Summary

This strain contains 20 protein-level mutations:

  • 9 mutations in Spike protein: HV 69-70 deletion, Y144 deletion, N501Y, A570D, D614G, P681H, T716I, S982A, D1118H
  • 3 mutations in N protein: D3L, 203-204 RG->KR, S235F
  • 1 mutation in NS8 protein: Q27stop
  • 1 mutation in NS9c protein: G50N
  • 3 mutations in NSP3 protein: T183I, A890D, I1412T
  • 1 mutation in NSP6 protein: SGF 106-108 deletion
  • 1 mutation in NSP9 protein: D78N
  • 1 mutation in NSP12 protein: P323L

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

HV 69-70 deletion

Reference  RSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAST
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    RSSVLHSTQDLFLPFFSNVTWFHAI‑‑SGTNGTKRFDNPVLPFNDGVYFAST

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*02:01 TQDLFLPFFSNVTWFHAIHV - 30 -
HLA-DPA1*03:01/DPB1*02:01 STQDLFLPFFSNVTWFHAIH - 31 -
HLA-DPA1*03:01/DPB1*02:01 QDLFLPFFSNVTWFHAIHV - 35 -
HLA-DPA1*03:01/DPB1*02:01 LFLPFFSNVTWFHAIHV - 35 -
HLA-DPA1*03:01/DPB1*02:01 DLFLPFFSNVTWFHAIH - 36 -
HLA-DPA1*03:01/DPB1*02:01 TQDLFLPFFSNVTWFHAIH - 38 -
HLA-DRB1*10:01 DLFLPFFSNVTWFHAIH - 40 -
HLA-DRB1*10:01 LFLPFFSNVTWFHAIHV - 41 -
HLA-DRB1*10:01 TQDLFLPFFSNVTWFHAIHV - 42 -
HLA-DPA1*03:01/DPB1*02:01 LFLPFFSNVTWFHAIH - 43 -
HLA-DRB1*15:01 TQDLFLPFFSNVTWFHAIHV - 43 -
HLA-DRB1*10:01 STQDLFLPFFSNVTWFHAIH - 46 -
HLA-DRB1*10:01 LFLPFFSNVTWFHAIH - 46 -
HLA-DRB1*15:01 LFLPFFSNVTWFHAIHV - 50 -
HLA-DRB1*10:01 QDLFLPFFSNVTWFHAIHV - 51 -
HLA-DQA1*01:02/DQB1*05:01 TQDLFLPFFSNVTWFHAIHV - 52 -
HLA-DRB1*10:01 TQDLFLPFFSNVTWFHAIH - 55 -
HLA-DPA1*03:01/DPB1*02:01 DLFLPFFSNVTWFHAIHV - 57 -
HLA-DPA1*03:01/DPB1*04:01 TQDLFLPFFSNVTWFHAIHV - 57 -
HLA-DPA1*03:01/DPB1*02:01 QDLFLPFFSNVTWFHAIH - 58 -
HLA-DPA1*03:01/DPB1*04:01 STQDLFLPFFSNVTWFHAIH - 60 -
HLA-DRB1*01:01 TQDLFLPFFSNVTWFHAIHV - 60 -
HLA-DRB1*01:01 LFLPFFSNVTWFHAIHV - 60 -
HLA-DPA1*03:01/DPB1*04:01 QDLFLPFFSNVTWFHAIHV - 61 -
HLA-DRB1*16:01 TQDLFLPFFSNVTWFHAIHV - 61 -
HLA-DPA1*03:01/DPB1*04:01 TQDLFLPFFSNVTWFHAIH - 62 -
HLA-DPA1*03:01/DPB1*04:01 LFLPFFSNVTWFHAIHV - 62 -
HLA-DQA1*01:02/DQB1*05:01 QDLFLPFFSNVTWFHAIHV - 62 -
HLA-DRB1*07:01 LFLPFFSNVTWFHAIHV - 63 -
HLA-DRB1*15:01 QDLFLPFFSNVTWFHAIHV - 64 -
HLA-DRB1*15:02 TQDLFLPFFSNVTWFHAIHV - 65 -
HLA-DRB1*07:01 TQDLFLPFFSNVTWFHAIHV - 66 -
HLA-DPA1*03:01/DPB1*04:01 DLFLPFFSNVTWFHAIH - 67 -
HLA-DQA1*01:02/DQB1*05:01 LFLPFFSNVTWFHAIHV - 68 -
HLA-DRB1*16:01 STQDLFLPFFSNVTWFHAIH - 68 -
HLA-DPA1*03:01/DPB1*01:01 TQDLFLPFFSNVTWFHAIHV - 69 -
HLA-DPA1*04:01/DPB1*02:01 STQDLFLPFFSNVTWFHAIH - 70 -
