*03:01 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 100 247
HLA-DQA1*02:01/DQB1*03:19 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 100 247
HLA-DQA1*02:01/DQB1*03:01 DISTEIYQAGSTPCNGVE DISTEIYQAGSKPCNGVE 250 617
HLA-DQA1*02:01/DQB1*03:19 DISTEIYQAGSTPCNGVE DISTEIYQAGSKPCNGVE 250 617
HLA-DQA1*05:01/DQB1*03:03 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 437 1078
HLA-DQA1*05:01/DQB1*03:01 IYQAGSTPCNGVEGFN IYQAGSKPCNGVEGFN 196 483
HLA-DQA1*05:01/DQB1*03:19 IYQAGSTPCNGVEGFN IYQAGSKPCNGVEGFN 196 483
HLA-DQA1*02:01/DQB1*03:01 YQAGSTPCNGVEGFNC YQAGSKPCNGVEGFNC 303 745
HLA-DQA1*02:01/DQB1*03:19 YQAGSTPCNGVEGFNC YQAGSKPCNGVEGFNC 303 745
HLA-DQA1*03:01/DQB1*03:01 TEIYQAGSTPCNGVEGFNCY TEIYQAGSKPCNGVEGFNCY 429 1050
HLA-DQA1*03:01/DQB1*03:19 TEIYQAGSTPCNGVEGFNCY TEIYQAGSKPCNGVEGFNCY 429 1050
HLA-DQA1*05:01/DQB1*03:01 FERDISTEIYQAGSTPCNG FERDISTEIYQAGSKPCNG 424 1031
HLA-DQA1*05:01/DQB1*03:19 FERDISTEIYQAGSTPCNG FERDISTEIYQAGSKPCNG 424 1031
HLA-DQA1*05:01/DQB1*03:01 TEIYQAGSTPCNGVEGF TEIYQAGSKPCNGVEGF 158 384
HLA-DQA1*05:01/DQB1*03:19 TEIYQAGSTPCNGVEGF TEIYQAGSKPCNGVEGF 158 384
HLA-DQA1*03:01/DQB1*03:01 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 395 960
HLA-DQA1*03:01/DQB1*03:19 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 395 960
HLA-DQA1*02:01/DQB1*03:03 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 459 1112
HLA-DQA1*05:01/DQB1*03:01 ISTEIYQAGSTPCNG ISTEIYQAGSKPCNG 150 363
HLA-DQA1*05:01/DQB1*03:19 ISTEIYQAGSTPCNG ISTEIYQAGSKPCNG 150 363
HLA-DQA1*05:01/DQB1*03:01 TEIYQAGSTPCNGVEGFNC TEIYQAGSKPCNGVEGFNC 256 619
HLA-DQA1*05:01/DQB1*03:19 TEIYQAGSTPCNGVEGFNC TEIYQAGSKPCNGVEGFNC 256 619
HLA-DQA1*02:01/DQB1*03:01 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 87 210
HLA-DQA1*02:01/DQB1*03:19 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 87 210
HLA-DQA1*05:01/DQB1*03:01 STEIYQAGSTPCNGVEGFN STEIYQAGSKPCNGVEGFN 235 567
HLA-DQA1*05:01/DQB1*03:19 STEIYQAGSTPCNGVEGFN STEIYQAGSKPCNGVEGFN 235 567
HLA-DQA1*05:01/DQB1*03:01 STEIYQAGSTPCNGVEG STEIYQAGSKPCNGVEG 148 357
HLA-DQA1*05:01/DQB1*03:19 STEIYQAGSTPCNGVEG STEIYQAGSKPCNGVEG 148 357
HLA-DQA1*02:01/DQB1*03:01 RDISTEIYQAGSTPCNGV RDISTEIYQAGSKPCNGV 265 638
HLA-DQA1*02:01/DQB1*03:19 RDISTEIYQAGSTPCNGV RDISTEIYQAGSKPCNGV 265 638
HLA-DQA1*02:01/DQB1*03:01 EIYQAGSTPCNGVEGFNCYF EIYQAGSKPCNGVEGFNCYF 146 351
HLA-DQA1*02:01/DQB1*03:19 EIYQAGSTPCNGVEGFNCYF EIYQAGSKPCNGVEGFNCYF 146 351
HLA-DQA1*05:01/DQB1*03:01 EIYQAGSTPCNGVEGF EIYQAGSKPCNGVEGF 139 334
HLA-DQA1*05:01/DQB1*03:19 EIYQAGSTPCNGVEGF EIYQAGSKPCNGVEGF 139 334
HLA-DQA1*05:01/DQB1*03:01 ISTEIYQAGSTPCNGVEGF ISTEIYQAGSKPCNGVEGF 225 540
HLA-DQA1*05:01/DQB1*03:19 ISTEIYQAGSTPCNGVEGF ISTEIYQAGSKPCNGVEGF 225 540
HLA-DQA1*05:01/DQB1*03:03 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 429 1029
HLA-DQA1*03:01/DQB1*03:01 TEIYQAGSTPCNGVEGF TEIYQAGSKPCNGVEGF 343 820
HLA-DQA1*03:01/DQB1*03:19 TEIYQAGSTPCNGVEGF TEIYQAGSKPCNGVEGF 343 820
HLA-DQA1*05:01/DQB1*03:01 RDISTEIYQAGSTPCNG RDISTEIYQAGSKPCNG 290 693
HLA-DQA1*05:01/DQB1*03:19 RDISTEIYQAGSTPCNG RDISTEIYQAGSKPCNG 290 693
HLA-DQA1*05:01/DQB1*03:01 TEIYQAGSTPCNGVEGFNCY TEIYQAGSKPCNGVEGFNCY 185 442
HLA-DQA1*05:01/DQB1*03:19 TEIYQAGSTPCNGVEGFNCY TEIYQAGSKPCNGVEGFNCY 185 442
HLA-DRB1*10:01 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 401 958
HLA-DQA1*05:01/DQB1*03:01 DISTEIYQAGSTPCNGVEG DISTEIYQAGSKPCNGVEG 225 537
HLA-DQA1*05:01/DQB1*03:19 DISTEIYQAGSTPCNGVEG DISTEIYQAGSKPCNGVEG 225 537
HLA-DQA1*06:01/DQB1*03:01 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 254 606
HLA-DQA1*06:01/DQB1*03:19 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 254 606
HLA-DQA1*03:01/DQB1*03:01 DISTEIYQAGSTPCNGVEG DISTEIYQAGSKPCNGVEG 421 1001
HLA-DQA1*03:01/DQB1*03:19 DISTEIYQAGSTPCNGVEG DISTEIYQAGSKPCNGVEG 421 1001
HLA-DQA1*02:01/DQB1*03:01 RDISTEIYQAGSTPCNGVE RDISTEIYQAGSKPCNGVE 143 340
HLA-DQA1*02:01/DQB1*03:19 RDISTEIYQAGSTPCNGVE RDISTEIYQAGSKPCNGVE 143 340
HLA-DQA1*05:01/DQB1*03:01 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 170 404
HLA-DQA1*05:01/DQB1*03:19 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 170 404
HLA-DQA1*06:01/DQB1*03:01 EIYQAGSTPCNGVEGF EIYQAGSKPCNGVEGF 314 746
HLA-DQA1*06:01/DQB1*03:19 EIYQAGSTPCNGVEGF EIYQAGSKPCNGVEGF 314 746
HLA-DQA1*06:01/DQB1*03:01 TEIYQAGSTPCNGVEGF TEIYQAGSKPCNGVEGF 387 919
HLA-DQA1*06:01/DQB1*03:19 TEIYQAGSTPCNGVEGF TEIYQAGSKPCNGVEGF 387 919
HLA-DQA1*06:01/DQB1*03:01 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 276 653
HLA-DQA1*06:01/DQB1*03:19 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 276 653
HLA-DQA1*05:01/DQB1*03:01 DISTEIYQAGSTPCNGVE DISTEIYQAGSKPCNGVE 396 936
HLA-DQA1*05:01/DQB1*03:19 DISTEIYQAGSTPCNGVE DISTEIYQAGSKPCNGVE 396 936
HLA-DQA1*03:01/DQB1*03:01 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 215 507
HLA-DQA1*03:01/DQB1*03:19 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 215 507
HLA-DQA1*02:01/DQB1*03:01 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 100 235
HLA-DQA1*02:01/DQB1*03:19 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 100 235
HLA-DQA1*05:01/DQB1*03:01 TEIYQAGSTPCNGVEGFN TEIYQAGSKPCNGVEGFN 440 1034
HLA-DQA1*05:01/DQB1*03:19 TEIYQAGSTPCNGVEGFN TEIYQAGSKPCNGVEGFN 440 1034
HLA-DQA1*05:01/DQB1*03:01 STEIYQAGSTPCNGVEGF STEIYQAGSKPCNGVEGF 406 954
HLA-DQA1*05:01/DQB1*03:19 STEIYQAGSTPCNGVEGF STEIYQAGSKPCNGVEGF 406 954
HLA-DQA1*06:01/DQB1*03:01 STEIYQAGSTPCNGVEG STEIYQAGSKPCNGVEG 365 857
HLA-DQA1*06:01/DQB1*03:19 STEIYQAGSTPCNGVEG STEIYQAGSKPCNGVEG 365 857
HLA-DQA1*03:01/DQB1*03:01 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 368 864
HLA-DQA1*03:01/DQB1*03:19 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 368 864
HLA-DQA1*06:01/DQB1*03:01 IYQAGSTPCNGVEGFN IYQAGSKPCNGVEGFN 440 1032
HLA-DQA1*06:01/DQB1*03:19 IYQAGSTPCNGVEGFN IYQAGSKPCNGVEGFN 440 1032
HLA-DQA1*02:01/DQB1*03:01 ISTEIYQAGSTPCNG ISTEIYQAGSKPCNG 116 272
HLA-DQA1*02:01/DQB1*03:19 ISTEIYQAGSTPCNG ISTEIYQAGSKPCNG 116 272
HLA-DQA1*03:01/DQB1*03:01 EIYQAGSTPCNGVEGF EIYQAGSKPCNGVEGF 289 677
HLA-DQA1*03:01/DQB1*03:19 EIYQAGSTPCNGVEGF EIYQAGSKPCNGVEGF 289 677
HLA-DQA1*03:01/DQB1*03:01 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 243 569
HLA-DQA1*03:01/DQB1*03:19 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 243 569
HLA-DQA1*05:01/DQB1*03:01 RDISTEIYQAGSTPCNGVE RDISTEIYQAGSKPCNGVE 238 556
HLA-DQA1*05:01/DQB1*03:19 RDISTEIYQAGSTPCNGVE RDISTEIYQAGSKPCNGVE 238 556
HLA-DQA1*05:01/DQB1*03:01 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 120 280
HLA-DQA1*05:01/DQB1*03:19 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 120 280
HLA-DQA1*03:01/DQB1*03:01 IYQAGSTPCNGVEGFN IYQAGSKPCNGVEGFN 412 961
HLA-DQA1*03:01/DQB1*03:19 IYQAGSTPCNGVEGFN IYQAGSKPCNGVEGFN 412 961
HLA-DQA1*03:01/DQB1*03:01 STEIYQAGSTPCNGVEG STEIYQAGSKPCNGVEG 327 762
HLA-DQA1*03:01/DQB1*03:19 STEIYQAGSTPCNGVEG STEIYQAGSKPCNGVEG 327 762
HLA-DQA1*05:01/DQB1*03:01 ISTEIYQAGSTPCNGVEG ISTEIYQAGSKPCNGVEG 395 920
HLA-DQA1*05:01/DQB1*03:19 ISTEIYQAGSTPCNGVEG ISTEIYQAGSKPCNGVEG 395 920
HLA-DQA1*06:01/DQB1*03:01 IYQAGSTPCNGVEGF IYQAGSKPCNGVEGF 359 836
HLA-DQA1*06:01/DQB1*03:19 IYQAGSTPCNGVEGF IYQAGSKPCNGVEGF 359 836
HLA-DQA1*05:01/DQB1*03:01 IYQAGSTPCNGVEGF IYQAGSKPCNGVEGF 137 319
HLA-DQA1*05:01/DQB1*03:19 IYQAGSTPCNGVEGF IYQAGSKPCNGVEGF 137 319
HLA-DQA1*03:01/DQB1*03:01 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 353 821
HLA-DQA1*03:01/DQB1*03:19 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 353 821
HLA-DQA1*02:01/DQB1*03:01 ERDISTEIYQAGSTPCNGV ERDISTEIYQAGSKPCNGV 157 365
HLA-DQA1*02:01/DQB1*03:19 ERDISTEIYQAGSTPCNGV ERDISTEIYQAGSKPCNGV 157 365
HLA-DQA1*05:01/DQB1*03:01 EIYQAGSTPCNGVEGFN EIYQAGSKPCNGVEGFN 191 444
HLA-DQA1*05:01/DQB1*03:19 EIYQAGSTPCNGVEGFN EIYQAGSKPCNGVEGFN 191 444
HLA-DQA1*06:01/DQB1*03:01 EIYQAGSTPCNGVEGFN EIYQAGSKPCNGVEGFN 449 1043
HLA-DQA1*06:01/DQB1*03:19 EIYQAGSTPCNGVEGFN EIYQAGSKPCNGVEGFN 449 1043
HLA-DQA1*03:01/DQB1*03:01 IYQAGSTPCNGVEGF IYQAGSKPCNGVEGF 350 813
HLA-DQA1*03:01/DQB1*03:19 IYQAGSTPCNGVEGF IYQAGSKPCNGVEGF 350 813
HLA-DQA1*03:01/DQB1*03:01 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 225 522
HLA-DQA1*03:01/DQB1*03:19 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 225 522
HLA-DQA1*03:01/DQB1*03:01 EIYQAGSTPCNGVEGFN EIYQAGSKPCNGVEGFN 413 958
HLA-DQA1*03:01/DQB1*03:19 EIYQAGSTPCNGVEGFN EIYQAGSKPCNGVEGFN 413 958
HLA-DQA1*05:01/DQB1*03:01 EIYQAGSTPCNGVEGFNCY EIYQAGSKPCNGVEGFNCY 310 719
HLA-DQA1*05:01/DQB1*03:19 EIYQAGSTPCNGVEGFNCY EIYQAGSKPCNGVEGFNCY 310 719
HLA-DQA1*02:01/DQB1*03:01 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 69 160
HLA-DQA1*02:01/DQB1*03:19 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 69 160
HLA-DQA1*05:01/DQB1*03:01 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 99 229
HLA-DQA1*05:01/DQB1*03:19 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 99 229
HLA-DQA1*05:01/DQB1*03:01 RDISTEIYQAGSTPCNGV RDISTEIYQAGSKPCNGV 428 990
HLA-DQA1*05:01/DQB1*03:19 RDISTEIYQAGSTPCNGV RDISTEIYQAGSKPCNGV 428 990
HLA-DQA1*02:01/DQB1*03:01 RDISTEIYQAGSTPCNG RDISTEIYQAGSKPCNG 202 465
HLA-DQA1*02:01/DQB1*03:19 RDISTEIYQAGSTPCNG RDISTEIYQAGSKPCNG 202 465
HLA-DQA1*04:01/DQB1*03:01 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 499 1148
HLA-DQA1*04:01/DQB1*03:19 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 499 1148
HLA-DQA1*03:01/DQB1*03:01 ISTEIYQAGSTPCNG ISTEIYQAGSKPCNG 340 781
HLA-DQA1*03:01/DQB1*03:19 ISTEIYQAGSTPCNG ISTEIYQAGSKPCNG 340 781
HLA-DQA1*05:01/DQB1*03:01 ERDISTEIYQAGSTPCNGV ERDISTEIYQAGSKPCNGV 270 620
HLA-DQA1*05:01/DQB1*03:19 ERDISTEIYQAGSTPCNGV ERDISTEIYQAGSKPCNGV 270 620
HLA-DQA1*06:01/DQB1*03:01 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 270 620
HLA-DQA1*06:01/DQB1*03:19 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 270 620
HLA-DQA1*05:01/DQB1*03:01 ISTEIYQAGSTPCNGVE ISTEIYQAGSKPCNGVE 149 342
HLA-DQA1*05:01/DQB1*03:19 ISTEIYQAGSTPCNGVE ISTEIYQAGSKPCNGVE 149 342
HLA-DQA1*06:01/DQB1*03:01 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 238 544
HLA-DQA1*06:01/DQB1*03:19 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 238 544
HLA-DQA1*06:01/DQB1*03:01 ISTEIYQAGSTPCNGVE ISTEIYQAGSKPCNGVE 353 806
HLA-DQA1*06:01/DQB1*03:19 ISTEIYQAGSTPCNGVE ISTEIYQAGSKPCNGVE 353 806
HLA-DQA1*05:01/DQB1*03:01 IYQAGSTPCNGVEGFNC IYQAGSKPCNGVEGFNC 275 627
HLA-DQA1*05:01/DQB1*03:19 IYQAGSTPCNGVEGFNC IYQAGSKPCNGVEGFNC 275 627
HLA-DQA1*02:01/DQB1*03:01 KPFERDISTEIYQAGSTPCN KPFERDISTEIYQAGSKPCN 292 665
HLA-DQA1*02:01/DQB1*03:19 KPFERDISTEIYQAGSTPCN KPFERDISTEIYQAGSKPCN 292 665
HLA-DQA1*06:01/DQB1*03:01 STEIYQAGSTPCNGVEGFN STEIYQAGSKPCNGVEGFN 486 1106
HLA-DQA1*06:01/DQB1*03:19 STEIYQAGSTPCNGVEGFN STEIYQAGSKPCNGVEGFN 486 1106
HLA-DQA1*05:01/DQB1*03:01 EIYQAGSTPCNGVEGFNCYF EIYQAGSKPCNGVEGFNCYF 228 517
HLA-DQA1*05:01/DQB1*03:19 EIYQAGSTPCNGVEGFNCYF EIYQAGSKPCNGVEGFNCYF 228 517
HLA-DQA1*05:01/DQB1*03:01 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 86 195
HLA-DQA1*05:01/DQB1*03:19 TEIYQAGSTPCNGVE TEIYQAGSKPCNGVE 86 195
HLA-DQA1*03:01/DQB1*03:01 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 258 585
HLA-DQA1*03:01/DQB1*03:19 EIYQAGSTPCNGVEG EIYQAGSKPCNGVEG 258 585
HLA-DQA1*02:01/DQB1*03:01 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 90 204
HLA-DQA1*02:01/DQB1*03:19 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 90 204
HLA-DQA1*05:01/DQB1*03:01 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 163 369
HLA-DQA1*05:01/DQB1*03:19 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 163 369
HLA-DQA1*06:01/DQB1*03:01 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 234 529
HLA-DQA1*06:01/DQB1*03:19 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 234 529
HLA-DQA1*05:01/DQB1*03:01 DISTEIYQAGSTPCNG DISTEIYQAGSKPCNG 210 473
HLA-DQA1*05:01/DQB1*03:19 DISTEIYQAGSTPCNG DISTEIYQAGSKPCNG 210 473
HLA-DQA1*04:01/DQB1*03:01 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 453 1018
HLA-DQA1*04:01/DQB1*03:19 TEIYQAGSTPCNGVEG TEIYQAGSKPCNGVEG 453 1018
HLA-DQA1*02:01/DQB1*03:01 IYQAGSTPCNGVEGFNCYFP IYQAGSKPCNGVEGFNCYFP 223 501
HLA-DQA1*02:01/DQB1*03:19 IYQAGSTPCNGVEGFNCYFP IYQAGSKPCNGVEGFNCYFP 223 501
HLA-DQA1*02:01/DQB1*03:01 ERDISTEIYQAGSTPCNG ERDISTEIYQAGSKPCNG 451 1010
HLA-DQA1*02:01/DQB1*03:19 ERDISTEIYQAGSTPCNG ERDISTEIYQAGSKPCNG 451 1010
HLA-DQA1*05:01/DQB1*03:01 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 160 358
HLA-DQA1*05:01/DQB1*03:19 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 160 358
HLA-DQA1*06:01/DQB1*03:01 TEIYQAGSTPCNGVEGFNCY TEIYQAGSKPCNGVEGFNCY 407 910
HLA-DQA1*06:01/DQB1*03:19 TEIYQAGSTPCNGVEGFNCY TEIYQAGSKPCNGVEGFNCY 407 910
HLA-DQA1*03:01/DQB1*03:01 ISTEIYQAGSTPCNGVE ISTEIYQAGSKPCNGVE 327 729
HLA-DQA1*03:01/DQB1*03:19 ISTEIYQAGSTPCNGVE ISTEIYQAGSKPCNGVE 327 729
HLA-DQA1*02:01/DQB1*03:01 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 105 234
HLA-DQA1*02:01/DQB1*03:19 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 105 234
HLA-DQA1*02:01/DQB1*03:03 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 420 936
HLA-DQA1*06:01/DQB1*03:01 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 372 829
HLA-DQA1*06:01/DQB1*03:19 STEIYQAGSTPCNGVEGFNC STEIYQAGSKPCNGVEGFNC 372 829
HLA-DQA1*03:01/DQB1*03:01 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 228 508
HLA-DQA1*03:01/DQB1*03:19 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 228 508
HLA-DQA1*05:01/DQB1*03:01 DISTEIYQAGSTPCNGV DISTEIYQAGSKPCNGV 168 373
HLA-DQA1*05:01/DQB1*03:19 DISTEIYQAGSTPCNGV DISTEIYQAGSKPCNGV 168 373
HLA-DQA1*06:01/DQB1*03:01 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 264 586
HLA-DQA1*06:01/DQB1*03:19 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 264 586
HLA-DQA1*06:01/DQB1*03:01 ISTEIYQAGSTPCNGVEGF ISTEIYQAGSKPCNGVEGF 469 1040
HLA-DQA1*06:01/DQB1*03:19 ISTEIYQAGSTPCNGVEGF ISTEIYQAGSKPCNGVEGF 469 1040
HLA-DQA1*05:01/DQB1*03:01 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 117 259
HLA-DQA1*05:01/DQB1*03:19 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 117 259
HLA-DQA1*03:01/DQB1*03:01 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 354 783
HLA-DQA1*03:01/DQB1*03:19 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 354 783
HLA-DQA1*03:01/DQB1*03:01 RDISTEIYQAGSTPCNGVE RDISTEIYQAGSKPCNGVE 435 962
HLA-DQA1*03:01/DQB1*03:19 RDISTEIYQAGSTPCNGVE RDISTEIYQAGSKPCNGVE 435 962
HLA-DQA1*06:01/DQB1*03:01 ISTEIYQAGSTPCNG ISTEIYQAGSKPCNG 375 827
HLA-DQA1*06:01/DQB1*03:19 ISTEIYQAGSTPCNG ISTEIYQAGSKPCNG 375 827