HLA-DPA1*04:01/DPB1*02:01 TQDLFLPFFSNVTWFHAIHV - 71 -
HLA-DQA1*01:02/DQB1*05:01 STQDLFLPFFSNVTWFHAIH - 71 -
HLA-DRB1*15:01 STQDLFLPFFSNVTWFHAIH - 72 -
HLA-DRB1*01:01 STQDLFLPFFSNVTWFHAIH - 73 -
HLA-DPA1*03:01/DPB1*01:01 STQDLFLPFFSNVTWFHAIH - 74 -
HLA-DRB1*01:01 DLFLPFFSNVTWFHAIH - 75 -
HLA-DPA1*03:01/DPB1*04:01 LFLPFFSNVTWFHAIH - 77 -
HLA-DPA1*04:01/DPB1*02:01 DLFLPFFSNVTWFHAIH - 79 -
HLA-DPA1*04:01/DPB1*01:01 TQDLFLPFFSNVTWFHAIHV - 84 -
HLA-DQA1*01:03/DQB1*05:01 TQDLFLPFFSNVTWFHAIHV - 84 -
HLA-DPA1*04:01/DPB1*02:01 LFLPFFSNVTWFHAIHV - 85 -
HLA-DRB1*10:01 QDLFLPFFSNVTWFHAIH - 85 -
HLA-DRB1*16:01 QDLFLPFFSNVTWFHAIHV - 85 -
HLA-DPA1*04:01/DPB1*02:01 TQDLFLPFFSNVTWFHAIH - 86 -
HLA-DPA1*04:01/DPB1*02:01 LFLPFFSNVTWFHAIH - 86 -
HLA-DQA1*01:02/DQB1*05:01 TQDLFLPFFSNVTWFHAIH - 86 -
HLA-DRB1*15:03 LFLPFFSNVTWFHAIHV - 86 -
HLA-DRB1*01:01 QDLFLPFFSNVTWFHAIHV - 87 -
HLA-DPA1*04:01/DPB1*02:01 QDLFLPFFSNVTWFHAIHV - 88 -
HLA-DRB1*15:03 TQDLFLPFFSNVTWFHAIHV - 88 -
HLA-DRB1*16:01 DLFLPFFSNVTWFHAIH - 88 -
HLA-DRB1*10:01 DLFLPFFSNVTWFHAIHV - 89 -
HLA-DPA1*01:03/DPB1*02:01 STQDLFLPFFSNVTWFHAIH - 90 -
HLA-DPA1*03:01/DPB1*01:01 QDLFLPFFSNVTWFHAIHV - 90 -
HLA-DQA1*01:02/DQB1*05:01 DLFLPFFSNVTWFHAIHV - 90 -
HLA-DRB1*16:01 TQDLFLPFFSNVTWFHAIH - 90 -
HLA-DPA1*01:03/DPB1*02:01 TQDLFLPFFSNVTWFHAIHV - 91 -
HLA-DPA1*04:01/DPB1*01:01 STQDLFLPFFSNVTWFHAIH - 91 -
HLA-DRB1*07:01 QDLFLPFFSNVTWFHAIHV - 91 -
HLA-DPA1*03:01/DPB1*01:01 TQDLFLPFFSNVTWFHAIH - 94 -
HLA-DRB1*15:02 STQDLFLPFFSNVTWFHAIH - 94 -
HLA-DRB1*16:01 LFLPFFSNVTWFHAIHV - 94 -
HLA-DPA1*01:03/DPB1*02:01 DLFLPFFSNVTWFHAIH - 95 -
HLA-DPA1*01:03/DPB1*02:01 LFLPFFSNVTWFHAIHV - 95 -
HLA-DQA1*01:03/DQB1*05:01 LFLPFFSNVTWFHAIHV - 95 -
HLA-DRB1*01:01 LFLPFFSNVTWFHAIH - 95 -
HLA-DRB1*15:02 LFLPFFSNVTWFHAIHV - 96 -
HLA-DRB1*15:02 QDLFLPFFSNVTWFHAIHV - 98 -
HLA-DPA1*03:01/DPB1*01:01 LFLPFFSNVTWFHAIHV - 99 -
HLA-DPA1*03:01/DPB1*04:01 QDLFLPFFSNVTWFHAIH - 99 -
HLA-DQA1*01:02/DQB1*05:01 LFLPFFSNVTWFHAIH - 100 -
HLA-DPA1*03:01/DPB1*04:01 DLFLPFFSNVTWFHAIHV - 101 -
HLA-DQA1*01:02/DQB1*05:01 DLFLPFFSNVTWFHAIH - 102 -
HLA-DRB1*15:01 DLFLPFFSNVTWFHAIH - 104 -
HLA-DPA1*04:01/DPB1*01:01 QDLFLPFFSNVTWFHAIHV - 106 -
HLA-DRB1*04:01 DLFLPFFSNVTWFHAIH - 106 -
HLA-DQA1*01:03/DQB1*05:01 STQDLFLPFFSNVTWFHAIH - 107 -
HLA-DQA1*01:03/DQB1*05:01 QDLFLPFFSNVTWFHAIHV - 107 -
HLA-DPA1*04:01/DPB1*01:01 TQDLFLPFFSNVTWFHAIH - 108 -
HLA-DRB1*01:01 TQDLFLPFFSNVTWFHAIH - 108 -
HLA-DPA1*01:03/DPB1*02:01 TQDLFLPFFSNVTWFHAIH - 111 -
HLA-DPA1*04:01/DPB1*04:01 TQDLFLPFFSNVTWFHAIHV - 111 -
HLA-DRB1*07:01 STQDLFLPFFSNVTWFHAIH - 111 -