HLA-DQA1*04:01/DQB1*03:01 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 438 964
HLA-DQA1*04:01/DQB1*03:19 STEIYQAGSTPCNGVE STEIYQAGSKPCNGVE 438 964
HLA-DQA1*05:01/DQB1*03:01 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 161 353
HLA-DQA1*05:01/DQB1*03:19 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 161 353
HLA-DQA1*05:01/DQB1*03:01 YQAGSTPCNGVEGFN YQAGSKPCNGVEGFN 302 661
HLA-DQA1*05:01/DQB1*03:19 YQAGSTPCNGVEGFN YQAGSKPCNGVEGFN 302 661
HLA-DQA1*05:01/DQB1*03:01 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 91 198
HLA-DQA1*05:01/DQB1*03:19 STEIYQAGSTPCNGV STEIYQAGSKPCNGV 91 198
HLA-DQA1*05:01/DQB1*03:01 IYQAGSTPCNGVEGFNCYF IYQAGSKPCNGVEGFNCYF 471 1024
HLA-DQA1*05:01/DQB1*03:19 IYQAGSTPCNGVEGFNCYF IYQAGSKPCNGVEGFNCYF 471 1024
HLA-DQA1*05:01/DQB1*03:03 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 479 1040
HLA-DQA1*02:01/DQB1*03:01 YQAGSTPCNGVEGFNCY YQAGSKPCNGVEGFNCY 395 855
HLA-DQA1*02:01/DQB1*03:19 YQAGSTPCNGVEGFNCY YQAGSKPCNGVEGFNCY 395 855
HLA-DQA1*05:01/DQB1*03:01 PFERDISTEIYQAGSTPCNG PFERDISTEIYQAGSKPCNG 323 698
HLA-DQA1*05:01/DQB1*03:19 PFERDISTEIYQAGSTPCNG PFERDISTEIYQAGSKPCNG 323 698
HLA-DQA1*06:01/DQB1*03:01 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 351 756
HLA-DQA1*06:01/DQB1*03:19 ISTEIYQAGSTPCNGVEGFN ISTEIYQAGSKPCNGVEGFN 351 756
HLA-DQA1*03:01/DQB1*03:01 DISTEIYQAGSTPCNGV DISTEIYQAGSKPCNGV 349 751
HLA-DQA1*03:01/DQB1*03:19 DISTEIYQAGSTPCNGV DISTEIYQAGSKPCNGV 349 751
HLA-DQA1*06:01/DQB1*03:01 DISTEIYQAGSTPCNGVEG DISTEIYQAGSKPCNGVEG 465 1000
HLA-DQA1*06:01/DQB1*03:19 DISTEIYQAGSTPCNGVEG DISTEIYQAGSKPCNGVEG 465 1000
HLA-DQA1*02:01/DQB1*03:01 FERDISTEIYQAGSTPCNG FERDISTEIYQAGSKPCNG 255 547
HLA-DQA1*02:01/DQB1*03:19 FERDISTEIYQAGSTPCNG FERDISTEIYQAGSKPCNG 255 547
HLA-DQA1*05:01/DQB1*03:01 YQAGSTPCNGVEGFNC YQAGSKPCNGVEGFNC 457 980
HLA-DQA1*05:01/DQB1*03:19 YQAGSTPCNGVEGFNC YQAGSKPCNGVEGFNC 457 980
HLA-DQA1*05:01/DQB1*03:01 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 125 268
HLA-DQA1*05:01/DQB1*03:19 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 125 268
HLA-DQA1*03:01/DQB1*03:01 ERDISTEIYQAGSTPCNGV ERDISTEIYQAGSKPCNGV 489 1046
HLA-DQA1*03:01/DQB1*03:19 ERDISTEIYQAGSTPCNGV ERDISTEIYQAGSKPCNGV 489 1046
HLA-DQA1*03:01/DQB1*03:01 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 365 778
HLA-DQA1*03:01/DQB1*03:19 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 365 778
HLA-DQA1*06:01/DQB1*03:01 DISTEIYQAGSTPCNGV DISTEIYQAGSKPCNGV 367 782
HLA-DQA1*06:01/DQB1*03:19 DISTEIYQAGSTPCNGV DISTEIYQAGSKPCNGV 367 782
HLA-DQA1*03:01/DQB1*03:01 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 251 534
HLA-DQA1*03:01/DQB1*03:19 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 251 534
HLA-DQA1*05:01/DQB1*03:01 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 175 372
HLA-DQA1*05:01/DQB1*03:19 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 175 372
HLA-DQA1*05:01/DQB1*03:03 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 460 974
HLA-DQA1*02:01/DQB1*03:01 DISTEIYQAGSTPCNG DISTEIYQAGSKPCNG 150 316
HLA-DQA1*02:01/DQB1*03:19 DISTEIYQAGSTPCNG DISTEIYQAGSKPCNG 150 316
HLA-DRB1*10:01 RDISTEIYQAGSTPCNGVEG RDISTEIYQAGSKPCNGVEG 365 768
HLA-DQA1*05:01/DQB1*03:01 IYQAGSTPCNGVEGFNCYFP IYQAGSKPCNGVEGFNCYFP 363 761
HLA-DQA1*05:01/DQB1*03:19 IYQAGSTPCNGVEGFNCYFP IYQAGSKPCNGVEGFNCYFP 363 761
HLA-DQA1*06:01/DQB1*03:01 EIYQAGSTPCNGVEGFNCYF EIYQAGSKPCNGVEGFNCYF 480 1003
HLA-DQA1*06:01/DQB1*03:19 EIYQAGSTPCNGVEGFNCYF EIYQAGSKPCNGVEGFNCYF 480 1003
HLA-DQA1*02:01/DQB1*03:01 FERDISTEIYQAGSTPCNGV FERDISTEIYQAGSKPCNGV 121 252
HLA-DQA1*02:01/DQB1*03:19 FERDISTEIYQAGSTPCNGV FERDISTEIYQAGSKPCNGV 121 252
HLA-DQA1*06:01/DQB1*03:01 DISTEIYQAGSTPCNG DISTEIYQAGSKPCNG 401 832
HLA-DQA1*06:01/DQB1*03:19 DISTEIYQAGSTPCNG DISTEIYQAGSKPCNG 401 832
HLA-DQA1*06:01/DQB1*03:01 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 341 704
HLA-DQA1*06:01/DQB1*03:19 DISTEIYQAGSTPCNGVEGF DISTEIYQAGSKPCNGVEGF 341 704
HLA-DQA1*06:01/DQB1*03:01 RDISTEIYQAGSTPCNGVE RDISTEIYQAGSKPCNGVE 458 945
HLA-DQA1*06:01/DQB1*03:19 RDISTEIYQAGSTPCNGVE RDISTEIYQAGSKPCNGVE 458 945
HLA-DQA1*05:01/DQB1*03:01 FERDISTEIYQAGSTPCNGV FERDISTEIYQAGSKPCNGV 206 425
HLA-DQA1*05:01/DQB1*03:19 FERDISTEIYQAGSTPCNGV FERDISTEIYQAGSKPCNGV 206 425
HLA-DQA1*06:01/DQB1*03:01 ERDISTEIYQAGSTPCNGV ERDISTEIYQAGSKPCNGV 484 998
HLA-DQA1*06:01/DQB1*03:19 ERDISTEIYQAGSTPCNGV ERDISTEIYQAGSKPCNGV 484 998
HLA-DRB1*10:01 ERDISTEIYQAGSTPCNGVE ERDISTEIYQAGSKPCNGVE 350 719
HLA-DQA1*02:01/DQB1*03:01 PFERDISTEIYQAGSTPCNG PFERDISTEIYQAGSKPCNG 191 391
HLA-DQA1*02:01/DQB1*03:19 PFERDISTEIYQAGSTPCNG PFERDISTEIYQAGSKPCNG 191 391
HLA-DQA1*04:01/DQB1*03:01 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 495 1008
HLA-DQA1*04:01/DQB1*03:19 ISTEIYQAGSTPCNGV ISTEIYQAGSKPCNGV 495 1008
HLA-DQA1*05:01/DQB1*03:03 FERDISTEIYQAGSTPCNGV FERDISTEIYQAGSKPCNGV 473 950
HLA-DQA1*03:01/DQB1*03:01 FERDISTEIYQAGSTPCNGV FERDISTEIYQAGSKPCNGV 410 822
HLA-DQA1*03:01/DQB1*03:19 FERDISTEIYQAGSTPCNGV FERDISTEIYQAGSKPCNGV 410 822
HLA-DQA1*03:01/DQB1*03:01 DISTEIYQAGSTPCNG DISTEIYQAGSKPCNG 377 754
HLA-DQA1*03:01/DQB1*03:19 DISTEIYQAGSTPCNG DISTEIYQAGSKPCNG 377 754

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 533 192
HLA-DRB1*01:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 521 192
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 328 123
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 889 335
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTE NTSNQVAVLYQGVNCTE 281 107
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 677 258
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 243 93
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 227 87
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 130 50
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 403 155
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 136 53
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 228 89
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 176 69
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 181 71
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 150 59
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 167 66
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 200 80
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQD TPGTNTSNQVAVLYQG 276 112
HLA-DRB1*01:01 VAVLYQDVNCTEVPV VAVLYQGVNCTEVPV 347 141
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEV NTSNQVAVLYQGVNCTEV 639 263
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 413 170
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVN TPGTNTSNQVAVLYQGVN 376 155
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQD ITPGTNTSNQVAVLYQG 339 140
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVA QVAVLYQGVNCTEVPVA 814 340
HLA-DRB1*01:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 867 365
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDV ITPGTNTSNQVAVLYQGV 435 184
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDVN ITPGTNTSNQVAVLYQGVN 229 97
HLA-DQA1*01:03/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 960 408
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPV NQVAVLYQGVNCTEVPV 799 340
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 176 75
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCT TNTSNQVAVLYQGVNCT 211 90
HLA-DRB1*01:01 VAVLYQDVNCTEVPVAI VAVLYQGVNCTEVPVAI 996 428
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 292 126
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 417 181
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 852 370
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 312 136
HLA-DRB1*01:01 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 699 305
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNC GTNTSNQVAVLYQGVNC 197 86
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVP NTSNQVAVLYQGVNCTEVP 412 180
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVP TSNQVAVLYQGVNCTEVP 908 399
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 450 198
HLA-DRB1*01:01 QVAVLYQDVNCTEVP QVAVLYQGVNCTEVP 285 126
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 530 235
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDVN VITPGTNTSNQVAVLYQGVN 189 84
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDV VITPGTNTSNQVAVLYQGV 270 121
HLA-DRB1*01:01 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 450 202
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 597 268
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 838 380
HLA-DRB1*01:01 VAVLYQDVNCTEVPVA VAVLYQGVNCTEVPVA 1017 462
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 801 365
HLA-DRB1*10:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 910 416
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVA SNQVAVLYQGVNCTEVPVA 979 449
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 365 168
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 447 206
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVNC PGTNTSNQVAVLYQGVNC 425 196
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 471 218
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTE TNTSNQVAVLYQGVNCTE 477 221
HLA-DRB1*01:01 QVAVLYQDVNCTEVPV QVAVLYQGVNCTEVPV 855 397
HLA-DRB1*01:01 NQVAVLYQDVNCTEV NQVAVLYQGVNCTEV 253 118
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPVA TSNQVAVLYQGVNCTEVPVA 488 228
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNCT GTNTSNQVAVLYQGVNCT 436 204
HLA-DQA1*02:01/DQB1*03:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DQA1*02:01/DQB1*03:19 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DRB1*01:01 NQVAVLYQDVNCTEVP NQVAVLYQGVNCTEVP 887 416
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAI NQVAVLYQGVNCTEVPVAI 991 467
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 984 467
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 485 231
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 641 306
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIH QVAVLYQGVNCTEVPVAIH 1021 488
HLA-DPA1*03:01/DPB1*04:01 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 307 635
HLA-DRB1*01:01 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 850 411
HLA-DRB1*01:01 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 502 243
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVAI SNQVAVLYQGVNCTEVPVAI 481 235
HLA-DQA1*01:02/DQB1*06:02 SVITPGTNTSNQVAVLYQDV SVITPGTNTSNQVAVLYQGV 231 113
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAIH NQVAVLYQGVNCTEVPVAIH 483 237
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 936 460
HLA-DQA1*01:03/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 493 243
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTEV TNTSNQVAVLYQGVNCTEV 298 147
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVNC TPGTNTSNQVAVLYQGVNC 254 126
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQD VITPGTNTSNQVAVLYQG 681 338
HLA-DRB1*01:01 TNTSNQVAVLYQDVNCTEVP TNTSNQVAVLYQGVNCTEVP 523 260
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIHA QVAVLYQGVNCTEVPVAIHA 502 251

P681R

Reference  VNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVA
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    VNNSYECDIPIGAGICASYQTQTNSRRRARSVASQSIIAYTMSLGAENSVA

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*01:03/DPB1*03:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 2758 405
HLA-DQA1*05:01/DQB1*03:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 202 1295
HLA-DQA1*05:01/DQB1*03:19 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 202 1295
HLA-DQA1*02:01/DQB1*03:01 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 123 783
HLA-DQA1*02:01/DQB1*03:19 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 123 783
HLA-DQA1*02:01/DQB1*03:01 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 149 914
HLA-DQA1*02:01/DQB1*03:19 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 149 914
HLA-DQA1*02:01/DQB1*03:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 120 729
HLA-DQA1*02:01/DQB1*03:19 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 120 729
HLA-DQA1*02:01/DQB1*03:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 105 636
HLA-DQA1*02:01/DQB1*03:19 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 105 636
HLA-DQA1*05:01/DQB1*03:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 168 1012
HLA-DQA1*05:01/DQB1*03:19 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 168 1012
HLA-DQA1*02:01/DQB1*03:01 SYQTQTNSPRRARSVAS SYQTQTNSRRRARSVAS 180 1071
HLA-DQA1*02:01/DQB1*03:19 SYQTQTNSPRRARSVAS SYQTQTNSRRRARSVAS 180 1071
HLA-DQA1*02:01/DQB1*03:01 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 142 829
HLA-DQA1*02:01/DQB1*03:19 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 142 829
HLA-DQA1*05:01/DQB1*03:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 134 749
HLA-DQA1*05:01/DQB1*03:19 QTNSPRRARSVASQS QTNSRRRARSVASQS 134 749
HLA-DPA1*01:03/DPB1*03:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 1810 324
HLA-DQA1*02:01/DQB1*03:01 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 201 1100
HLA-DQA1*02:01/DQB1*03:19 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 201 1100
HLA-DQA1*05:01/DQB1*03:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 168 916
HLA-DQA1*05:01/DQB1*03:19 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 168 916
HLA-DQA1*02:01/DQB1*03:01 CASYQTQTNSPRRARSVAS CASYQTQTNSRRRARSVAS 254 1358
HLA-DQA1*02:01/DQB1*03:19 CASYQTQTNSPRRARSVAS CASYQTQTNSRRRARSVAS 254 1358
HLA-DQA1*02:01/DQB1*03:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 95 493
HLA-DQA1*02:01/DQB1*03:19 QTNSPRRARSVASQS QTNSRRRARSVASQS 95 493
HLA-DQA1*05:01/DQB1*03:01 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 288 1480
HLA-DQA1*05:01/DQB1*03:19 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 288 1480
HLA-DQA1*02:01/DQB1*03:03 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 465 2360
HLA-DQA1*02:01/DQB1*03:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 171 863
HLA-DQA1*02:01/DQB1*03:19 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 171 863
HLA-DQA1*02:01/DQB1*03:01 SYQTQTNSPRRARSVASQ SYQTQTNSRRRARSVASQ 332 1665
HLA-DQA1*02:01/DQB1*03:19 SYQTQTNSPRRARSVASQ SYQTQTNSRRRARSVASQ 332 1665
HLA-DRB1*11:04 YQTQTNSPRRARSVA YQTQTNSRRRARSVA 912 182
HLA-DQA1*02:01/DQB1*03:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 135 675
HLA-DQA1*02:01/DQB1*03:19 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 135 675
HLA-DQA1*05:01/DQB1*03:01 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 247 1228