HLA-DRB1*15:01 TQDLFLPFFSNVTWFHAIH - 111 -
HLA-DPA1*03:01/DPB1*01:01 DLFLPFFSNVTWFHAIH - 112 -
HLA-DRB1*04:01 LFLPFFSNVTWFHAIH - 114 -
HLA-DPA1*03:01/DPB1*01:01 LFLPFFSNVTWFHAIH - 115 -
HLA-DPA1*01:03/DPB1*02:01 QDLFLPFFSNVTWFHAIHV - 116 -
HLA-DQA1*01:02/DQB1*05:01 QDLFLPFFSNVTWFHAIH - 116 -
HLA-DPA1*01:03/DPB1*02:01 LFLPFFSNVTWFHAIH - 117 -
HLA-DPA1*04:01/DPB1*01:01 LFLPFFSNVTWFHAIHV - 117 -
HLA-DPA1*04:01/DPB1*04:01 STQDLFLPFFSNVTWFHAIH - 117 -
HLA-DRB1*04:01 LFLPFFSNVTWFHAIHV - 117 -
HLA-DRB1*16:01 LFLPFFSNVTWFHAIH - 118 -
HLA-DPA1*04:01/DPB1*01:01 DLFLPFFSNVTWFHAIH - 119 -
HLA-DPA1*04:01/DPB1*04:01 LFLPFFSNVTWFHAIHV - 120 -
HLA-DRB1*07:01 DLFLPFFSNVTWFHAIH - 120 -
HLA-DPA1*01:03/DPB1*01:01 STQDLFLPFFSNVTWFHAIH - 123 -
HLA-DPA1*04:01/DPB1*01:01 LFLPFFSNVTWFHAIH - 123 -
HLA-DPA1*04:01/DPB1*04:01 DLFLPFFSNVTWFHAIH - 124 -
HLA-DPA1*01:03/DPB1*01:01 TQDLFLPFFSNVTWFHAIHV - 125 -
HLA-DPA1*03:01/DPB1*04:02 STQDLFLPFFSNVTWFHAIH - 125 -
HLA-DPA1*03:01/DPB1*105:01 STQDLFLPFFSNVTWFHAIH - 125 -
HLA-DPA1*04:01/DPB1*04:01 TQDLFLPFFSNVTWFHAIH - 127 -
HLA-DPA1*04:01/DPB1*04:01 QDLFLPFFSNVTWFHAIHV - 127 -
HLA-DQA1*01:03/DQB1*05:01 LFLPFFSNVTWFHAIH - 127 -
HLA-DPA1*03:01/DPB1*04:02 TQDLFLPFFSNVTWFHAIHV - 128 -
HLA-DPA1*03:01/DPB1*105:01 TQDLFLPFFSNVTWFHAIHV - 128 -
HLA-DRB1*15:03 QDLFLPFFSNVTWFHAIHV - 128 -
HLA-DPA1*02:02/DPB1*01:01 TQDLFLPFFSNVTWFHAIHV - 135 -
HLA-DRB1*15:01 DLFLPFFSNVTWFHAIHV - 135 -
HLA-DPA1*03:01/DPB1*01:01 DLFLPFFSNVTWFHAIHV - 136 -
HLA-DQA1*01:03/DQB1*05:01 DLFLPFFSNVTWFHAIH - 137 -
HLA-DPA1*03:01/DPB1*01:01 QDLFLPFFSNVTWFHAIH - 139 -
HLA-DPA1*03:01/DPB1*04:02 DLFLPFFSNVTWFHAIH - 139 -
HLA-DPA1*03:01/DPB1*105:01 DLFLPFFSNVTWFHAIH - 139 -
HLA-DPA1*02:02/DPB1*01:01 STQDLFLPFFSNVTWFHAIH - 140 -
HLA-DPA1*04:01/DPB1*02:01 QDLFLPFFSNVTWFHAIH - 140 -
HLA-DPA1*03:01/DPB1*04:02 LFLPFFSNVTWFHAIHV - 141 -
HLA-DPA1*03:01/DPB1*105:01 LFLPFFSNVTWFHAIHV - 141 -
HLA-DPA1*04:01/DPB1*04:01 LFLPFFSNVTWFHAIH - 142 -
HLA-DRB1*04:01 TQDLFLPFFSNVTWFHAIHV - 142 -
HLA-DRB1*15:02 DLFLPFFSNVTWFHAIH - 142 -
HLA-DRB1*04:01 STQDLFLPFFSNVTWFHAIH - 143 -
HLA-DRB1*15:02 TQDLFLPFFSNVTWFHAIH - 144 -
HLA-DPA1*01:03/DPB1*04:01 STQDLFLPFFSNVTWFHAIH - 145 -
HLA-DPA1*01:03/DPB1*04:01 LFLPFFSNVTWFHAIHV - 146 -
HLA-DPA1*01:03/DPB1*04:01 DLFLPFFSNVTWFHAIH - 147 -
HLA-DQA1*01:03/DQB1*05:01 TQDLFLPFFSNVTWFHAIH - 147 -
HLA-DRB1*07:01 LFLPFFSNVTWFHAIH - 147 -
HLA-DPA1*01:03/DPB1*04:01 TQDLFLPFFSNVTWFHAIH - 148 -
HLA-DPA1*01:03/DPB1*04:01 TQDLFLPFFSNVTWFHAIHV - 148 -
HLA-DPA1*04:01/DPB1*02:01 DLFLPFFSNVTWFHAIHV - 149 -