HLA-DQA1*05:01/DQB1*03:19 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 247 1228
HLA-DQA1*02:01/DQB1*03:01 SYQTQTNSPRRARSV SYQTQTNSRRRARSV 449 2230
HLA-DQA1*02:01/DQB1*03:19 SYQTQTNSPRRARSV SYQTQTNSRRRARSV 449 2230
HLA-DQA1*05:01/DQB1*03:01 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 290 1438
HLA-DQA1*05:01/DQB1*03:19 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 290 1438
HLA-DRB1*11:04 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 1281 259
HLA-DPA1*01:03/DPB1*14:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 2085 422
HLA-DQA1*02:01/DQB1*03:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 109 531
HLA-DQA1*02:01/DQB1*03:19 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 109 531
HLA-DQA1*06:01/DQB1*03:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 425 2059
HLA-DQA1*06:01/DQB1*03:19 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 425 2059
HLA-DQA1*02:01/DQB1*03:01 ASYQTQTNSPRRARSVAS ASYQTQTNSRRRARSVAS 399 1916
HLA-DQA1*02:01/DQB1*03:19 ASYQTQTNSPRRARSVAS ASYQTQTNSRRRARSVAS 399 1916
HLA-DRB1*11:04 SYQTQTNSPRRARSV SYQTQTNSRRRARSV 903 189
HLA-DQA1*02:01/DQB1*03:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 175 832
HLA-DQA1*02:01/DQB1*03:19 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 175 832
HLA-DPA1*04:01/DPB1*03:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 1382 291
HLA-DQA1*06:01/DQB1*03:01 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 491 2290
HLA-DQA1*06:01/DQB1*03:19 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 491 2290
HLA-DQA1*06:01/DQB1*03:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 413 1922
HLA-DQA1*06:01/DQB1*03:19 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 413 1922
HLA-DQA1*06:01/DQB1*03:01 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 496 2289
HLA-DQA1*06:01/DQB1*03:19 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 496 2289
HLA-DQA1*02:01/DQB1*03:01 ICASYQTQTNSPRRARSVAS ICASYQTQTNSRRRARSVAS 219 996
HLA-DQA1*02:01/DQB1*03:19 ICASYQTQTNSPRRARSVAS ICASYQTQTNSRRRARSVAS 219 996
HLA-DPA1*04:01/DPB1*03:01 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 1336 294
HLA-DQA1*05:01/DQB1*03:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 237 1075
HLA-DQA1*05:01/DQB1*03:19 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 237 1075
HLA-DQA1*02:01/DQB1*03:03 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 469 2105
HLA-DPA1*04:01/DPB1*03:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 1445 323
HLA-DQA1*02:01/DQB1*03:01 YQTQTNSPRRARSVA YQTQTNSRRRARSVA 498 2196
HLA-DQA1*02:01/DQB1*03:19 YQTQTNSPRRARSVA YQTQTNSRRRARSVA 498 2196
HLA-DQA1*05:01/DQB1*03:01 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 446 1945
HLA-DQA1*05:01/DQB1*03:19 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 446 1945
HLA-DRB1*11:04 ASYQTQTNSPRRARSVA ASYQTQTNSRRRARSVA 1434 330
HLA-DQA1*02:01/DQB1*03:01 YQTQTNSPRRARSVASQS YQTQTNSRRRARSVASQS 303 1307
HLA-DQA1*02:01/DQB1*03:19 YQTQTNSPRRARSVASQS YQTQTNSRRRARSVASQS 303 1307
HLA-DRB1*11:04 ASYQTQTNSPRRARS ASYQTQTNSRRRARS 1113 259
HLA-DQA1*05:01/DQB1*03:03 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 472 2017
HLA-DRB1*11:04 CASYQTQTNSPRRARSV CASYQTQTNSRRRARSV 1616 380
HLA-DQA1*05:01/DQB1*03:01 SYQTQTNSPRRARSVAS SYQTQTNSRRRARSVAS 403 1709
HLA-DQA1*05:01/DQB1*03:19 SYQTQTNSPRRARSVAS SYQTQTNSRRRARSVAS 403 1709
HLA-DPA1*04:01/DPB1*03:01 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 1692 400
HLA-DQA1*02:01/DQB1*03:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 147 621
HLA-DQA1*02:01/DQB1*03:19 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 147 621
HLA-DRB1*11:01 YQTQTNSPRRARSVA YQTQTNSRRRARSVA 1740 414
HLA-DRB1*11:04 SYQTQTNSPRRARSVA SYQTQTNSRRRARSVA 1916 457
HLA-DPA1*04:01/DPB1*03:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 976 234
HLA-DRB1*11:04 GICASYQTQTNSPRRARSVA GICASYQTQTNSRRRARSVA 1241 299
HLA-DQA1*05:01/DQB1*03:03 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 442 1808
HLA-DQA1*05:01/DQB1*03:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 365 1486
HLA-DQA1*05:01/DQB1*03:19 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 365 1486
HLA-DRB1*11:04 SYQTQTNSPRRARSVAS SYQTQTNSRRRARSVAS 1392 345
HLA-DRB1*11:04 ICASYQTQTNSPRRARSVAS ICASYQTQTNSRRRARSVAS 1131 282
HLA-DQA1*05:01/DQB1*03:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 107 429
HLA-DQA1*05:01/DQB1*03:19 TNSPRRARSVASQSI TNSRRRARSVASQSI 107 429
HLA-DRB1*11:04 AGICASYQTQTNSPRRARSV AGICASYQTQTNSRRRARSV 1419 357
HLA-DRB1*11:04 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 1929 486
HLA-DQA1*06:01/DQB1*03:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 358 1412
HLA-DQA1*06:01/DQB1*03:19 QTNSPRRARSVASQS QTNSRRRARSVASQS 358 1412
HLA-DRB1*11:04 CASYQTQTNSPRRAR CASYQTQTNSRRRAR 1381 351
HLA-DQA1*06:01/DQB1*03:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 375 1467
HLA-DQA1*06:01/DQB1*03:19 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 375 1467
HLA-DQA1*05:01/DQB1*03:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 125 488
HLA-DQA1*05:01/DQB1*03:19 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 125 488
HLA-DRB1*11:04 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 1080 278
HLA-DPA1*04:01/DPB1*03:01 ICASYQTQTNSPRRARSVAS ICASYQTQTNSRRRARSVAS 1621 418
HLA-DPA1*04:01/DPB1*14:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 1379 356
HLA-DQA1*05:01/DQB1*03:03 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 475 1780
HLA-DPA1*04:01/DPB1*06:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 1413 382
HLA-DRB1*11:04 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 1019 276
HLA-DPA1*04:01/DPB1*06:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 1477 404
HLA-DRB1*11:02 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 901 247
HLA-DRB1*13:01 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 901 247
HLA-DQA1*05:01/DQB1*03:03 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 419 1527
HLA-DRB1*11:04 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 1384 380
HLA-DRB1*11:01 SYQTQTNSPRRARSV SYQTQTNSRRRARSV 1303 360
HLA-DRB1*11:04 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 979 271
HLA-DPA1*04:01/DPB1*06:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 1070 297
HLA-DQA1*05:01/DQB1*03:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 423 1518
HLA-DQA1*05:01/DQB1*03:19 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 423 1518
HLA-DRB1*11:04 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 1337 374
HLA-DQA1*02:01/DQB1*03:03 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 447 1589
HLA-DPA1*04:01/DPB1*06:01 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 1447 409
HLA-DRB1*11:02 QTNSPRRARSVASQS QTNSRRRARSVASQS 1639 464
HLA-DRB1*13:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 1639 464
HLA-DRB1*11:02 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 1142 333
HLA-DRB1*13:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 1142 333
HLA-DQA1*02:01/DQB1*03:03 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 465 1587
HLA-DQA1*05:01/DQB1*03:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 174 586
HLA-DQA1*05:01/DQB1*03:19 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 174 586
HLA-DRB1*11:04 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 974 290
HLA-DRB1*11:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 1338 399
HLA-DQA1*05:01/DQB1*03:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 327 1093
HLA-DQA1*05:01/DQB1*03:19 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 327 1093
HLA-DRB1*11:02 SYQTQTNSPRRARSVAS SYQTQTNSRRRARSVAS 1047 315
HLA-DRB1*13:01 SYQTQTNSPRRARSVAS SYQTQTNSRRRARSVAS 1047 315
HLA-DRB1*11:02 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 1206 367
HLA-DRB1*13:01 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 1206 367
HLA-DQA1*03:01/DQB1*03:01 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 450 1477
HLA-DQA1*03:01/DQB1*03:19 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 450 1477
HLA-DPA1*04:01/DPB1*14:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 954 291
HLA-DRB1*11:02 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 1567 479
HLA-DRB1*13:01 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 1567 479
HLA-DRB1*11:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 1371 421
HLA-DRB1*11:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 1320 407
HLA-DPA1*04:01/DPB1*14:01 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 1601 496
HLA-DQA1*05:01/DQB1*03:01 QTQTNSPRRARSVASQSI QTQTNSRRRARSVASQSI 375 1203
HLA-DQA1*05:01/DQB1*03:19 QTQTNSPRRARSVASQSI QTQTNSRRRARSVASQSI 375 1203
HLA-DPA1*04:01/DPB1*14:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 1385 432
HLA-DPA1*04:01/DPB1*14:01 ICASYQTQTNSPRRARSVAS ICASYQTQTNSRRRARSVAS 1468 458
HLA-DRB1*11:02 YQTQTNSPRRARSVA YQTQTNSRRRARSVA 570 178
HLA-DRB1*13:01 YQTQTNSPRRARSVA YQTQTNSRRRARSVA 570 178
HLA-DQA1*03:01/DQB1*03:01 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 478 1526
HLA-DQA1*03:01/DQB1*03:19 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 478 1526
HLA-DQA1*05:01/DQB1*03:03 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 404 1285
HLA-DQA1*03:01/DQB1*03:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 411 1305
HLA-DQA1*03:01/DQB1*03:19 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 411 1305
HLA-DRB1*11:02 ASYQTQTNSPRRARSVA ASYQTQTNSRRRARSVA 982 311
HLA-DRB1*13:01 ASYQTQTNSPRRARSVA ASYQTQTNSRRRARSVA 982 311
HLA-DQA1*05:01/DQB1*03:03 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 439 1384
HLA-DQA1*05:01/DQB1*03:01 TNSPRRARSVASQSII TNSRRRARSVASQSII 129 405
HLA-DQA1*05:01/DQB1*03:19 TNSPRRARSVASQSII TNSRRRARSVASQSII 129 405
HLA-DRB1*08:04 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 1459 465
HLA-DRB1*11:02 SYQTQTNSPRRARSV SYQTQTNSRRRARSV 513 165
HLA-DRB1*13:01 SYQTQTNSPRRARSV SYQTQTNSRRRARSV 513 165
HLA-DQA1*02:01/DQB1*03:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 118 365
HLA-DQA1*02:01/DQB1*03:19 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 118 365
HLA-DRB1*11:01 ICASYQTQTNSPRRARSVAS ICASYQTQTNSRRRARSVAS 1365 443
HLA-DRB1*11:02 SYQTQTNSPRRARSVA SYQTQTNSRRRARSVA 1334 437
HLA-DRB1*13:01 SYQTQTNSPRRARSVA SYQTQTNSRRRARSVA 1334 437
HLA-DRB1*11:02 CASYQTQTNSPRRARSV CASYQTQTNSRRRARSV 1090 358
HLA-DRB1*13:01 CASYQTQTNSPRRARSV CASYQTQTNSRRRARSV 1090 358
HLA-DQA1*05:01/DQB1*03:03 QTNSPRRARSVASQS QTNSRRRARSVASQS 385 1172
HLA-DRB1*08:04 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 1290 424
HLA-DQA1*02:01/DQB1*03:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 72 219
HLA-DQA1*02:01/DQB1*03:19 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 72 219
HLA-DRB1*11:02 ICASYQTQTNSPRRA ICASYQTQTNSRRRA 1249 411
HLA-DRB1*13:01 ICASYQTQTNSPRRA ICASYQTQTNSRRRA 1249 411
HLA-DQA1*02:01/DQB1*03:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 63 191
HLA-DQA1*02:01/DQB1*03:19 TNSPRRARSVASQSI TNSRRRARSVASQSI 63 191
HLA-DQA1*03:01/DQB1*03:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 407 1229
HLA-DQA1*03:01/DQB1*03:19 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 407 1229
HLA-DQA1*05:01/DQB1*03:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 270 815
HLA-DQA1*05:01/DQB1*03:19 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 270 815
HLA-DRB1*11:02 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 745 247
HLA-DRB1*13:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 745 247
HLA-DQA1*02:01/DQB1*06:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 300 903
HLA-DRB1*11:01 ASYQTQTNSPRRARS ASYQTQTNSRRRARS 1184 394
HLA-DRB1*11:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 1315 438
HLA-DQA1*02:01/DQB1*03:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 91 272
HLA-DQA1*02:01/DQB1*03:19 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 91 272
HLA-DRB1*08:04 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 1063 356
HLA-DRB1*11:02 ASYQTQTNSPRRARS ASYQTQTNSRRRARS 600 201
HLA-DRB1*13:01 ASYQTQTNSPRRARS ASYQTQTNSRRRARS 600 201
HLA-DPA1*01:03/DPB1*03:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 483 162
HLA-DPA1*04:01/DPB1*14:01 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 1256 423
HLA-DRB1*11:04 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 1065 359
HLA-DRB1*11:02 ICASYQTQTNSPRRARS ICASYQTQTNSRRRARS 1408 475
HLA-DRB1*13:01 ICASYQTQTNSPRRARS ICASYQTQTNSRRRARS 1408 475
HLA-DRB1*11:02 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 738 250
HLA-DRB1*13:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 738 250
HLA-DQA1*02:01/DQB1*06:01 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 381 1117
HLA-DRB1*11:02 ASYQTQTNSPRRARSV ASYQTQTNSRRRARSV 1265 432
HLA-DRB1*13:01 ASYQTQTNSPRRARSV ASYQTQTNSRRRARSV 1265 432
HLA-DPA1*01:03/DPB1*03:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 816 280
HLA-DQA1*02:01/DQB1*03:01 QTQTNSPRRARSVASQSI QTQTNSRRRARSVASQSI 195 568
HLA-DQA1*02:01/DQB1*03:19 QTQTNSPRRARSVASQSI QTQTNSRRRARSVASQSI 195 568
HLA-DQA1*02:01/DQB1*06:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 385 1117
HLA-DRB1*11:02 ICASYQTQTNSPRRARSVAS ICASYQTQTNSRRRARSVAS 749 259
HLA-DRB1*13:01 ICASYQTQTNSPRRARSVAS ICASYQTQTNSRRRARSVAS 749 259
HLA-DQA1*05:01/DQB1*03:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 173 500
HLA-DQA1*05:01/DQB1*03:19 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 173 500
HLA-DRB1*11:01 GICASYQTQTNSPRRARSVA GICASYQTQTNSRRRARSVA 1397 484
HLA-DQA1*02:01/DQB1*03:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 101 290
HLA-DQA1*02:01/DQB1*03:19 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 101 290
HLA-DPA1*01:03/DPB1*03:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 614 214
HLA-DRB1*11:02 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 725 254
HLA-DRB1*13:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 725 254
HLA-DQA1*02:01/DQB1*06:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 283 802
HLA-DRB1*11:02 GICASYQTQTNSPRRARSVA GICASYQTQTNSRRRARSVA 802 283
HLA-DRB1*13:01 GICASYQTQTNSPRRARSVA GICASYQTQTNSRRRARSVA 802 283
HLA-DRB1*11:02 CASYQTQTNSPRRAR CASYQTQTNSRRRAR 699 247
HLA-DRB1*13:01 CASYQTQTNSPRRAR CASYQTQTNSRRRAR 699 247
HLA-DRB1*11:02 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 1318 466
HLA-DRB1*13:01 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 1318 466
HLA-DRB1*11:02 GAGICASYQTQTNSPRRARS GAGICASYQTQTNSRRRARS 1149 407
HLA-DRB1*13:01 GAGICASYQTQTNSPRRARS GAGICASYQTQTNSRRRARS 1149 407
HLA-DQA1*05:01/DQB1*03:01 NSPRRARSVASQSII NSRRRARSVASQSII 135 380
HLA-DQA1*05:01/DQB1*03:19 NSPRRARSVASQSII NSRRRARSVASQSII 135 380
HLA-DRB1*11:02 AGICASYQTQTNSPRRARSV AGICASYQTQTNSRRRARSV 880 313
HLA-DRB1*13:01 AGICASYQTQTNSPRRARSV AGICASYQTQTNSRRRARSV 880 313
HLA-DQA1*02:01/DQB1*06:01 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 403 1129
HLA-DQA1*03:01/DQB1*03:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 471 1313
HLA-DQA1*03:01/DQB1*03:19 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 471 1313
HLA-DRB1*11:01 CASYQTQTNSPRRAR CASYQTQTNSRRRAR 1341 484
HLA-DQA1*05:01/DQB1*03:01 TQTNSPRRARSVASQSII TQTNSRRRARSVASQSII 369 1022
HLA-DQA1*05:01/DQB1*03:19 TQTNSPRRARSVASQSII TQTNSRRRARSVASQSII 369 1022
HLA-DQA1*02:01/DQB1*06:01 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 458 1267
HLA-DRB1*08:04 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 957 346
HLA-DRB1*11:02 CASYQTQTNSPRRARSVAS CASYQTQTNSRRRARSVAS 1332 487
HLA-DRB1*13:01 CASYQTQTNSPRRARSVAS CASYQTQTNSRRRARSVAS 1332 487
HLA-DRB1*11:01 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 1351 495
HLA-DQA1*03:01/DQB1*03:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 482 1301
HLA-DQA1*03:01/DQB1*03:19 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 482 1301
HLA-DPA1*01:03/DPB1*03:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 232 86
HLA-DQA1*02:01/DQB1*06:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 362 976
HLA-DQA1*05:01/DQB1*06:01 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 391 1053
HLA-DPA1*01:03/DPB1*03:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 346 129
HLA-DQA1*05:01/DQB1*06:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 470 1260
HLA-DPA1*02:02/DPB1*03:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 1193 446
HLA-DPA1*01:03/DPB1*03:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 347 130
HLA-DQA1*05:01/DQB1*06:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 344 917
HLA-DQA1*02:01/DQB1*06:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 439 1160
HLA-DRB1*11:02 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 749 284
HLA-DRB1*13:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 749 284
HLA-DQA1*05:01/DQB1*03:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 266 700
HLA-DQA1*05:01/DQB1*03:19 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 266 700
HLA-DQA1*02:01/DQB1*06:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 356 935
HLA-DRB1*11:02 TNSPRRARSVASQSI TNSRRRARSVASQSI 1036 395
HLA-DRB1*13:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 1036 395
HLA-DQA1*03:01/DQB1*03:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 392 1025
HLA-DQA1*03:01/DQB1*03:19 QTNSPRRARSVASQS QTNSRRRARSVASQS 392 1025
HLA-DQA1*05:01/DQB1*06:01 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 488 1274
HLA-DQA1*05:01/DQB1*03:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 243 633
HLA-DQA1*05:01/DQB1*03:19 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 243 633
HLA-DQA1*02:01/DQB1*03:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 115 299
HLA-DQA1*02:01/DQB1*03:19 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 115 299
HLA-DQA1*02:01/DQB1*06:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 336 872
HLA-DQA1*03:01/DQB1*03:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 377 978
HLA-DQA1*03:01/DQB1*03:19 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 377 978
HLA-DQA1*05:01/DQB1*06:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 417 1080
HLA-DPA1*01:03/DPB1*03:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 535 207
HLA-DPA1*01:03/DPB1*14:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 526 204
HLA-DRB1*11:02 IGAGICASYQTQTNSPRRAR IGAGICASYQTQTNSRRRAR 1273 494
HLA-DRB1*13:01 IGAGICASYQTQTNSPRRAR IGAGICASYQTQTNSRRRAR 1273 494
HLA-DQA1*06:01/DQB1*03:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 253 650
HLA-DQA1*06:01/DQB1*03:19 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 253 650
HLA-DPA1*01:03/DPB1*03:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 272 106
HLA-DPA1*01:03/DPB1*14:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 1125 440
HLA-DQA1*06:01/DQB1*03:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 232 592
HLA-DQA1*06:01/DQB1*03:19 TNSPRRARSVASQSI TNSRRRARSVASQSI 232 592
HLA-DQA1*05:01/DQB1*06:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 462 1175
HLA-DPA1*02:02/DPB1*14:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 737 290
HLA-DRB1*11:02 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 811 321
HLA-DRB1*13:01 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 811 321
HLA-DPA1*02:02/DPB1*03:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 912 363
HLA-DQA1*01:03/DQB1*06:01 SYQTQTNSPRRARSV SYQTQTNSRRRARSV 426 1070
HLA-DPA1*04:01/DPB1*03:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 442 176
HLA-DQA1*02:01/DQB1*06:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 489 1226
HLA-DPA1*02:02/DPB1*14:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 802 321
HLA-DPA1*01:03/DPB1*06:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 1044 418
HLA-DPA1*01:03/DPB1*14:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 653 262
HLA-DRB1*08:04 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 899 363
HLA-DPA1*01:03/DPB1*06:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 777 315
HLA-DPA1*01:03/DPB1*03:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 143 58
HLA-DRB1*08:04 TNSPRRARSVASQSI TNSRRRARSVASQSI 1225 497
HLA-DPA1*04:01/DPB1*03:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 340 138
HLA-DQA1*02:01/DQB1*03:01 TNSPRRARSVASQSII TNSRRRARSVASQSII 70 172
HLA-DQA1*02:01/DQB1*03:19 TNSPRRARSVASQSII TNSRRRARSVASQSII 70 172
HLA-DQA1*02:01/DQB1*03:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 98 240
HLA-DQA1*02:01/DQB1*03:19 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 98 240
HLA-DPA1*02:01/DPB1*14:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 956 392
HLA-DQA1*02:01/DQB1*03:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 90 217
HLA-DQA1*02:01/DQB1*03:19 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 90 217
HLA-DPA1*02:02/DPB1*14:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 953 396
HLA-DPA1*04:01/DPB1*06:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 344 143
HLA-DQA1*01:03/DQB1*06:01 YQTQTNSPRRARSVA YQTQTNSRRRARSVA 443 1064
HLA-DPA1*01:03/DPB1*14:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 492 205
HLA-DQA1*05:01/DQB1*03:01 TNSPRRARSVASQSIIA TNSRRRARSVASQSIIA 169 403
HLA-DQA1*05:01/DQB1*03:19 TNSPRRARSVASQSIIA TNSRRRARSVASQSIIA 169 403
HLA-DPA1*01:03/DPB1*14:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 833 350
HLA-DPA1*02:02/DPB1*14:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 933 393
HLA-DPA1*01:03/DPB1*14:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 325 137
HLA-DPA1*01:03/DPB1*03:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 206 87
HLA-DPA1*01:03/DPB1*06:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 1150 486
HLA-DQA1*05:01/DQB1*03:01 QTNSPRRARSVASQSIIA QTNSRRRARSVASQSIIA 355 840
HLA-DQA1*05:01/DQB1*03:19 QTNSPRRARSVASQSIIA QTNSRRRARSVASQSIIA 355 840
HLA-DQA1*05:01/DQB1*06:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 470 1110
HLA-DQA1*03:01/DQB1*03:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 450 1061
HLA-DQA1*03:01/DQB1*03:19 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 450 1061
HLA-DQA1*05:01/DQB1*03:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 235 554
HLA-DQA1*05:01/DQB1*03:19 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 235 554
HLA-DPA1*01:03/DPB1*06:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 498 212
HLA-DQA1*03:01/DQB1*03:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 392 918
HLA-DQA1*03:01/DQB1*03:19 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 392 918
HLA-DPA1*04:01/DPB1*03:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 297 127
HLA-DPA1*03:01/DPB1*14:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 1044 447
HLA-DPA1*04:01/DPB1*03:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 233 100
HLA-DPA1*03:01/DPB1*03:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 731 314
HLA-DPA1*01:03/DPB1*03:01 NSPRRARSVASQSII NSRRRARSVASQSII 142 61
HLA-DPA1*01:03/DPB1*03:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 258 111
HLA-DPA1*01:03/DPB1*06:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 336 145
HLA-DQA1*06:01/DQB1*03:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 357 827
HLA-DQA1*06:01/DQB1*03:19 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 357 827
HLA-DQA1*02:01/DQB1*03:01 TQTNSPRRARSVASQSII TQTNSRRRARSVASQSII 190 440
HLA-DQA1*02:01/DQB1*03:19 TQTNSPRRARSVASQSII TQTNSRRRARSVASQSII 190 440
HLA-DQA1*02:01/DQB1*03:01 NSPRRARSVASQSII NSRRRARSVASQSII 68 157
HLA-DQA1*02:01/DQB1*03:19 NSPRRARSVASQSII NSRRRARSVASQSII 68 157
HLA-DPA1*04:01/DPB1*06:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 587 255
HLA-DQA1*05:01/DQB1*03:01 TQTNSPRRARSVASQSIIA TQTNSRRRARSVASQSIIA 259 595
HLA-DQA1*05:01/DQB1*03:19 TQTNSPRRARSVASQSIIA TQTNSRRRARSVASQSIIA 259 595
HLA-DPA1*04:01/DPB1*03:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 232 101
HLA-DPA1*01:03/DPB1*06:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 726 317
HLA-DPA1*01:03/DPB1*14:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 226 99
HLA-DPA1*01:03/DPB1*06:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 1131 497
HLA-DRB1*10:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 879 387
HLA-DPA1*04:01/DPB1*06:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 429 189
HLA-DQA1*06:01/DQB1*03:01 TNSPRRARSVASQSII TNSRRRARSVASQSII 239 542
HLA-DQA1*06:01/DQB1*03:19 TNSPRRARSVASQSII TNSRRRARSVASQSII 239 542
HLA-DPA1*04:01/DPB1*03:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 183 81
HLA-DPA1*04:01/DPB1*14:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 400 178
HLA-DPA1*03:01/DPB1*03:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 860 383
HLA-DPA1*04:01/DPB1*10:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 792 353
HLA-DPA1*01:03/DPB1*03:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 166 74
HLA-DPA1*04:01/DPB1*03:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 305 136
HLA-DRB1*11:04 TQTNSPRRARSVASQSIIAY TQTNSRRRARSVASQSIIAY 925 413
HLA-DRB1*10:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 525 235
HLA-DPA1*01:03/DPB1*14:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 402 180
HLA-DPA1*02:02/DPB1*03:01 TNSPRRARSVASQSII TNSRRRARSVASQSII 825 370
HLA-DPA1*04:01/DPB1*06:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 452 203
HLA-DPA1*02:01/DPB1*14:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 875 393
HLA-DPA1*02:01/DPB1*03:01 TNSPRRARSVASQSIIA TNSRRRARSVASQSIIA 926 417
HLA-DPA1*01:03/DPB1*03:01 TQTNSPRRARSVASQSIIA TQTNSRRRARSVASQSIIA 162 73
HLA-DPA1*03:01/DPB1*14:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 782 353
HLA-DPA1*02:01/DPB1*03:01 NSPRRARSVASQSII NSRRRARSVASQSII 1098 496
HLA-DPA1*04:01/DPB1*10:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 995 450
HLA-DPA1*01:03/DPB1*03:01 SPRRARSVASQSIIA SRRRARSVASQSIIA 117 53
HLA-DPA1*01:03/DPB1*17:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 929 421
HLA-DPA1*02:02/DPB1*03:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 578 262
HLA-DPA1*01:03/DPB1*06:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 531 241
HLA-DQA1*05:01/DQB1*03:01 NSPRRARSVASQSIIA NSRRRARSVASQSIIA 151 332
HLA-DQA1*05:01/DQB1*03:19 NSPRRARSVASQSIIA NSRRRARSVASQSIIA 151 332
HLA-DPA1*01:03/DPB1*14:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 312 142
HLA-DPA1*04:01/DPB1*06:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 404 184
HLA-DQA1*03:01/DQB1*03:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 313 687
HLA-DQA1*03:01/DQB1*03:19 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 313 687
HLA-DPA1*03:01/DPB1*03:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 601 274
HLA-DQA1*06:01/DQB1*06:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 414 907
HLA-DQA1*05:01/DQB1*04:02 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 403 882
HLA-DPA1*03:01/DPB1*03:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 851 390
HLA-DQA1*01:03/DQB1*06:01 SYQTQTNSPRRARSVA SYQTQTNSRRRARSVA 468 1021
HLA-DQA1*06:01/DQB1*03:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 469 1023
HLA-DQA1*06:01/DQB1*03:19 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 469 1023
HLA-DPA1*02:01/DPB1*03:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 836 384
HLA-DPA1*02:02/DPB1*03:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 838 385
HLA-DPA1*03:01/DPB1*14:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 635 292
HLA-DPA1*01:03/DPB1*03:01 QTNSPRRARSVASQSIIAY QTNSRRRARSVASQSIIAY 152 70
HLA-DQA1*03:01/DQB1*03:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 301 651
HLA-DQA1*03:01/DQB1*03:19 TNSPRRARSVASQSI TNSRRRARSVASQSI 301 651
HLA-DQA1*05:01/DQB1*06:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 243 525
HLA-DQA1*05:01/DQB1*04:02 SYQTQTNSPRRARSVAS SYQTQTNSRRRARSVAS 486 1050
HLA-DQA1*05:01/DQB1*04:02 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 395 853
HLA-DQA1*06:01/DQB1*03:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 379 818
HLA-DQA1*06:01/DQB1*03:19 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 379 818
HLA-DPA1*04:01/DPB1*17:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 669 310
HLA-DQA1*02:01/DQB1*06:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 254 547
HLA-DRB1*11:02 NSPRRARSVASQSII NSRRRARSVASQSII 732 340
HLA-DRB1*13:01 NSPRRARSVASQSII NSRRRARSVASQSII 732 340
HLA-DPA1*04:01/DPB1*10:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 439 204
HLA-DPA1*01:03/DPB1*03:01 TNSPRRARSVASQSIIAYT TNSRRRARSVASQSIIAYT 148 69
HLA-DQA1*01:03/DQB1*06:01 YQTQTNSPRRARSVASQ YQTQTNSRRRARSVASQ 239 512
HLA-DRB1*08:02 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 936 437
HLA-DRB1*10:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 696 325
HLA-DRB1*10:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 349 163
HLA-DPA1*04:01/DPB1*06:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 291 136