HLA-DPA1*01:03/DPB1*01:01 TQDLFLPFFSNVTWFHAIH - 151 -
HLA-DPA1*03:01/DPB1*04:02 TQDLFLPFFSNVTWFHAIH - 152 -
HLA-DPA1*03:01/DPB1*105:01 TQDLFLPFFSNVTWFHAIH - 152 -
HLA-DPA1*03:01/DPB1*04:02 QDLFLPFFSNVTWFHAIHV - 153 -
HLA-DPA1*03:01/DPB1*105:01 QDLFLPFFSNVTWFHAIHV - 153 -
HLA-DRB1*04:01 TQDLFLPFFSNVTWFHAIH - 155 -
HLA-DRB1*15:03 STQDLFLPFFSNVTWFHAIH - 155 -
HLA-DPA1*03:01/DPB1*05:01 STQDLFLPFFSNVTWFHAIH - 158 -
HLA-DPA1*03:01/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV - 160 -
HLA-DRB1*04:01 QDLFLPFFSNVTWFHAIHV - 160 -
HLA-DPA1*01:03/DPB1*04:01 QDLFLPFFSNVTWFHAIHV - 161 -
HLA-DRB1*07:01 TQDLFLPFFSNVTWFHAIH - 161 -
HLA-DPA1*01:03/DPB1*01:01 QDLFLPFFSNVTWFHAIHV - 162 -
HLA-DPA1*02:02/DPB1*01:01 LFLPFFSNVTWFHAIHV - 162 -
HLA-DRB1*04:04 TQDLFLPFFSNVTWFHAIHV - 164 -
HLA-DRB1*04:04 STQDLFLPFFSNVTWFHAIH - 166 -
HLA-DPA1*04:01/DPB1*01:01 DLFLPFFSNVTWFHAIHV - 167 -
HLA-DRB1*04:04 DLFLPFFSNVTWFHAIH - 167 -
HLA-DPA1*04:01/DPB1*01:01 QDLFLPFFSNVTWFHAIH - 168 -
HLA-DPA1*02:02/DPB1*01:01 DLFLPFFSNVTWFHAIH - 172 -
HLA-DPA1*02:02/DPB1*01:01 QDLFLPFFSNVTWFHAIHV - 173 -
HLA-DPA1*03:01/DPB1*04:02 LFLPFFSNVTWFHAIH - 176 -
HLA-DPA1*03:01/DPB1*105:01 LFLPFFSNVTWFHAIH - 176 -
HLA-DRB1*15:03 DLFLPFFSNVTWFHAIH - 176 -
HLA-DPA1*02:02/DPB1*01:01 TQDLFLPFFSNVTWFHAIH - 179 -
HLA-DPA1*01:03/DPB1*02:01 QDLFLPFFSNVTWFHAIH - 183 -
HLA-DPA1*01:03/DPB1*04:01 LFLPFFSNVTWFHAIH - 185 -
HLA-DPA1*01:03/DPB1*01:01 DLFLPFFSNVTWFHAIH - 186 -
HLA-DRB1*07:01 DLFLPFFSNVTWFHAIHV - 186 -
HLA-DPA1*03:01/DPB1*13:01 TQDLFLPFFSNVTWFHAIHV - 187 -
HLA-DQA1*01:03/DQB1*05:01 DLFLPFFSNVTWFHAIHV - 187 -
HLA-DRB1*04:04 LFLPFFSNVTWFHAIHV - 187 -
HLA-DPA1*01:03/DPB1*02:01 DLFLPFFSNVTWFHAIHV - 189 -
HLA-DPA1*01:03/DPB1*01:01 LFLPFFSNVTWFHAIHV - 190 -
HLA-DRB1*15:01 LFLPFFSNVTWFHAIH - 191 -
HLA-DPA1*04:01/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV - 192 -
HLA-DQA1*01:02/DQB1*05:03 TQDLFLPFFSNVTWFHAIHV - 194 -
HLA-DRB1*16:01 QDLFLPFFSNVTWFHAIH - 194 -
HLA-DPA1*02:02/DPB1*01:01 LFLPFFSNVTWFHAIH - 196 -
HLA-DPA1*01:03/DPB1*01:01 LFLPFFSNVTWFHAIH - 197 -
HLA-DRB1*15:02 DLFLPFFSNVTWFHAIHV - 200 -
HLA-DRB1*15:02 LFLPFFSNVTWFHAIH - 200 -
HLA-DPA1*02:01/DPB1*01:01 STQDLFLPFFSNVTWFHAIH - 201 -
HLA-DPA1*02:01/DPB1*01:01 TQDLFLPFFSNVTWFHAIHV - 206 -
HLA-DRB1*04:04 QDLFLPFFSNVTWFHAIHV - 207 -
HLA-DPA1*03:01/DPB1*11:01 TQDLFLPFFSNVTWFHAIHV - 208 -
HLA-DPA1*04:01/DPB1*05:01 STQDLFLPFFSNVTWFHAIH - 208 -
HLA-DPA1*02:02/DPB1*02:01 LFLPFFSNVTWFHAIHV - 211 -
HLA-DRB1*04:04 TQDLFLPFFSNVTWFHAIH - 212 -
HLA-DPA1*04:01/DPB1*04:01 QDLFLPFFSNVTWFHAIH - 213 -