HLA-DPA1*02:02/DPB1*14:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 389 182
HLA-DPA1*04:01/DPB1*14:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 517 242
HLA-DPA1*02:02/DPB1*03:01 NSPRRARSVASQSII NSRRRARSVASQSII 722 338
HLA-DQA1*05:01/DQB1*04:02 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 448 956
HLA-DQA1*05:01/DQB1*03:01 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 221 471
HLA-DQA1*05:01/DQB1*03:19 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 221 471
HLA-DQA1*06:01/DQB1*06:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 383 816
HLA-DPA1*01:03/DPB1*14:01 NSPRRARSVASQSII NSRRRARSVASQSII 213 100
HLA-DPA1*01:03/DPB1*06:01 NSPRRARSVASQSII NSRRRARSVASQSII 313 147
HLA-DRB1*10:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 347 163
HLA-DPA1*01:03/DPB1*03:01 NSPRRARSVASQSIIAYTM NSRRRARSVASQSIIAYTM 153 72
HLA-DPA1*04:01/DPB1*06:01 YQTQTNSPRRARSVASQS YQTQTNSRRRARSVASQS 947 446
HLA-DQA1*03:01/DQB1*03:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 443 940
HLA-DQA1*03:01/DQB1*03:19 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 443 940
HLA-DQA1*01:03/DQB1*06:01 CASYQTQTNSPRRARSVASQ CASYQTQTNSRRRARSVASQ 199 422
HLA-DPA1*02:01/DPB1*03:01 SPRRARSVASQSIIA SRRRARSVASQSIIA 818 386
HLA-DQA1*02:01/DQB1*06:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 185 392
HLA-DQA1*05:01/DQB1*04:02 TQTNSPRRARSVASQ TQTNSRRRARSVASQ 263 557
HLA-DQA1*02:01/DQB1*06:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 248 525
HLA-DPA1*01:03/DPB1*03:01 PRRARSVASQSIIAY RRRARSVASQSIIAY 127 60
HLA-DPA1*01:03/DPB1*14:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 762 360
HLA-DQA1*05:01/DQB1*06:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 302 639
HLA-DPA1*01:03/DPB1*03:01 TNSPRRARSVASQSII TNSRRRARSVASQSII 167 79
HLA-DPA1*02:01/DPB1*14:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 507 240
HLA-DPA1*02:01/DPB1*14:01 TNSPRRARSVASQSII TNSRRRARSVASQSII 866 410
HLA-DQA1*03:01/DQB1*03:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 384 810
HLA-DQA1*03:01/DQB1*03:19 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 384 810
HLA-DPA1*02:01/DPB1*14:01 NSPRRARSVASQSII NSRRRARSVASQSII 719 341
HLA-DPA1*04:01/DPB1*14:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 293 139
HLA-DPA1*01:03/DPB1*06:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 533 253
HLA-DPA1*01:03/DPB1*03:01 SPRRARSVASQSIIAYTMS SRRRARSVASQSIIAYTMS 158 75
HLA-DQA1*05:01/DQB1*06:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 441 929
HLA-DQA1*06:01/DQB1*06:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 340 716
HLA-DRB1*11:02 TQTNSPRRARSVASQSIIAY TQTNSRRRARSVASQSIIAY 577 274
HLA-DRB1*13:01 TQTNSPRRARSVASQSIIAY TQTNSRRRARSVASQSIIAY 577 274
HLA-DPA1*04:01/DPB1*03:01 YQTQTNSPRRARSVASQS YQTQTNSRRRARSVASQS 838 398
HLA-DPA1*04:01/DPB1*03:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 160 76
HLA-DPA1*01:03/DPB1*03:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 84 40
HLA-DRB1*08:04 NSPRRARSVASQSII NSRRRARSVASQSII 1001 477
HLA-DPA1*01:03/DPB1*03:01 TNSPRRARSVASQSIIA TNSRRRARSVASQSIIA 132 63
HLA-DPA1*04:01/DPB1*06:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 176 84
HLA-DQA1*05:01/DQB1*06:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 333 697
HLA-DPA1*04:01/DPB1*11:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 885 423
HLA-DQA1*01:03/DQB1*06:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 165 345
HLA-DQA1*02:01/DQB1*06:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 341 713
HLA-DQA1*03:01/DQB1*03:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 402 840
HLA-DQA1*03:01/DQB1*03:19 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 402 840
HLA-DQA1*02:01/DQB1*03:01 TQTNSPRRARSVASQSIIA TQTNSRRRARSVASQSIIA 105 219
HLA-DQA1*02:01/DQB1*03:19 TQTNSPRRARSVASQSIIA TQTNSRRRARSVASQSIIA 105 219
HLA-DQA1*01:03/DQB1*06:01 SYQTQTNSPRRARSVASQS SYQTQTNSRRRARSVASQS 262 546
HLA-DPA1*03:01/DPB1*14:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 952 458
HLA-DPA1*01:03/DPB1*06:01 SPRRARSVASQSIIA SRRRARSVASQSIIA 253 122
HLA-DPA1*01:03/DPB1*06:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 425 205
HLA-DQA1*05:01/DQB1*04:02 QTQTNSPRRARSVAS QTQTNSRRRARSVAS 328 680
HLA-DPA1*02:01/DPB1*03:01 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 524 253
HLA-DPA1*04:01/DPB1*14:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 416 201
HLA-DRB1*08:04 TQTNSPRRARSVASQSIIAY TQTNSRRRARSVASQSIIAY 689 333
HLA-DPA1*01:03/DPB1*14:01 TQTNSPRRARSVASQSIIA TQTNSRRRARSVASQSIIA 242 117
HLA-DPA1*03:01/DPB1*14:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 646 313
HLA-DRB1*10:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 525 255
HLA-DQA1*01:03/DQB1*06:01 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 260 535
HLA-DPA1*04:01/DPB1*14:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 216 105
HLA-DPA1*04:01/DPB1*17:01 QTNSPRRARSVASQS QTNSRRRARSVASQS 835 406
HLA-DQA1*05:01/DQB1*04:02 QTNSPRRARSVASQS QTNSRRRARSVASQS 256 526
HLA-DQA1*05:01/DQB1*04:02 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 401 823
HLA-DQA1*05:01/DQB1*06:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 352 722
HLA-DPA1*04:01/DPB1*03:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 166 81
HLA-DPA1*01:03/DPB1*03:01 NSPRRARSVASQSIIAY NSRRRARSVASQSIIAY 127 62
HLA-DQA1*05:01/DQB1*04:02 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 352 721
HLA-DRB1*11:04 QTNSPRRARSVASQSIIAYT QTNSRRRARSVASQSIIAYT 961 470
HLA-DPA1*02:01/DPB1*14:01 TQTNSPRRARSVASQSIIA TQTNSRRRARSVASQSIIA 824 403
HLA-DQA1*06:01/DQB1*06:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 427 873
HLA-DRB1*10:01 TNSPRRARSVASQSII TNSRRRARSVASQSII 470 230
HLA-DPA1*04:01/DPB1*17:01 TQTNSPRRARSVASQS TQTNSRRRARSVASQS 799 391
HLA-DPA1*03:01/DPB1*03:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 723 354
HLA-DPA1*04:01/DPB1*10:01 TNSPRRARSVASQSI TNSRRRARSVASQSI 598 293
HLA-DPA1*04:01/DPB1*17:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 901 442
HLA-DQA1*01:03/DQB1*06:01 SYQTQTNSPRRARSVASQ SYQTQTNSRRRARSVASQ 469 956
HLA-DPA1*04:01/DPB1*06:01 QTQTNSPRRARSVASQSI QTQTNSRRRARSVASQSI 511 251
HLA-DPA1*02:02/DPB1*14:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 525 258
HLA-DPA1*01:03/DPB1*03:01 SPRRARSVASQSIIAYT SRRRARSVASQSIIAYT 126 62
HLA-DQA1*01:02/DQB1*06:01 YQTQTNSPRRARSVAS YQTQTNSRRRARSVAS 404 821
HLA-DPA1*04:01/DPB1*03:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 156 77
HLA-DRB1*08:02 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 810 400
HLA-DPA1*01:03/DPB1*14:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 257 127
HLA-DRB1*10:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 740 366
HLA-DQA1*06:01/DQB1*03:01 NSPRRARSVASQSII NSRRRARSVASQSII 254 513
HLA-DQA1*06:01/DQB1*03:19 NSPRRARSVASQSII NSRRRARSVASQSII 254 513
HLA-DPA1*04:01/DPB1*03:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 115 57
HLA-DRB1*07:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 345 171
HLA-DPA1*02:02/DPB1*14:01 NSPRRARSVASQSII NSRRRARSVASQSII 468 232
HLA-DPA1*03:01/DPB1*03:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 536 266
HLA-DPA1*04:01/DPB1*14:01 YQTQTNSPRRARSVASQSI YQTQTNSRRRARSVASQSI 286 142
HLA-DPA1*02:01/DPB1*14:01 TNSPRRARSVASQSIIA TNSRRRARSVASQSIIA 594 295
HLA-DPA1*02:02/DPB1*03:01 NSPRRARSVASQSIIA NSRRRARSVASQSIIA 598 297
HLA-DQA1*01:03/DQB1*06:01 ASYQTQTNSPRRARSVASQ ASYQTQTNSRRRARSVASQ 308 620
HLA-DPA1*03:01/DPB1*03:01 NSPRRARSVASQSII NSRRRARSVASQSII 471 234
HLA-DPA1*04:01/DPB1*09:01 ASYQTQTNSPRRARSVASQS ASYQTQTNSRRRARSVASQS 646 321
HLA-DQA1*06:01/DQB1*03:01 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 341 686
HLA-DQA1*06:01/DQB1*03:19 QTNSPRRARSVASQSII QTNSRRRARSVASQSII 341 686
HLA-DPA1*04:01/DPB1*17:01 SYQTQTNSPRRARSVASQSI SYQTQTNSRRRARSVASQSI 358 178
HLA-DQA1*05:01/DQB1*04:02 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 402 808
HLA-DQA1*01:03/DQB1*06:01 QTQTNSPRRARSVASQ QTQTNSRRRARSVASQ 255 512
HLA-DPA1*02:02/DPB1*14:01 QTQTNSPRRARSVASQSII QTQTNSRRRARSVASQSII 877 437
HLA-DPA1*02:01/DPB1*03:01 NSPRRARSVASQSIIA NSRRRARSVASQSIIA 889 443
HLA-DPA1*02:02/DPB1*03:01 TNSPRRARSVASQSIIA TNSRRRARSVASQSIIA 594 296
HLA-DPA1*04:01/DPB1*10:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 632 315
HLA-DPA1*01:03/DPB1*03:01 QTQTNSPRRARSVASQSIIA QTQTNSRRRARSVASQSIIA 66 33
HLA-DPA1*01:03/DPB1*14:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 138 69
HLA-DPA1*01:03/DPB1*03:01 NSPRRARSVASQSIIA NSRRRARSVASQSIIA 142 71
HLA-DPA1*01:03/DPB1*06:01 YQTQTNSPRRARSVASQSII YQTQTNSRRRARSVASQSII 196 98
HLA-DPA1*04:01/DPB1*06:01 QTNSPRRARSVASQSI QTNSRRRARSVASQSI 222 111
HLA-DRB1*07:01 TQTNSPRRARSVASQSI TQTNSRRRARSVASQSI 280 140
HLA-DQA1*01:03/DQB1*06:01 QTQTNSPRRARSVASQS QTQTNSRRRARSVASQS 238 476

D950N

Reference  NQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NQFNSAIGKIQDSLSSTASALGKLQNVVNQNAQALNTLVKQLSSNFGAISS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*01:01 ASALGKLQDVVNQNA ASALGKLQNVVNQNA 862 124
HLA-DRB1*01:01 TASALGKLQDVVNQN TASALGKLQNVVNQN 1276 198
HLA-DRB1*01:01 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 647 116
HLA-DRB1*10:01 TASALGKLQDVVNQN TASALGKLQNVVNQN 727 144
HLA-DRB1*01:01 TASALGKLQDVVNQNAQ TASALGKLQNVVNQNAQ 1652 346
HLA-DRB1*10:01 STASALGKLQDVVNQNA STASALGKLQNVVNQNA 806 169
HLA-DRB1*10:01 TASALGKLQDVVNQNAQ TASALGKLQNVVNQNAQ 672 141
HLA-DRB1*10:01 STASALGKLQDVVNQ STASALGKLQNVVNQ 743 159
HLA-DRB1*10:01 SSTASALGKLQDVVNQN SSTASALGKLQNVVNQN 1223 265
HLA-DRB1*04:04 TASALGKLQDVVNQNAQ TASALGKLQNVVNQNAQ 483 105
HLA-DRB1*01:01 ASALGKLQDVVNQNAQA ASALGKLQNVVNQNAQA 1178 257
HLA-DRB1*01:01 STASALGKLQDVVNQ STASALGKLQNVVNQ 1011 224
HLA-DRB1*01:01 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 459 103
HLA-DRB1*04:04 STASALGKLQDVVNQNAQA STASALGKLQNVVNQNAQA 449 101
HLA-DRB1*15:01 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 1111 250
HLA-DRB1*10:01 STASALGKLQDVVNQN STASALGKLQNVVNQN 1471 332
HLA-DRB1*15:01 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 1820 411
HLA-DRB1*01:01 ASALGKLQDVVNQNAQ ASALGKLQNVVNQNAQ 1675 380
HLA-DRB1*10:01 ASALGKLQDVVNQNA ASALGKLQNVVNQNA 418 95
HLA-DRB1*04:04 SSTASALGKLQDVVNQNAQ SSTASALGKLQNVVNQNAQ 783 178
HLA-DRB1*04:04 ASALGKLQDVVNQNAQ ASALGKLQNVVNQNAQ 421 98
HLA-DRB1*01:01 STASALGKLQDVVNQNA STASALGKLQNVVNQNA 1882 440
HLA-DRB1*04:04 ASALGKLQDVVNQNAQA ASALGKLQNVVNQNAQA 280 66
HLA-DRB1*10:01 TASALGKLQDVVNQNA TASALGKLQNVVNQNA 876 210
HLA-DRB1*10:01 ASALGKLQDVVNQNAQA ASALGKLQNVVNQNAQA 519 125
HLA-DRB1*01:01 SALGKLQDVVNQNAQA SALGKLQNVVNQNAQA 1215 294
HLA-DRB1*04:04 ASALGKLQDVVNQNAQAL ASALGKLQNVVNQNAQAL 623 151
HLA-DRB1*10:01 SSTASALGKLQDVVNQNAQ SSTASALGKLQNVVNQNAQ 820 199
HLA-DRB1*04:04 SALGKLQDVVNQNAQALN SALGKLQNVVNQNAQALN 617 150
HLA-DRB1*08:02 ASALGKLQDVVNQNAQA ASALGKLQNVVNQNAQA 1899 463
HLA-DRB1*04:04 ALGKLQDVVNQNAQALNT ALGKLQNVVNQNAQALNT 648 158
HLA-DRB1*04:04 TASALGKLQDVVNQNAQA TASALGKLQNVVNQNAQA 902 220
HLA-DRB1*04:04 STASALGKLQDVVNQNAQ STASALGKLQNVVNQNAQ 1554 382
HLA-DRB1*10:01 ASALGKLQDVVNQNAQ ASALGKLQNVVNQNAQ 683 168
HLA-DRB1*04:04 TASALGKLQDVVNQNAQAL TASALGKLQNVVNQNAQAL 309 77
HLA-DRB1*04:04 LGKLQDVVNQNAQALNTL LGKLQNVVNQNAQALNTL 706 176
HLA-DRB1*10:01 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 371 93
HLA-DRB1*01:01 SSTASALGKLQDVVNQNAQA SSTASALGKLQNVVNQNAQA 793 199
HLA-DRB1*04:04 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 207 52
HLA-DRB1*08:02 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 1578 398
HLA-DRB1*04:04 ASALGKLQDVVNQNA ASALGKLQNVVNQNA 463 117
HLA-DRB1*10:01 SSTASALGKLQDVVNQ SSTASALGKLQNVVNQ 1515 383
HLA-DRB1*15:01 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 1450 368
HLA-DRB1*10:01 STASALGKLQDVVNQNAQA STASALGKLQNVVNQNAQA 645 165
HLA-DRB1*01:01 STASALGKLQDVVNQNAQA STASALGKLQNVVNQNAQA 1523 391
HLA-DRB1*04:04 SALGKLQDVVNQNAQA SALGKLQNVVNQNAQA 253 65
HLA-DRB1*04:04 SSTASALGKLQDVVNQNAQA SSTASALGKLQNVVNQNAQA 323 83
HLA-DRB1*04:04 ASALGKLQDVVNQNAQALN ASALGKLQNVVNQNAQALN 291 75
HLA-DRB1*10:01 LSSTASALGKLQDVVNQNA LSSTASALGKLQNVVNQNA 904 233
HLA-DRB1*08:04 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 1607 415
HLA-DRB1*04:04 LSSTASALGKLQDVVNQNAQ LSSTASALGKLQNVVNQNAQ 558 145
HLA-DRB1*04:04 STASALGKLQDVVNQNA STASALGKLQNVVNQNA 1130 294
HLA-DRB1*04:04 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 198 52
HLA-DRB1*08:02 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 1062 279
HLA-DRB1*04:01 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 456 120
HLA-DRB1*04:04 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 216 57
HLA-DRB1*04:04 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 197 52
HLA-DRB1*15:01 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 678 179
HLA-DRB1*04:04 SALGKLQDVVNQNAQALNT SALGKLQNVVNQNAQALNT 290 77
HLA-DRB1*04:04 TASALGKLQDVVNQNA TASALGKLQNVVNQNA 1028 273
HLA-DRB1*04:01 ASALGKLQDVVNQNAQA ASALGKLQNVVNQNAQA 628 167
HLA-DRB1*08:02 SALGKLQDVVNQNAQA SALGKLQNVVNQNAQA 1667 445
HLA-DRB1*04:04 GKLQDVVNQNAQALNT GKLQNVVNQNAQALNT 283 76
HLA-DRB1*15:01 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 1359 365
HLA-DRB1*04:01 TASALGKLQDVVNQNAQ TASALGKLQNVVNQNAQ 980 265
HLA-DRB1*08:02 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 1335 361
HLA-DRB1*04:04 GKLQDVVNQNAQALNTL GKLQNVVNQNAQALNTL 314 85
HLA-DRB1*11:02 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 1176 319
HLA-DRB1*13:01 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 1176 319
HLA-DRB1*08:04 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 1124 305
HLA-DRB1*04:01 STASALGKLQDVVNQNAQA STASALGKLQNVVNQNAQA 950 260
HLA-DRB1*04:04 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 189 52
HLA-DRB1*04:04 GKLQDVVNQNAQALNTLV GKLQNVVNQNAQALNTLV 1099 303
HLA-DRB1*15:01 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 1265 349
HLA-DRB1*04:04 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 181 50
HLA-DRB1*04:01 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 310 86
HLA-DRB1*04:01 ASALGKLQDVVNQNAQ ASALGKLQNVVNQNAQ 901 250
HLA-DRB1*04:01 SALGKLQDVVNQNAQA SALGKLQNVVNQNAQA 590 164
HLA-DRB1*08:04 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 1675 466
HLA-DRB1*08:02 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 1298 362
HLA-DRB1*01:02 ASALGKLQDVVNQNA ASALGKLQNVVNQNA 1411 394
HLA-DRB1*13:02 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 1329 374
HLA-DRB1*04:04 ALGKLQDVVNQNAQALNTL ALGKLQNVVNQNAQALNTL 287 81
HLA-DRB1*04:04 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 134 38