HLA-DPA1*02:01/DPB1*01:01 TQDLFLPFFSNVTWFHAIH - 216 -
HLA-DPA1*04:01/DPB1*11:01 TQDLFLPFFSNVTWFHAIHV - 218 -
HLA-DRB1*01:01 DLFLPFFSNVTWFHAIHV - 220 -
HLA-DPA1*03:01/DPB1*06:01 TQDLFLPFFSNVTWFHAIHV - 222 -
HLA-DRB1*15:01 QDLFLPFFSNVTWFHAIH - 222 -
HLA-DRB1*04:04 LFLPFFSNVTWFHAIH - 224 -
HLA-DPA1*02:01/DPB1*01:01 DLFLPFFSNVTWFHAIH - 225 -
HLA-DPA1*04:01/DPB1*04:01 DLFLPFFSNVTWFHAIHV - 227 -
HLA-DRB1*16:01 DLFLPFFSNVTWFHAIHV - 227 -
HLA-DPA1*02:01/DPB1*01:01 QDLFLPFFSNVTWFHAIHV - 228 -
HLA-DPA1*02:02/DPB1*02:01 TQDLFLPFFSNVTWFHAIHV - 228 -
HLA-DPA1*02:02/DPB1*02:01 STQDLFLPFFSNVTWFHAIH - 230 -
HLA-DPA1*01:03/DPB1*01:01 QDLFLPFFSNVTWFHAIH - 232 -
HLA-DPA1*03:01/DPB1*05:01 QDLFLPFFSNVTWFHAIHV - 232 -
HLA-DQA1*01:03/DQB1*05:01 QDLFLPFFSNVTWFHAIH - 232 -
HLA-DRB1*15:03 TQDLFLPFFSNVTWFHAIH - 232 -
HLA-DPA1*03:01/DPB1*11:01 STQDLFLPFFSNVTWFHAIH - 234 -
HLA-DPA1*03:01/DPB1*13:01 QDLFLPFFSNVTWFHAIHV - 234 -
HLA-DQA1*01:02/DQB1*05:03 STQDLFLPFFSNVTWFHAIH - 234 -
HLA-DRB1*15:02 QDLFLPFFSNVTWFHAIH - 234 -
HLA-DQA1*01:02/DQB1*05:03 QDLFLPFFSNVTWFHAIHV - 235 -
HLA-DQA1*05:01/DQB1*04:02 LFLPFFSNVTWFHAIHV - 235 -
HLA-DRB1*04:01 QDLFLPFFSNVTWFHAIH - 235 -
HLA-DPA1*03:01/DPB1*05:01 TQDLFLPFFSNVTWFHAIH - 237 -
HLA-DPA1*02:01/DPB1*01:01 LFLPFFSNVTWFHAIHV - 238 -
HLA-DPA1*03:01/DPB1*04:02 QDLFLPFFSNVTWFHAIH - 240 -
HLA-DPA1*03:01/DPB1*105:01 QDLFLPFFSNVTWFHAIH - 240 -
HLA-DPA1*03:01/DPB1*13:01 STQDLFLPFFSNVTWFHAIH - 241 -
HLA-DPA1*03:01/DPB1*05:01 LFLPFFSNVTWFHAIHV - 243 -
HLA-DQA1*01:02/DQB1*05:03 LFLPFFSNVTWFHAIHV - 243 -
HLA-DRB1*01:01 QDLFLPFFSNVTWFHAIH - 243 -
HLA-DPA1*02:02/DPB1*01:01 QDLFLPFFSNVTWFHAIH - 249 -
HLA-DPA1*03:01/DPB1*04:02 DLFLPFFSNVTWFHAIHV - 249 -
HLA-DPA1*03:01/DPB1*105:01 DLFLPFFSNVTWFHAIHV - 249 -
HLA-DPA1*01:03/DPB1*01:01 DLFLPFFSNVTWFHAIHV - 252 -
HLA-DPA1*02:02/DPB1*01:01 DLFLPFFSNVTWFHAIHV - 252 -
HLA-DPA1*04:01/DPB1*11:01 STQDLFLPFFSNVTWFHAIH - 252 -
HLA-DPA1*04:01/DPB1*13:01 TQDLFLPFFSNVTWFHAIHV - 253 -
HLA-DPA1*02:02/DPB1*02:01 DLFLPFFSNVTWFHAIH - 258 -
HLA-DRB1*11:02 LFLPFFSNVTWFHAIHV - 261 -
HLA-DRB1*13:01 LFLPFFSNVTWFHAIHV - 261 -
HLA-DPA1*03:01/DPB1*06:01 STQDLFLPFFSNVTWFHAIH - 263 -
HLA-DPA1*02:01/DPB1*01:01 LFLPFFSNVTWFHAIH - 264 -
HLA-DPA1*02:01/DPB1*02:01 STQDLFLPFFSNVTWFHAIH - 264 -
HLA-DRB1*13:02 LFLPFFSNVTWFHAIHV - 267 -
HLA-DPA1*01:03/DPB1*04:01 QDLFLPFFSNVTWFHAIH - 270 -
HLA-DRB1*04:01 DLFLPFFSNVTWFHAIHV - 271 -
HLA-DRB1*13:02 TQDLFLPFFSNVTWFHAIHV - 272 -
HLA-DPA1*02:01/DPB1*02:01 TQDLFLPFFSNVTWFHAIHV - 274 -
HLA-DPA1*04:01/DPB1*05:01 LFLPFFSNVTWFHAIHV - 275 -
HLA-DPA1*04:01/DPB1*05:01 QDLFLPFFSNVTWFHAIHV - 277 -
HLA-DQA1*01:02/DQB1*05:03 TQDLFLPFFSNVTWFHAIH - 278 -
HLA-DPA1*02:02/DPB1*02:01 QDLFLPFFSNVTWFHAIHV - 280 -
HLA-DPA1*03:01/DPB1*17:01 TQDLFLPFFSNVTWFHAIHV - 281 -
HLA-DPA1*03:01/DPB1*05:01 DLFLPFFSNVTWFHAIH - 283 -
HLA-DPA1*01:03/DPB1*04:01 DLFLPFFSNVTWFHAIHV - 284 -
HLA-DPA1*02:01/DPB1*02:01 LFLPFFSNVTWFHAIHV - 284 -
HLA-DQA1*01:02/DQB1*05:03 DLFLPFFSNVTWFHAIHV - 284 -
HLA-DPA1*02:02/DPB1*02:01 LFLPFFSNVTWFHAIH - 285 -
HLA-DPA1*03:01/DPB1*11:01 QDLFLPFFSNVTWFHAIHV - 285 -
HLA-DRB1*15:03 LFLPFFSNVTWFHAIH - 287 -
HLA-DPA1*04:01/DPB1*06:01 TQDLFLPFFSNVTWFHAIHV - 288 -
HLA-DPA1*03:01/DPB1*13:01 LFLPFFSNVTWFHAIHV - 292 -
HLA-DPA1*02:01/DPB1*01:01 QDLFLPFFSNVTWFHAIH - 293 -
HLA-DPA1*02:01/DPB1*02:01 DLFLPFFSNVTWFHAIH - 295 -
HLA-DPA1*04:01/DPB1*04:02 TQDLFLPFFSNVTWFHAIHV - 295 -
HLA-DPA1*04:01/DPB1*105:01 TQDLFLPFFSNVTWFHAIHV - 295 -
HLA-DPA1*03:01/DPB1*13:01 TQDLFLPFFSNVTWFHAIH - 296 -
HLA-DQA1*01:03/DQB1*05:03 TQDLFLPFFSNVTWFHAIHV - 297 -
HLA-DRB1*07:01 QDLFLPFFSNVTWFHAIH - 298 -
HLA-DRB1*15:03 DLFLPFFSNVTWFHAIHV - 299 -
HLA-DQA1*01:02/DQB1*05:03 LFLPFFSNVTWFHAIH - 303 -
HLA-DPA1*01:03/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV - 305 -
HLA-DPA1*04:01/DPB1*04:02 STQDLFLPFFSNVTWFHAIH - 307 -
HLA-DPA1*04:01/DPB1*105:01 STQDLFLPFFSNVTWFHAIH - 307 -
HLA-DPA1*04:01/DPB1*13:01 STQDLFLPFFSNVTWFHAIH - 309 -
HLA-DPA1*04:01/DPB1*05:01 TQDLFLPFFSNVTWFHAIH - 311 -
HLA-DPA1*03:01/DPB1*11:01 TQDLFLPFFSNVTWFHAIH - 313 -
HLA-DQA1*01:02/DQB1*05:03 DLFLPFFSNVTWFHAIH - 313 -
HLA-DQA1*01:03/DQB1*06:09 LFLPFFSNVTWFHAIHV - 313 -
HLA-DPA1*04:01/DPB1*04:02 LFLPFFSNVTWFHAIHV - 314 -
HLA-DPA1*04:01/DPB1*105:01 LFLPFFSNVTWFHAIHV - 314 -
HLA-DPA1*02:02/DPB1*02:01 TQDLFLPFFSNVTWFHAIH - 319 -
HLA-DPA1*03:01/DPB1*85:01 TQDLFLPFFSNVTWFHAIHV - 321 -
HLA-DPA1*04:01/DPB1*13:01 QDLFLPFFSNVTWFHAIHV - 321 -
HLA-DRB1*13:02 LFLPFFSNVTWFHAIH - 321 -
HLA-DPA1*04:01/DPB1*11:01 QDLFLPFFSNVTWFHAIHV - 322 -
HLA-DPA1*04:01/DPB1*05:01 DLFLPFFSNVTWFHAIH - 323 -
HLA-DRB1*11:01 LFLPFFSNVTWFHAIHV - 323 -
HLA-DPA1*03:01/DPB1*05:01 LFLPFFSNVTWFHAIH - 324 -
HLA-DPA1*01:03/DPB1*05:01 STQDLFLPFFSNVTWFHAIH - 325 -
HLA-DPA1*02:02/DPB1*04:01 LFLPFFSNVTWFHAIHV - 325 -
HLA-DPA1*02:01/DPB1*01:01 DLFLPFFSNVTWFHAIHV - 326 -
HLA-DQA1*01:03/DQB1*06:09 TQDLFLPFFSNVTWFHAIHV - 326 -
HLA-DPA1*04:01/DPB1*11:01 LFLPFFSNVTWFHAIHV - 327 -
HLA-DPA1*03:01/DPB1*06:01 QDLFLPFFSNVTWFHAIHV - 329 -
HLA-DQA1*01:01/DQB1*05:01 QDLFLPFFSNVTWFHAIHV - 329 -
HLA-DRB1*01:02 LFLPFFSNVTWFHAIHV - 333 -
HLA-DPA1*03:01/DPB1*17:01 STQDLFLPFFSNVTWFHAIH - 335 -