HLA-DRB1*04:01 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 444 126
HLA-DRB1*11:04 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 1588 451
HLA-DRB1*04:01 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 457 130
HLA-DRB1*04:04 LGKLQDVVNQNAQALNTLV LGKLQNVVNQNAQALNTLV 326 93
HLA-DRB1*08:02 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 1218 349
HLA-DRB1*08:04 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 1615 463
HLA-DRB1*04:01 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 453 130
HLA-DRB1*04:04 TASALGKLQDVVNQN TASALGKLQNVVNQN 1575 452
HLA-DRB1*04:02 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 1051 302
HLA-DRB1*08:02 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 1211 348
HLA-DRB1*04:01 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 488 141
HLA-DRB1*04:01 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 452 131
HLA-DRB1*10:01 SALGKLQDVVNQNAQA SALGKLQNVVNQNAQA 547 159
HLA-DRB1*04:01 ASALGKLQDVVNQNAQAL ASALGKLQNVVNQNAQAL 1283 373
HLA-DRB1*10:01 SSTASALGKLQDVVNQNAQA SSTASALGKLQNVVNQNAQA 392 114
HLA-DRB1*04:02 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 1562 455
HLA-DRB1*04:01 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 322 94
HLA-DRB1*04:04 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 226 66
HLA-DRB1*08:02 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 1300 382
HLA-DRB1*04:01 SALGKLQDVVNQNAQALN SALGKLQNVVNQNAQALN 1252 368
HLA-DRB1*08:02 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 811 239
HLA-DRB1*04:01 SSTASALGKLQDVVNQNAQ SSTASALGKLQNVVNQNAQ 1512 450
HLA-DRB1*04:01 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 245 73
HLA-DRB1*04:04 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 144 43
HLA-DRB1*08:02 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 976 292
HLA-DRB1*10:01 LSSTASALGKLQDVVNQNAQ LSSTASALGKLQNVVNQNAQ 447 134
HLA-DRB1*10:01 TASALGKLQDVVNQNAQAL TASALGKLQNVVNQNAQAL 470 141
HLA-DRB1*04:01 ALGKLQDVVNQNAQALNT ALGKLQNVVNQNAQALNT 1278 384
HLA-DRB1*08:04 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 1639 494
HLA-DRB1*08:02 GKLQDVVNQNAQALNT GKLQNVVNQNAQALNT 1487 449
HLA-DRB1*08:04 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 1589 481
HLA-DRB1*15:01 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 1168 354
HLA-DRB1*04:02 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 639 194
HLA-DRB1*15:01 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 1192 362
HLA-DRB1*01:01 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 638 194
HLA-DRB1*08:02 SSTASALGKLQDVVNQNAQA SSTASALGKLQNVVNQNAQA 1516 461
HLA-DRB1*10:01 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 394 120
HLA-DRB1*04:02 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 513 157
HLA-DRB1*04:02 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 1354 415
HLA-DRB1*13:02 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 501 154
HLA-DRB1*15:01 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 1184 364
HLA-DRB1*04:02 ASALGKLQDVVNQNAQA ASALGKLQNVVNQNAQA 1486 457
HLA-DRB1*04:01 SSTASALGKLQDVVNQNAQA SSTASALGKLQNVVNQNAQA 702 217
HLA-DRB1*08:04 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 1115 345
HLA-DRB1*10:01 LSSTASALGKLQDVVNQ LSSTASALGKLQNVVNQ 880 273
HLA-DRB1*04:04 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 203 63
HLA-DRB1*04:02 SALGKLQDVVNQNAQA SALGKLQNVVNQNAQA 1224 381
HLA-DRB1*04:02 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 693 216
HLA-DRB1*08:02 ASALGKLQDVVNQNAQALN ASALGKLQNVVNQNAQALN 1603 500
HLA-DRB1*04:01 GKLQDVVNQNAQALNT GKLQNVVNQNAQALNT 571 179
HLA-DRB1*04:04 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 102 32
HLA-DRB1*04:01 ASALGKLQDVVNQNAQALN ASALGKLQNVVNQNAQALN 624 196
HLA-DRB1*04:02 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 1163 366
HLA-DRB1*04:01 TASALGKLQDVVNQNAQAL TASALGKLQNVVNQNAQAL 653 206
HLA-DRB1*01:01 TASALGKLQDVVNQNAQAL TASALGKLQNVVNQNAQAL 868 274
HLA-DRB1*04:01 LGKLQDVVNQNAQALNTL LGKLQNVVNQNAQALNTL 1341 424
HLA-DRB1*04:02 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 981 311
HLA-DRB1*10:01 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 318 101
HLA-DRB1*04:04 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 195 62
HLA-DRB1*04:04 KLQDVVNQNAQALNT KLQNVVNQNAQALNT 261 83
HLA-DRB1*04:02 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 1256 400
HLA-DRB1*13:02 SALGKLQDVVNQNAQA SALGKLQNVVNQNAQA 1017 324
HLA-DRB1*01:02 SALGKLQDVVNQNAQ SALGKLQNVVNQNAQ 1028 328
HLA-DRB1*08:04 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 1551 495
HLA-DRB1*08:04 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 842 270
HLA-DRB1*10:01 ASALGKLQDVVNQNAQALN ASALGKLQNVVNQNAQALN 433 139
HLA-DRB1*08:02 SALGKLQDVVNQNAQALNT SALGKLQNVVNQNAQALNT 1542 497
HLA-DRB1*04:04 GKLQDVVNQNAQALNTLVK GKLQNVVNQNAQALNTLVK 447 145
HLA-DRB1*04:01 ASALGKLQDVVNQNA ASALGKLQNVVNQNA 898 292
HLA-DRB1*10:01 SSTASALGKLQDVVN SSTASALGKLQNVVN 902 294
HLA-DRB1*15:01 SALGKLQDVVNQNAQALNT SALGKLQNVVNQNAQALNT 1501 490
HLA-DRB1*04:01 GKLQDVVNQNAQALNTL GKLQNVVNQNAQALNTL 615 201
HLA-DRB1*01:01 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 575 188
HLA-DRB1*15:01 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 703 230
HLA-DRB1*04:01 SALGKLQDVVNQNAQALNT SALGKLQNVVNQNAQALNT 611 200
HLA-DRB1*10:01 ASALGKLQDVVNQNAQAL ASALGKLQNVVNQNAQAL 1169 383
HLA-DRB1*01:01 LSSTASALGKLQDVVNQNAQ LSSTASALGKLQNVVNQNAQ 766 251
HLA-DRB1*13:02 ASALGKLQDVVNQNAQA ASALGKLQNVVNQNAQA 1221 401
HLA-DRB1*16:01 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 1357 448
HLA-DRB1*08:04 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 1496 494
HLA-DRB1*01:02 ALGKLQDVVNQNAQA ALGKLQNVVNQNAQA 732 242
HLA-DRB1*04:02 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 1087 360
HLA-DRB1*04:02 SALGKLQDVVNQNAQALNTL SALGKLQNVVNQNAQALNTL 1196 398
HLA-DRB1*04:02 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 949 317
HLA-DRB1*01:01 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 425 142
HLA-DRB1*10:01 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 286 96
HLA-DRB1*08:02 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 1135 382
HLA-DRB1*04:04 SALGKLQDVVNQNAQALNTL SALGKLQNVVNQNAQALNTL 187 63
HLA-DRB1*15:01 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 907 306
HLA-DRB1*04:02 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 1108 375
HLA-DRB1*11:02 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 1350 457
HLA-DRB1*13:01 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 1350 457
HLA-DRB1*08:02 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 1045 354
HLA-DRB1*04:02 ALGKLQDVVNQNAQALNTLV ALGKLQNVVNQNAQALNTLV 1236 420
HLA-DRB1*08:04 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 1386 478
HLA-DRB1*04:04 ALGKLQDVVNQNAQALNTLV ALGKLQNVVNQNAQALNTLV 198 69
HLA-DRB1*04:02 GKLQDVVNQNAQALNT GKLQNVVNQNAQALNT 1243 435
HLA-DRB1*04:01 ALGKLQDVVNQNAQALNTL ALGKLQNVVNQNAQALNTL 591 209
HLA-DRB1*13:02 STASALGKLQDVVNQNAQA STASALGKLQNVVNQNAQA 1365 483
HLA-DRB1*04:01 LSSTASALGKLQDVVNQNAQ LSSTASALGKLQNVVNQNAQ 1098 390
HLA-DRB1*10:01 SALGKLQDVVNQNAQALN SALGKLQNVVNQNAQALN 1145 407
HLA-DRB1*04:01 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 478 170
HLA-DRB1*11:02 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 427 152
HLA-DRB1*13:01 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 427 152
HLA-DRB1*11:02 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 1083 386
HLA-DRB1*13:01 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 1083 386
HLA-DRB1*08:02 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 965 346
HLA-DRB1*08:04 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 1302 467
HLA-DRB1*13:02 SSTASALGKLQDVVNQNAQA SSTASALGKLQNVVNQNAQA 815 294
HLA-DRB1*04:04 KLQDVVNQNAQALNTLV KLQNVVNQNAQALNTLV 523 189
HLA-DRB1*04:02 KLQDVVNQNAQALNT KLQNVVNQNAQALNT 973 352
HLA-DRB1*04:02 LGKLQDVVNQNAQALNTLVK LGKLQNVVNQNAQALNTLVK 1289 467
HLA-DRB1*15:01 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 764 277
HLA-DRB1*04:04 KLQDVVNQNAQALNTL KLQNVVNQNAQALNTL 433 157
HLA-DRB1*10:01 SLSSTASALGKLQDVVNQNA SLSSTASALGKLQNVVNQNA 397 144
HLA-DRB1*10:01 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 254 93
HLA-DRB1*10:01 SALGKLQDVVNQNAQALNT SALGKLQNVVNQNAQALNT 426 156
HLA-DRB1*04:04 LGKLQDVVNQNAQALNTLVK LGKLQNVVNQNAQALNTLVK 215 79
HLA-DRB1*10:01 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 378 139
HLA-DRB1*11:02 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 1019 376
HLA-DRB1*13:01 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 1019 376
HLA-DRB1*04:01 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 427 158
HLA-DRB1*04:01 LGKLQDVVNQNAQALNTLV LGKLQNVVNQNAQALNTLV 636 237
HLA-DRB1*15:01 ALGKLQDVVNQNAQALNTL ALGKLQNVVNQNAQALNTL 1136 427
HLA-DRB1*08:04 SALGKLQDVVNQNAQALNTL SALGKLQNVVNQNAQALNTL 1233 466
HLA-DRB1*04:04 SLSSTASALGKLQDVVNQNA SLSSTASALGKLQNVVNQNA 992 377
HLA-DRB1*15:01 GKLQDVVNQNAQALNT GKLQNVVNQNAQALNT 1266 482
HLA-DRB1*08:02 KLQDVVNQNAQALNT KLQNVVNQNAQALNT 1197 456
HLA-DRB1*10:01 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 382 146
HLA-DRB1*01:01 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 182 70
HLA-DRB1*01:01 SSTASALGKLQDVVN SSTASALGKLQNVVN 864 333
HLA-DRB1*04:01 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 396 153
HLA-DRB1*10:01 ALGKLQDVVNQNAQALNT ALGKLQNVVNQNAQALNT 1136 441
HLA-DRB1*08:04 ALGKLQDVVNQNAQALNTLV ALGKLQNVVNQNAQALNTLV 1249 491
HLA-DRB1*11:02 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 835 329
HLA-DRB1*13:01 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 835 329
HLA-DRB1*11:02 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 829 327
HLA-DRB1*13:01 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 829 327
HLA-DRB1*15:01 LGKLQDVVNQNAQALNTLV LGKLQNVVNQNAQALNTLV 1164 460
HLA-DRB1*08:02 SALGKLQDVVNQNAQALNTL SALGKLQNVVNQNAQALNTL 879 349
HLA-DRB1*10:01 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 236 95
HLA-DRB1*04:03 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 1069 431
HLA-DRB1*01:01 ASALGKLQDVVNQNAQALN ASALGKLQNVVNQNAQALN 519 211
HLA-DRB1*04:01 GKLQDVVNQNAQALNTLVK GKLQNVVNQNAQALNTLVK 798 326
HLA-DRB1*04:01 KLQDVVNQNAQALNT KLQNVVNQNAQALNT 440 180
HLA-DRB1*10:01 SLSSTASALGKLQDVVNQN SLSSTASALGKLQNVVNQN 752 311
HLA-DRB1*04:01 SALGKLQDVVNQNAQALNTL SALGKLQNVVNQNAQALNTL 369 153
HLA-DRB1*04:04 GKLQDVVNQNAQALNTLVKQ GKLQNVVNQNAQALNTLVKQ 281 117
HLA-DRB1*08:02 ALGKLQDVVNQNAQALNTLV ALGKLQNVVNQNAQALNTLV 886 369
HLA-DRB1*15:01 SALGKLQDVVNQNAQALNTL SALGKLQNVVNQNAQALNTL 550 232
HLA-DRB1*11:02 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 339 143
HLA-DRB1*13:01 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 339 143
HLA-DRB1*11:02 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 910 384
HLA-DRB1*13:01 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 910 384
HLA-DRB1*11:02 SALGKLQDVVNQNAQALNT SALGKLQNVVNQNAQALNT 1097 466
HLA-DRB1*13:01 SALGKLQDVVNQNAQALNT SALGKLQNVVNQNAQALNT 1097 466
HLA-DRB1*01:01 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 343 146
HLA-DRB1*04:01 ALGKLQDVVNQNAQALNTLV ALGKLQNVVNQNAQALNTLV 389 166
HLA-DRB1*15:01 GKLQDVVNQNAQALNTL GKLQNVVNQNAQALNTL 1025 442
HLA-DRB1*13:02 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 248 107
HLA-DRB1*13:02 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 222 96
HLA-DRB1*11:02 GKLQDVVNQNAQALNT GKLQNVVNQNAQALNT 744 322
HLA-DRB1*13:01 GKLQDVVNQNAQALNT GKLQNVVNQNAQALNT 744 322
HLA-DRB1*15:02 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 751 326
HLA-DRB1*10:01 GKLQDVVNQNAQALNT GKLQNVVNQNAQALNT 452 197
HLA-DRB1*01:01 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 243 106
HLA-DRB1*10:01 LGKLQDVVNQNAQALNTL LGKLQNVVNQNAQALNTL 1079 471
HLA-DRB1*15:01 ALGKLQDVVNQNAQALNTLV ALGKLQNVVNQNAQALNTLV 534 236
HLA-DRB1*10:01 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 373 165
HLA-DRB1*13:02 TASALGKLQDVVNQNAQAL TASALGKLQNVVNQNAQAL 332 147
HLA-DRB1*01:02 SALGKLQDVVNQNAQAL SALGKLQNVVNQNAQAL 941 417
HLA-DRB1*10:01 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 243 108
HLA-DRB1*04:01 KLQDVVNQNAQALNTL KLQNVVNQNAQALNTL 711 316
HLA-DRB1*13:02 ASALGKLQDVVNQNAQAL ASALGKLQNVVNQNAQAL 850 379
HLA-DRB1*01:01 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 302 135
HLA-DRB1*04:07 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 968 433
HLA-DRB1*01:02 ALGKLQDVVNQNAQAL ALGKLQNVVNQNAQAL 890 399
HLA-DRB1*10:01 LGKLQDVVNQNAQALNT LGKLQNVVNQNAQALNT 371 167
HLA-DRB1*04:01 LGKLQDVVNQNAQALNTLVK LGKLQNVVNQNAQALNTLVK 419 189
HLA-DRB1*10:01 ALGKLQDVVNQNAQALNTL ALGKLQNVVNQNAQALNTL 375 170
HLA-DRB1*04:01 KLQDVVNQNAQALNTLV KLQNVVNQNAQALNTLV 858 389
HLA-DRB1*11:02 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 639 291
HLA-DRB1*13:01 TASALGKLQDVVNQNAQALN TASALGKLQNVVNQNAQALN 639 291
HLA-DRB1*01:02 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 340 155
HLA-DRB1*01:02 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 1012 463
HLA-DRB1*08:02 LGKLQDVVNQNAQALNTLVK LGKLQNVVNQNAQALNTLVK 855 392
HLA-DRB1*10:01 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 278 128
HLA-DRB1*11:02 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 510 235
HLA-DRB1*13:01 ASALGKLQDVVNQNAQALNT ASALGKLQNVVNQNAQALNT 510 235
HLA-DRB1*15:01 KLQDVVNQNAQALNT KLQNVVNQNAQALNT 714 331
HLA-DRB1*11:02 KLQDVVNQNAQALNT KLQNVVNQNAQALNT 289 135
HLA-DRB1*13:01 KLQDVVNQNAQALNT KLQNVVNQNAQALNT 289 135
HLA-DRB1*04:04 KLQDVVNQNAQALNTLVKQ KLQNVVNQNAQALNTLVKQ 663 311
HLA-DRB1*13:02 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 202 95
HLA-DRB1*11:02 GKLQDVVNQNAQALNTL GKLQNVVNQNAQALNTL 614 290
HLA-DRB1*13:01 GKLQDVVNQNAQALNTL GKLQNVVNQNAQALNTL 614 290
HLA-DRB1*15:02 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 1017 482
HLA-DRB1*01:01 SLSSTASALGKLQDVVNQNA SLSSTASALGKLQNVVNQNA 525 250
HLA-DRB1*15:01 LGKLQDVVNQNAQALNTLVK LGKLQNVVNQNAQALNTLVK 526 251
HLA-DRB1*13:02 ALGKLQDVVNQNAQALN ALGKLQNVVNQNAQALN 180 86
HLA-DRB1*15:02 GKLQDVVNQNAQALN GKLQNVVNQNAQALN 736 352
HLA-DRB1*07:01 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 817 392
HLA-DRB1*11:02 ALGKLQDVVNQNAQALNTL ALGKLQNVVNQNAQALNTL 794 382
HLA-DRB1*13:01 ALGKLQDVVNQNAQALNTL ALGKLQNVVNQNAQALNTL 794 382
HLA-DRB1*13:02 LGKLQDVVNQNAQAL LGKLQNVVNQNAQAL 89 43
HLA-DRB1*15:02 STASALGKLQDVVNQNAQAL STASALGKLQNVVNQNAQAL 1024 498
HLA-DRB1*13:02 ASALGKLQDVVNQNAQALN ASALGKLQNVVNQNAQALN 226 110
HLA-DRB1*10:01 SALGKLQDVVNQNAQALNTL SALGKLQNVVNQNAQALNTL 209 102
HLA-DRB1*01:01 SALGKLQDVVNQNAQALNT SALGKLQNVVNQNAQALNT 337 166
HLA-DRB1*13:02 LGKLQDVVNQNAQALN LGKLQNVVNQNAQALN 160 79
HLA-DRB1*04:01 GKLQDVVNQNAQALNTLVKQ GKLQNVVNQNAQALNTLVKQ 506 250

N protein

N

R203M

Reference  GGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLN
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    GGSQASSRSSSRSRNSSRNSTPGSSMGTSPARMAGNGCDAALALLLLDRLN

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*01:01 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 1390 364
HLA-DRB1*01:01 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 1305 345
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALALL MGTSPARMAGNGCDAALALL 126 444
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALALL MGTSPARMAGNGCDAALALL 126 444
HLA-DRB1*01:01 SSRGTSPARMAGNGG SSMGTSPARMAGNGC 1480 429
HLA-DRB1*01:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 1312 399
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALAL MGTSPARMAGNGCDAALAL 194 625
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALAL MGTSPARMAGNGCDAALAL 194 625
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 270 85
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 270 85
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPAR RNSTPGSSMGTSPAR 556 178
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPAR RNSTPGSSMGTSPAR 556 178
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 221 73
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 221 73
HLA-DQA1*02:01/DQB1*03:03 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 792 263
HLA-DQA1*02:01/DQB1*03:03 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 1062 360
HLA-DQA1*02:01/DQB1*03:03 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 987 337
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMAG RNSTPGSSMGTSPARMAG 629 222
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMAG RNSTPGSSMGTSPARMAG 629 222
HLA-DQA1*02:01/DQB1*03:03 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 723 256
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 254 90
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 254 90
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 215 77
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 215 77
HLA-DQA1*02:01/DQB1*03:03 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 783 281
HLA-DQA1*02:01/DQB1*03:03 SRNSTPGSSRGTSPARMAGN SRNSTPGSSMGTSPARMAGN 756 272
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 166 60
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 166 60
HLA-DQA1*02:01/DQB1*03:03 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 959 348
HLA-DQA1*02:01/DQB1*03:03 STPGSSRGTSPARMA STPGSSMGTSPARMA 575 210
HLA-DQA1*02:01/DQB1*03:03 NSTPGSSRGTSPARMAGNGG NSTPGSSMGTSPARMAGNGC 800 295
HLA-DQA1*02:01/DQB1*03:03 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSMGTSPARMAG 786 290
HLA-DQA1*02:01/DQB1*03:03 STPGSSRGTSPARMAGNGGD STPGSSMGTSPARMAGNGCD 825 306
HLA-DQA1*02:01/DQB1*03:03 SRNSTPGSSRGTSPARMAG SRNSTPGSSMGTSPARMAG 973 362
HLA-DQA1*02:01/DQB1*03:03 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 635 237
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARMAG SRNSTPGSSMGTSPARMAG 318 119
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARMAG SRNSTPGSSMGTSPARMAG 318 119
HLA-DQA1*02:01/DQB1*03:03 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 1021 387
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARMA SRNSTPGSSMGTSPARMA 589 224
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARMA SRNSTPGSSMGTSPARMA 589 224
HLA-DQA1*02:01/DQB1*03:03 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 706 269
HLA-DQA1*02:01/DQB1*03:03 RNSTPGSSRGTSPARMAGN RNSTPGSSMGTSPARMAGN 924 353
HLA-DQA1*02:01/DQB1*03:03 NSTPGSSRGTSPARMAGNG NSTPGSSMGTSPARMAGNG 953 370
HLA-DQA1*02:01/DQB1*03:03 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 1081 420
HLA-DQA1*02:01/DQB1*03:03 TPGSSRGTSPARMAGNGGDA TPGSSMGTSPARMAGNGCDA 841 327
HLA-DQA1*06:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 618 241
HLA-DQA1*06:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 618 241
HLA-DQA1*05:01/DQB1*03:01 SRGTSPARMAGNGGDAALAL SMGTSPARMAGNGCDAALAL 146 372
HLA-DQA1*05:01/DQB1*03:19 SRGTSPARMAGNGGDAALAL SMGTSPARMAGNGCDAALAL 146 372
HLA-DQA1*02:01/DQB1*03:03 STPGSSRGTSPARMAGNGG STPGSSMGTSPARMAGNGC 975 385
HLA-DQA1*02:01/DQB1*03:03 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 764 302
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSMGTSPARMA 164 65
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSMGTSPARMA 164 65
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMAGN RNSTPGSSMGTSPARMAGN 282 113
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMAGN RNSTPGSSMGTSPARMAGN 282 113
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 497 200
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 497 200
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 159 64
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 159 64
HLA-DQA1*05:01/DQB1*03:03 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 756 306
HLA-DQA1*02:01/DQB1*03:03 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 610 247
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 200 81
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 200 81
HLA-DQA1*02:01/DQB1*03:03 TPGSSRGTSPARMAGNGGD TPGSSMGTSPARMAGNGCD 1021 415
HLA-DQA1*02:01/DQB1*03:03 NSSRNSTPGSSRGTSPARMA NSSRNSTPGSSMGTSPARMA 744 303
HLA-DQA1*02:01/DQB1*03:01 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 169 69
HLA-DQA1*02:01/DQB1*03:19 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 169 69
HLA-DQA1*02:01/DQB1*03:01 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSMGTSPARMAG 231 95
HLA-DQA1*02:01/DQB1*03:19 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSMGTSPARMAG 231 95
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAGNG NSTPGSSMGTSPARMAGNG 281 116
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAGNG NSTPGSSMGTSPARMAGNG 281 116
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAGN NSTPGSSMGTSPARMAGN 513 212
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAGN NSTPGSSMGTSPARMAGN 513 212
HLA-DQA1*05:01/DQB1*03:03 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 935 387
HLA-DQA1*03:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 620 257
HLA-DQA1*03:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 620 257
HLA-DQA1*02:01/DQB1*03:01 SSRNSTPGSSRGTSPARMA SSRNSTPGSSMGTSPARMA 316 131
HLA-DQA1*02:01/DQB1*03:19 SSRNSTPGSSRGTSPARMA SSRNSTPGSSMGTSPARMA 316 131
HLA-DQA1*02:01/DQB1*03:01 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 231 96
HLA-DQA1*02:01/DQB1*03:19 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 231 96
HLA-DQA1*02:01/DQB1*03:03 SSRNSTPGSSRGTSPARMA SSRNSTPGSSMGTSPARMA 882 367
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 209 87
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 209 87
HLA-DQA1*03:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 714 298
HLA-DQA1*03:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 714 298
HLA-DQA1*03:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 541 226
HLA-DQA1*03:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 541 226
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPA SRNSTPGSSMGTSPA 408 171
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPA SRNSTPGSSMGTSPA 408 171
HLA-DQA1*05:01/DQB1*03:03 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 725 304
HLA-DQA1*06:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 770 324
HLA-DQA1*06:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 770 324
HLA-DQA1*02:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 127 54
HLA-DQA1*02:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 127 54
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPAR SRNSTPGSSMGTSPAR 526 224
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPAR SRNSTPGSSMGTSPAR 526 224
HLA-DQA1*05:01/DQB1*03:03 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 577 246
HLA-DQA1*06:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 588 251
HLA-DQA1*06:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 588 251
HLA-DQA1*06:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 756 323
HLA-DQA1*06:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 756 323
HLA-DQA1*06:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 399 171
HLA-DQA1*06:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 399 171
HLA-DQA1*02:01/DQB1*03:03 PGSSRGTSPARMAGNGGDA PGSSMGTSPARMAGNGCDA 1057 453
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAGNG STPGSSMGTSPARMAGNG 527 226
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAGNG STPGSSMGTSPARMAGNG 527 226
HLA-DQA1*02:01/DQB1*03:03 GSSRGTSPARMAGNGGD GSSMGTSPARMAGNGCD 1047 450
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPAR RNSTPGSSMGTSPAR 644 277
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPAR RNSTPGSSMGTSPAR 644 277
HLA-DQA1*02:01/DQB1*06:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 573 247
HLA-DQA1*02:01/DQB1*03:03 GSSRGTSPARMAGNGG GSSMGTSPARMAGNGC 772 333
HLA-DQA1*02:01/DQB1*03:01 GSSRGTSPARMAGNGG GSSMGTSPARMAGNGC 183 79
HLA-DQA1*02:01/DQB1*03:19 GSSRGTSPARMAGNGG GSSMGTSPARMAGNGC 183 79
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 199 86
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 199 86
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 481 208
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 481 208
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARMAGN SRNSTPGSSMGTSPARMAGN 196 85
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARMAGN SRNSTPGSSMGTSPARMAGN 196 85
HLA-DQA1*06:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSMGTSPARMA 484 210
HLA-DQA1*06:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSMGTSPARMA 484 210
HLA-DQA1*05:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 333 145
HLA-DQA1*05:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 333 145
HLA-DQA1*02:01/DQB1*03:03 PGSSRGTSPARMAGNGGDAA PGSSMGTSPARMAGNGCDAA 766 334
HLA-DQA1*05:01/DQB1*03:03 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 878 383
HLA-DQA1*06:01/DQB1*03:01 SRNSTPGSSRGTSPARMAG SRNSTPGSSMGTSPARMAG 907 396
HLA-DQA1*06:01/DQB1*03:19 SRNSTPGSSRGTSPARMAG SRNSTPGSSMGTSPARMAG 907 396
HLA-DQA1*02:01/DQB1*03:01 GSSRGTSPARMAGNGGD GSSMGTSPARMAGNGCD 245 107
HLA-DQA1*02:01/DQB1*03:19 GSSRGTSPARMAGNGGD GSSMGTSPARMAGNGCD 245 107
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAALALL MGTSPARMAGNGCDAALALL 87 199
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAALALL MGTSPARMAGNGCDAALALL 87 199
HLA-DQA1*06:01/DQB1*03:01 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 491 215
HLA-DQA1*06:01/DQB1*03:19 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 491 215
HLA-DQA1*05:01/DQB1*04:02 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 1029 451
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAGNGG STPGSSMGTSPARMAGNGC 292 128
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAGNGG STPGSSMGTSPARMAGNGC 292 128
HLA-DQA1*01:03/DQB1*06:01 RNSTPGSSRGTSPARMAGN RNSTPGSSMGTSPARMAGN 494 217
HLA-DQA1*02:01/DQB1*03:01 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 132 58
HLA-DQA1*02:01/DQB1*03:19 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 132 58
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 416 183
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 416 183
HLA-DQA1*06:01/DQB1*06:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 799 352
HLA-DQA1*01:03/DQB1*06:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 323 143
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAALAL MGTSPARMAGNGCDAALAL 132 298
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAALAL MGTSPARMAGNGCDAALAL 132 298
HLA-DQA1*05:01/DQB1*03:03 SRNSTPGSSRGTSPARMAG SRNSTPGSSMGTSPARMAG 973 431
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGNGGD TPGSSMGTSPARMAGNGCD 300 133
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGNGGD TPGSSMGTSPARMAGNGCD 300 133
HLA-DQA1*06:01/DQB1*06:01 STPGSSRGTSPARMA STPGSSMGTSPARMA 865 384
HLA-DQA1*02:01/DQB1*03:03 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 610 271
HLA-DQA1*01:03/DQB1*06:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 333 148
HLA-DQA1*01:03/DQB1*06:02 SRNSTPGSSRGTSPARMAGN SRNSTPGSSMGTSPARMAGN 1103 491
HLA-DQA1*06:01/DQB1*03:01 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 424 189
HLA-DQA1*06:01/DQB1*03:19 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 424 189
HLA-DQA1*03:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 710 317
HLA-DQA1*03:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 710 317
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGNGG TPGSSMGTSPARMAGNGC 546 244
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGNGG TPGSSMGTSPARMAGNGC 546 244
HLA-DQA1*05:01/DQB1*03:03 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 712 319
HLA-DQA1*02:01/DQB1*03:01 PGSSRGTSPARMAGNGGDA PGSSMGTSPARMAGNGCDA 323 145
HLA-DQA1*02:01/DQB1*03:19 PGSSRGTSPARMAGNGGDA PGSSMGTSPARMAGNGCDA 323 145
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAGNGG NSTPGSSMGTSPARMAGNGC 202 91
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAGNGG NSTPGSSMGTSPARMAGNGC 202 91
HLA-DQA1*05:01/DQB1*03:03 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 962 434
HLA-DQA1*01:03/DQB1*06:01 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 430 194
HLA-DQA1*04:01/DQB1*06:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 1012 459
HLA-DQA1*01:03/DQB1*06:02 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 974 442
HLA-DQA1*02:01/DQB1*03:01 SRGTSPARMAGNGGD SMGTSPARMAGNGCD 229 104
HLA-DQA1*02:01/DQB1*03:19 SRGTSPARMAGNGGD SMGTSPARMAGNGCD 229 104
HLA-DQA1*01:03/DQB1*06:01 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 387 176
HLA-DQA1*06:01/DQB1*03:01 NSTPGSSRGTSPARMAGNG NSTPGSSMGTSPARMAGNG 787 358
HLA-DQA1*06:01/DQB1*03:19 NSTPGSSRGTSPARMAGNG NSTPGSSMGTSPARMAGNG 787 358
HLA-DQA1*05:01/DQB1*03:03 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 670 305
HLA-DQA1*01:03/DQB1*06:01 SRNSTPGSSRGTSPARMAG SRNSTPGSSMGTSPARMAG 562 256
HLA-DQA1*05:01/DQB1*03:03 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 832 379
HLA-DQA1*05:01/DQB1*03:03 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 888 405
HLA-DQA1*02:01/DQB1*03:01 SSRGTSPARMAGNGG SSMGTSPARMAGNGC 157 72
HLA-DQA1*02:01/DQB1*03:19 SSRGTSPARMAGNGG SSMGTSPARMAGNGC 157 72
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 484 222
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 484 222