HLA-DPA1*04:01/DPB1*06:01 STQDLFLPFFSNVTWFHAIH - 335 -
HLA-DRB1*01:02 TQDLFLPFFSNVTWFHAIHV - 337 -
HLA-DPA1*02:01/DPB1*02:01 QDLFLPFFSNVTWFHAIHV - 338 -
HLA-DPA1*04:01/DPB1*85:01 TQDLFLPFFSNVTWFHAIHV - 338 -
HLA-DPA1*04:01/DPB1*13:01 LFLPFFSNVTWFHAIHV - 339 -
HLA-DQA1*01:02/DQB1*05:03 QDLFLPFFSNVTWFHAIH - 339 -
HLA-DRB1*11:01 DLFLPFFSNVTWFHAIH - 340 -
HLA-DPA1*03:01/DPB1*13:01 LFLPFFSNVTWFHAIH - 341 -
HLA-DRB1*13:02 DLFLPFFSNVTWFHAIH - 342 -
HLA-DPA1*02:01/DPB1*02:01 LFLPFFSNVTWFHAIH - 344 -
HLA-DRB1*04:04 QDLFLPFFSNVTWFHAIH - 344 -
HLA-DPA1*03:01/DPB1*13:01 DLFLPFFSNVTWFHAIH - 346 -
HLA-DQA1*01:01/DQB1*05:01 TQDLFLPFFSNVTWFHAIHV - 347 -
HLA-DQA1*05:01/DQB1*04:02 TQDLFLPFFSNVTWFHAIHV - 348 -
HLA-DPA1*04:01/DPB1*04:02 DLFLPFFSNVTWFHAIH - 349 -
HLA-DPA1*04:01/DPB1*105:01 DLFLPFFSNVTWFHAIH - 349 -
HLA-DQA1*01:03/DQB1*06:09 QDLFLPFFSNVTWFHAIHV - 349 -
HLA-DPA1*02:01/DPB1*02:01 TQDLFLPFFSNVTWFHAIH - 350 -
HLA-DPA1*03:01/DPB1*11:01 LFLPFFSNVTWFHAIHV - 350 -
HLA-DPA1*04:01/DPB1*11:01 TQDLFLPFFSNVTWFHAIH - 351 -
HLA-DPA1*04:01/DPB1*05:01 LFLPFFSNVTWFHAIH - 353 -
HLA-DRB1*04:07 DLFLPFFSNVTWFHAIH - 353 -
HLA-DQA1*01:03/DQB1*05:03 LFLPFFSNVTWFHAIHV - 354 -
HLA-DPA1*01:03/DPB1*11:01 TQDLFLPFFSNVTWFHAIHV - 355 -
HLA-DPA1*02:02/DPB1*04:01 STQDLFLPFFSNVTWFHAIH - 358 -
HLA-DPA1*02:02/DPB1*13:01 TQDLFLPFFSNVTWFHAIHV - 358 -
HLA-DQA1*01:03/DQB1*05:03 QDLFLPFFSNVTWFHAIHV - 358 -
HLA-DQA1*05:01/DQB1*04:02 QDLFLPFFSNVTWFHAIHV - 358 -
HLA-DQA1*01:02/DQB1*06:09 LFLPFFSNVTWFHAIHV - 359 -
HLA-DPA1*04:01/DPB1*09:01 TQDLFLPFFSNVTWFHAIHV - 360 -
HLA-DPA1*04:01/DPB1*13:01 LFLPFFSNVTWFHAIH - 360 -
HLA-DRB1*04:07 LFLPFFSNVTWFHAIH - 360 -
HLA-DRB1*11:02 TQDLFLPFFSNVTWFHAIHV - 360 -
HLA-DRB1*13:01 TQDLFLPFFSNVTWFHAIHV - 360 -
HLA-DRB1*14:04 LFLPFFSNVTWFHAIHV - 360 -
HLA-DPA1*03:01/DPB1*11:01 LFLPFFSNVTWFHAIH - 361 -
HLA-DPA1*04:01/DPB1*11:01 DLFLPFFSNVTWFHAIH - 361 -
HLA-DQA1*02:01/DQB1*04:02 LFLPFFSNVTWFHAIHV - 361 -
HLA-DPA1*03:01/DPB1*11:01 DLFLPFFSNVTWFHAIH - 366 -
HLA-DPA1*04:01/DPB1*13:01 TQDLFLPFFSNVTWFHAIH - 366 -
HLA-DPA1*04:01/DPB1*85:01 STQDLFLPFFSNVTWFHAIH - 366 -
HLA-DQA1*01:03/DQB1*06:09 STQDLFLPFFSNVTWFHAIH - 366 -
HLA-DPA1*02:02/DPB1*04:01 DLFLPFFSNVTWFHAIH - 367 -
HLA-DPA1*03:01/DPB1*85:01 STQDLFLPFFSNVTWFHAIH - 367 -
HLA-DPA1*04:01/DPB1*01:01 HVSGTNGTKRFDNPVLPFND - 367 -
HLA-DQA1*01:03/DQB1*06:09 DLFLPFFSNVTWFHAIH - 367 -
HLA-DPA1*03:01/DPB1*06:01 TQDLFLPFFSNVTWFHAIH - 371 -
HLA-DPA1*03:01/DPB1*06:01 LFLPFFSNVTWFHAIHV - 372 -
HLA-DRB1*11:04 LFLPFFSNVTWFHAIHV - 372 -
HLA-DPA1*02:02/DPB1*04:01 TQDLFLPFFSNVTWFHAIHV - 373 -