HLA-DQA1*01:03/DQB1*06:01 RNSTPGSSRGTSPARMAG RNSTPGSSMGTSPARMAG 885 406
HLA-DQA1*03:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 586 269
HLA-DQA1*03:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 586 269
HLA-DQA1*03:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSMGTSPARMA 518 238
HLA-DQA1*03:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSMGTSPARMA 518 238
HLA-DQA1*01:03/DQB1*06:02 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 988 454
HLA-DQA1*02:01/DQB1*03:01 SSRGTSPARMAGNGGD SSMGTSPARMAGNGCD 211 97
HLA-DQA1*02:01/DQB1*03:19 SSRGTSPARMAGNGGD SSMGTSPARMAGNGCD 211 97
HLA-DQA1*02:01/DQB1*03:01 NSSRNSTPGSSRGTSPARMA NSSRNSTPGSSMGTSPARMA 239 110
HLA-DQA1*02:01/DQB1*03:19 NSSRNSTPGSSRGTSPARMA NSSRNSTPGSSMGTSPARMA 239 110
HLA-DQA1*06:01/DQB1*06:01 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 921 424
HLA-DQA1*02:01/DQB1*06:01 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 499 230
HLA-DQA1*01:03/DQB1*06:01 NSTPGSSRGTSPARMAGNG NSTPGSSMGTSPARMAGNG 462 213
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAGNGGD STPGSSMGTSPARMAGNGCD 208 96
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAGNGGD STPGSSMGTSPARMAGNGCD 208 96
HLA-DQA1*01:03/DQB1*06:01 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSMGTSPARMAG 392 181
HLA-DQA1*06:01/DQB1*03:01 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 634 293
HLA-DQA1*06:01/DQB1*03:19 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 634 293
HLA-DQA1*06:01/DQB1*03:01 RNSTPGSSRGTSPARMAGN RNSTPGSSMGTSPARMAGN 772 357
HLA-DQA1*06:01/DQB1*03:19 RNSTPGSSRGTSPARMAGN RNSTPGSSMGTSPARMAGN 772 357
HLA-DQA1*05:01/DQB1*03:01 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 430 199
HLA-DQA1*05:01/DQB1*03:19 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 430 199
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSMGTSPARMA 328 152
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSMGTSPARMA 328 152
HLA-DQA1*02:01/DQB1*03:01 SSRGTSPARMAGNGGDA SSMGTSPARMAGNGCDA 278 129
HLA-DQA1*02:01/DQB1*03:19 SSRGTSPARMAGNGGDA SSMGTSPARMAGNGCDA 278 129
HLA-DQA1*01:03/DQB1*06:01 NSTPGSSRGTSPARMAGNGG NSTPGSSMGTSPARMAGNGC 323 150
HLA-DQA1*01:03/DQB1*06:01 SRNSTPGSSRGTSPARMAGN SRNSTPGSSMGTSPARMAGN 331 154
HLA-DQA1*05:01/DQB1*03:03 STPGSSRGTSPARMA STPGSSMGTSPARMA 523 244
HLA-DQA1*03:01/DQB1*03:01 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 583 272
HLA-DQA1*03:01/DQB1*03:19 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 583 272
HLA-DQA1*06:01/DQB1*03:01 GSSRGTSPARMAGNGG GSSMGTSPARMAGNGC 535 250
HLA-DQA1*06:01/DQB1*03:19 GSSRGTSPARMAGNGG GSSMGTSPARMAGNGC 535 250
HLA-DQA1*01:03/DQB1*06:01 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 261 122
HLA-DQA1*02:01/DQB1*03:03 SSRGTSPARMAGNGGD SSMGTSPARMAGNGCD 827 387
HLA-DQA1*06:01/DQB1*03:01 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSMGTSPARMAG 692 324
HLA-DQA1*06:01/DQB1*03:19 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSMGTSPARMAG 692 324
HLA-DQA1*02:01/DQB1*06:01 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 474 222
HLA-DQA1*02:01/DQB1*03:01 PGSSRGTSPARMAGNGGD PGSSMGTSPARMAGNGCD 559 262
HLA-DQA1*02:01/DQB1*03:19 PGSSRGTSPARMAGNGGD PGSSMGTSPARMAGNGCD 559 262
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 644 302
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 644 302
HLA-DQA1*01:03/DQB1*06:01 STPGSSRGTSPARMAGNGG STPGSSMGTSPARMAGNGC 464 218
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 423 199
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 423 199
HLA-DQA1*02:01/DQB1*03:03 SSRGTSPARMAGNGG SSMGTSPARMAGNGC 652 307
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 403 190
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 403 190
HLA-DQA1*02:01/DQB1*03:01 SRGTSPARMAGNGGDAA SMGTSPARMAGNGCDAA 373 176
HLA-DQA1*02:01/DQB1*03:19 SRGTSPARMAGNGGDAA SMGTSPARMAGNGCDAA 373 176
HLA-DQA1*05:01/DQB1*03:01 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 273 129
HLA-DQA1*05:01/DQB1*03:19 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 273 129
HLA-DQA1*02:01/DQB1*03:01 SSRNSTPGSSRGTSPAR SSRNSTPGSSMGTSPAR 535 253
HLA-DQA1*02:01/DQB1*03:19 SSRNSTPGSSRGTSPAR SSRNSTPGSSMGTSPAR 535 253
HLA-DQA1*05:01/DQB1*03:03 SRNSTPGSSRGTSPARMAGN SRNSTPGSSMGTSPARMAGN 683 323
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 338 160
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 338 160
HLA-DQA1*02:01/DQB1*03:01 PGSSRGTSPARMAGNGGDAA PGSSMGTSPARMAGNGCDAA 226 107
HLA-DQA1*02:01/DQB1*03:19 PGSSRGTSPARMAGNGGDAA PGSSMGTSPARMAGNGCDAA 226 107
HLA-DQA1*01:02/DQB1*06:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 378 179
HLA-DQA1*05:01/DQB1*04:02 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 977 463
HLA-DQA1*01:03/DQB1*06:01 STPGSSRGTSPARMAGNGGD STPGSSMGTSPARMAGNGCD 318 151
HLA-DQA1*05:01/DQB1*04:02 STPGSSRGTSPARMA STPGSSMGTSPARMA 1036 492
HLA-DQA1*06:01/DQB1*03:01 STPGSSRGTSPARMAGNGG STPGSSMGTSPARMAGNGC 806 383
HLA-DQA1*06:01/DQB1*03:19 STPGSSRGTSPARMAGNGG STPGSSMGTSPARMAGNGC 806 383
HLA-DQA1*05:01/DQB1*06:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 812 386
HLA-DQA1*06:01/DQB1*03:01 RGTSPARMAGNGGDAALALL MGTSPARMAGNGCDAALALL 251 528
HLA-DQA1*06:01/DQB1*03:19 RGTSPARMAGNGGDAALALL MGTSPARMAGNGCDAALALL 251 528
HLA-DQA1*05:01/DQB1*03:03 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSMGTSPARMAG 723 344
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAGNGGDA TPGSSMGTSPARMAGNGCDA 212 101
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAGNGGDA TPGSSMGTSPARMAGNGCDA 212 101
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 258 123
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 258 123
HLA-DQA1*02:01/DQB1*03:03 SRGTSPARMAGNGGD SMGTSPARMAGNGCD 950 453
HLA-DQA1*02:01/DQB1*06:01 SSRGTSPARMAGNGG SSMGTSPARMAGNGC 568 271
HLA-DQA1*06:01/DQB1*03:01 SSRGTSPARMAGNGG SSMGTSPARMAGNGC 549 262
HLA-DQA1*06:01/DQB1*03:19 SSRGTSPARMAGNGG SSMGTSPARMAGNGC 549 262
HLA-DQA1*02:01/DQB1*03:01 SRGTSPARMAGNGGDA SMGTSPARMAGNGCDA 299 143
HLA-DQA1*02:01/DQB1*03:19 SRGTSPARMAGNGGDA SMGTSPARMAGNGCDA 299 143
HLA-DQA1*01:03/DQB1*06:02 NSTPGSSRGTSPARMAGNGG NSTPGSSMGTSPARMAGNGC 948 454
HLA-DQA1*02:01/DQB1*06:01 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 691 331
HLA-DQA1*02:01/DQB1*03:03 GSSRGTSPARMAGNGGDAA GSSMGTSPARMAGNGCDAA 960 460
HLA-DQA1*03:01/DQB1*03:01 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 586 281
HLA-DQA1*03:01/DQB1*03:19 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 586 281
HLA-DQA1*01:03/DQB1*06:02 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 1023 491
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 452 217
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 452 217
HLA-DQA1*01:03/DQB1*06:01 NSTPGSSRGTSPARMAGN NSTPGSSMGTSPARMAGN 706 339
HLA-DQA1*06:01/DQB1*03:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 589 283
HLA-DQA1*06:01/DQB1*03:19 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 589 283
HLA-DQA1*05:01/DQB1*03:01 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 333 160
HLA-DQA1*05:01/DQB1*03:19 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 333 160
HLA-DQA1*05:01/DQB1*03:03 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 679 327
HLA-DQA1*02:01/DQB1*03:01 GSSRGTSPARMAGNGGDAA GSSMGTSPARMAGNGCDAA 328 158
HLA-DQA1*02:01/DQB1*03:19 GSSRGTSPARMAGNGGDAA GSSMGTSPARMAGNGCDAA 328 158
HLA-DQA1*05:01/DQB1*03:03 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 504 243
HLA-DQA1*03:01/DQB1*03:01 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 477 230
HLA-DQA1*03:01/DQB1*03:19 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 477 230
HLA-DQA1*05:01/DQB1*03:03 RNSTPGSSRGTSPARMAGN RNSTPGSSMGTSPARMAGN 875 422
HLA-DQA1*05:01/DQB1*03:03 STPGSSRGTSPARMAGNGGD STPGSSMGTSPARMAGNGCD 742 358
HLA-DQA1*01:03/DQB1*06:01 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 337 163
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDA MGTSPARMAGNGCDA 436 211
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDA MGTSPARMAGNGCDA 436 211
HLA-DQA1*01:03/DQB1*06:01 SRGTSPARMAGNGGD SMGTSPARMAGNGCD 405 196
HLA-DQA1*01:03/DQB1*06:01 TPGSSRGTSPARMAGNGGD TPGSSMGTSPARMAGNGCD 448 217
HLA-DQA1*06:01/DQB1*03:01 SSRNSTPGSSRGTSPARMA SSRNSTPGSSMGTSPARMA 871 422
HLA-DQA1*06:01/DQB1*03:19 SSRNSTPGSSRGTSPARMA SSRNSTPGSSMGTSPARMA 871 422
HLA-DQA1*05:01/DQB1*03:03 TPGSSRGTSPARMAGNGGD TPGSSMGTSPARMAGNGCD 1001 485
HLA-DQA1*02:01/DQB1*03:01 GSSRGTSPARMAGNGGDA GSSMGTSPARMAGNGCDA 584 283
HLA-DQA1*02:01/DQB1*03:19 GSSRGTSPARMAGNGGDA GSSMGTSPARMAGNGCDA 584 283
HLA-DQA1*06:01/DQB1*03:01 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 686 333
HLA-DQA1*06:01/DQB1*03:19 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 686 333
HLA-DQA1*06:01/DQB1*03:01 SRGTSPARMAGNGGD SMGTSPARMAGNGCD 805 391
HLA-DQA1*06:01/DQB1*03:19 SRGTSPARMAGNGGD SMGTSPARMAGNGCD 805 391
HLA-DQA1*01:03/DQB1*06:01 TPGSSRGTSPARMAGNGGDA TPGSSMGTSPARMAGNGCDA 317 154
HLA-DQA1*05:01/DQB1*03:03 NSTPGSSRGTSPARMAGNGG NSTPGSSMGTSPARMAGNGC 706 343
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 469 228
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSMGTSPARMA 469 228
HLA-DQA1*02:01/DQB1*06:01 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 582 283
HLA-DQA1*02:01/DQB1*06:01 NSTPGSSRGTSPARMAG NSTPGSSMGTSPARMAG 779 379
HLA-DQA1*01:03/DQB1*06:01 PGSSRGTSPARMAGNGGDA PGSSMGTSPARMAGNGCDA 457 223
HLA-DQA1*01:03/DQB1*06:01 STPGSSRGTSPARMA STPGSSMGTSPARMA 348 170
HLA-DQA1*01:02/DQB1*06:01 STPGSSRGTSPARMAG STPGSSMGTSPARMAG 436 213
HLA-DQA1*01:03/DQB1*06:01 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 309 151
HLA-DQA1*05:01/DQB1*03:03 STPGSSRGTSPARMAGNGG STPGSSMGTSPARMAGNGC 934 457
HLA-DQA1*06:01/DQB1*03:01 RNSTPGSSRGTSPARM RNSTPGSSMGTSPARM 815 399
HLA-DQA1*06:01/DQB1*03:19 RNSTPGSSRGTSPARM RNSTPGSSMGTSPARM 815 399
HLA-DQA1*02:01/DQB1*06:01 GSSRGTSPARMAGNGGD GSSMGTSPARMAGNGCD 768 376
HLA-DQA1*01:03/DQB1*06:02 TPGSSRGTSPARMAGN TPGSSMGTSPARMAGN 913 447
HLA-DQA1*01:02/DQB1*06:01 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSMGTSPARMAG 398 195
HLA-DQA1*06:01/DQB1*06:01 NSTPGSSRGTSPARMA NSTPGSSMGTSPARMA 1002 491
HLA-DQA1*02:01/DQB1*06:01 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 578 284
HLA-DQA1*06:01/DQB1*03:01 SRNSTPGSSRGTSPARMAGN SRNSTPGSSMGTSPARMAGN 582 286
HLA-DQA1*06:01/DQB1*03:19 SRNSTPGSSRGTSPARMAGN SRNSTPGSSMGTSPARMAGN 582 286
HLA-DQA1*05:01/DQB1*03:03 NSTPGSSRGTSPARMAGNG NSTPGSSMGTSPARMAGNG 887 436
HLA-DQA1*02:01/DQB1*03:03 NSTPGSSRGTSPARM NSTPGSSMGTSPARM 933 459
HLA-DQA1*02:01/DQB1*03:01 RNSSRNSTPGSSRGTSPAR RNSSRNSTPGSSMGTSPAR 660 325
HLA-DQA1*02:01/DQB1*03:19 RNSSRNSTPGSSRGTSPAR RNSSRNSTPGSSMGTSPAR 660 325
HLA-DQA1*03:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 402 198
HLA-DQA1*03:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 402 198
HLA-DQA1*05:01/DQB1*03:03 GSSRGTSPARMAGNGGD GSSMGTSPARMAGNGCD 946 466
HLA-DQA1*01:03/DQB1*06:02 PGSSRGTSPARMAGN PGSSMGTSPARMAGN 749 369
HLA-DQA1*05:01/DQB1*03:03 SSRNSTPGSSRGTSPARMA SSRNSTPGSSMGTSPARMA 904 446
HLA-DQA1*01:03/DQB1*06:02 STPGSSRGTSPARMAGNGGD STPGSSMGTSPARMAGNGCD 914 451
HLA-DQA1*06:01/DQB1*03:01 NSTPGSSRGTSPARMAGNGG NSTPGSSMGTSPARMAGNGC 614 303
HLA-DQA1*06:01/DQB1*03:19 NSTPGSSRGTSPARMAGNGG NSTPGSSMGTSPARMAGNGC 614 303
HLA-DQA1*05:01/DQB1*03:03 TPGSSRGTSPARMAGNGGDA TPGSSMGTSPARMAGNGCDA 774 382
HLA-DQA1*02:01/DQB1*06:01 TPGSSRGTSPARMAGNG TPGSSMGTSPARMAGNG 650 322
HLA-DQA1*02:01/DQB1*06:01 STPGSSRGTSPARMA STPGSSMGTSPARMA 605 300
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAALA MGTSPARMAGNGCDAALA 491 990
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAALA MGTSPARMAGNGCDAALA 491 990
HLA-DQA1*02:01/DQB1*06:01 SSRGTSPARMAGNGGDA SSMGTSPARMAGNGCDA 867 430
HLA-DQA1*01:02/DQB1*06:02 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 1008 500
HLA-DQA1*01:03/DQB1*03:01 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 631 314
HLA-DQA1*01:03/DQB1*03:19 TPGSSRGTSPARMAG TPGSSMGTSPARMAG 631 314
HLA-DQA1*02:01/DQB1*06:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSMGTSPARMAGNG 673 335
HLA-DQA1*05:01/DQB1*03:03 GSSRGTSPARMAGNGG GSSMGTSPARMAGNGC 711 354
HLA-DQA1*01:03/DQB1*06:01 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 245 122
HLA-DQA1*01:03/DQB1*06:01 SRGTSPARMAGNGGDA SMGTSPARMAGNGCDA 500 249
HLA-DQA1*02:01/DQB1*06:01 SRGTSPARMAGNGGD SMGTSPARMAGNGCD 767 382
HLA-DQA1*02:01/DQB1*06:01 PGSSRGTSPARMAGNGG PGSSMGTSPARMAGNGC 682 340
HLA-DQA1*02:01/DQB1*06:01 STPGSSRGTSPARMAGN STPGSSMGTSPARMAGN 671 335
HLA-DQA1*05:01/DQB1*06:01 GSSRGTSPARMAGNG GSSMGTSPARMAGNG 697 348
HLA-DQA1*05:01/DQB1*03:01 SRNSTPGSSRGTSPAR SRNSTPGSSMGTSPAR 775 387
HLA-DQA1*05:01/DQB1*03:19 SRNSTPGSSRGTSPAR SRNSTPGSSMGTSPAR 775 387
HLA-DQA1*01:03/DQB1*06:01 PGSSRGTSPARMAGNG PGSSMGTSPARMAGNG 292 146
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAA MGTSPARMAGNGCDAA 484 242
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAA MGTSPARMAGNGCDAA 484 242

G215C

Reference  SRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SRNSSRNSTPGSSMGTSPARMAGNGCDAALALLLLDRLNQLESKMSGKGQQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALL ARMAGNGCDAALALL 58 423
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALL ARMAGNGCDAALALL 58 423
HLA-DQA1*05:01/DQB1*03:01 RMAGNGGDAALALLL RMAGNGCDAALALLL 54 360
HLA-DQA1*05:01/DQB1*03:19 RMAGNGGDAALALLL RMAGNGCDAALALLL 54 360
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALAL PARMAGNGCDAALAL 70 438
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALAL PARMAGNGCDAALAL 70 438
HLA-DQA1*05:01/DQB1*03:01 SPARMAGNGGDAALALL SPARMAGNGCDAALALL 99 610
HLA-DQA1*05:01/DQB1*03:19 SPARMAGNGGDAALALL SPARMAGNGCDAALALL 99 610
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALALLL PARMAGNGCDAALALLL 86 522
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALALLL PARMAGNGCDAALALLL 86 522
HLA-DQA1*05:01/DQB1*03:01 PARMAGNGGDAALALL PARMAGNGCDAALALL 75 449
HLA-DQA1*05:01/DQB1*03:19 PARMAGNGGDAALALL PARMAGNGCDAALALL 75 449
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALLLL ARMAGNGCDAALALLLL 88 524
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALLLL ARMAGNGCDAALALLLL 88 524
HLA-DQA1*05:01/DQB1*03:01 ARMAGNGGDAALALLL ARMAGNGCDAALALLL 66 387
HLA-DQA1*05:01/DQB1*03:19 ARMAGNGGDAALALLL ARMAGNGCDAALALLL 66 387
HLA-DQA1*05:01/DQB1*03:01 RMAGNGGDAALALLLL RMAGNGCDAALALLLL 71 407
HLA-DQA1*05:01/DQB1*03:19 RMAGNGGDAALALLLL RMAGNGCDAALALLLL 71 407
HLA-DQA1*05:01/DQB1*03:01 MAGNGGDAALALLLL MAGNGCDAALALLLL 72 412
HLA-DQA1*05:01/DQB1*03:19