HLA-DRB1*11:01 TQDLFLPFFSNVTWFHAIHV - 374 -
HLA-DPA1*04:01/DPB1*17:01 TQDLFLPFFSNVTWFHAIHV - 375 -
HLA-DPA1*04:01/DPB1*04:02 LFLPFFSNVTWFHAIH - 376 -
HLA-DPA1*04:01/DPB1*105:01 LFLPFFSNVTWFHAIH - 376 -
HLA-DRB1*13:02 STQDLFLPFFSNVTWFHAIH - 376 -
HLA-DPA1*02:02/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV - 377 -
HLA-DQA1*01:03/DQB1*06:09 LFLPFFSNVTWFHAIH - 377 -
HLA-DPA1*04:01/DPB1*06:01 LFLPFFSNVTWFHAIHV - 379 -
HLA-DRB1*04:07 TQDLFLPFFSNVTWFHAIHV - 379 -
HLA-DPA1*04:01/DPB1*01:01 VSGTNGTKRFDNPVLPFNDG - 381 -
HLA-DPA1*04:01/DPB1*04:02 QDLFLPFFSNVTWFHAIHV - 382 -
HLA-DPA1*04:01/DPB1*105:01 QDLFLPFFSNVTWFHAIHV - 382 -
HLA-DQA1*05:01/DQB1*04:02 DLFLPFFSNVTWFHAIH - 383 -
HLA-DQA1*01:02/DQB1*06:09 QDLFLPFFSNVTWFHAIHV - 384 -
HLA-DRB1*04:07 STQDLFLPFFSNVTWFHAIH - 384 -
HLA-DPA1*01:03/DPB1*13:01 TQDLFLPFFSNVTWFHAIHV - 388 -
HLA-DPA1*04:01/DPB1*11:01 LFLPFFSNVTWFHAIH - 389 -
HLA-DQA1*01:03/DQB1*05:03 STQDLFLPFFSNVTWFHAIH - 391 -
HLA-DPA1*02:02/DPB1*05:01 LFLPFFSNVTWFHAIHV - 393 -
HLA-DPA1*04:01/DPB1*13:01 DLFLPFFSNVTWFHAIH - 393 -
HLA-DQA1*01:02/DQB1*06:09 LFLPFFSNVTWFHAIH - 393 -
HLA-DRB1*13:02 QDLFLPFFSNVTWFHAIHV - 394 -
HLA-DRB1*04:07 LFLPFFSNVTWFHAIHV - 395 -
HLA-DRB1*04:04 DLFLPFFSNVTWFHAIHV - 397 -
HLA-DRB1*11:01 LFLPFFSNVTWFHAIH - 400 -
HLA-DRB1*14:01 LFLPFFSNVTWFHAIHV - 400 -
HLA-DPA1*04:01/DPB1*06:01 QDLFLPFFSNVTWFHAIHV - 401 -
HLA-DPA1*04:01/DPB1*04:02 TQDLFLPFFSNVTWFHAIH - 402 -
HLA-DPA1*04:01/DPB1*105:01 TQDLFLPFFSNVTWFHAIH - 402 -
HLA-DPA1*02:02/DPB1*05:01 STQDLFLPFFSNVTWFHAIH - 403 -
HLA-DPA1*02:02/DPB1*13:01 LFLPFFSNVTWFHAIHV - 406 -
HLA-DPA1*03:01/DPB1*17:01 QDLFLPFFSNVTWFHAIHV - 406 -
HLA-DPA1*01:03/DPB1*11:01 STQDLFLPFFSNVTWFHAIH - 408 -
HLA-DQA1*05:01/DQB1*04:02 LFLPFFSNVTWFHAIH - 408 -
HLA-DPA1*02:02/DPB1*02:01 DLFLPFFSNVTWFHAIHV - 409 -
HLA-DPA1*03:01/DPB1*05:01 DLFLPFFSNVTWFHAIHV - 410 -
HLA-DPA1*02:02/DPB1*11:01 TQDLFLPFFSNVTWFHAIHV - 411 -
HLA-DPA1*03:01/DPB1*13:01 DLFLPFFSNVTWFHAIHV - 413 -
HLA-DPA1*02:02/DPB1*04:01 LFLPFFSNVTWFHAIH - 416 -
HLA-DQA1*01:02/DQB1*06:09 TQDLFLPFFSNVTWFHAIHV - 417 -
HLA-DQA1*01:03/DQB1*06:09 TQDLFLPFFSNVTWFHAIH - 417 -
HLA-DRB1*08:02 LFLPFFSNVTWFHAIHV - 420 -
HLA-DQA1*01:02/DQB1*06:09 DLFLPFFSNVTWFHAIH - 421 -
HLA-DQA1*01:01/DQB1*05:01 DLFLPFFSNVTWFHAIHV - 425 -
HLA-DPA1*03:01/DPB1*09:01 TQDLFLPFFSNVTWFHAIHV - 426 -
HLA-DPA1*02:02/DPB1*13:01 QDLFLPFFSNVTWFHAIHV - 429 -
HLA-DRB1*08:02 TQDLFLPFFSNVTWFHAIHV - 430 -
HLA-DRB1*11:01 STQDLFLPFFSNVTWFHAIH - 430 -
HLA-DPA1*04:01/DPB1*06:01 LFLPFFSNVTWFHAIH - 433 -
HLA-DQA1*01:02/DQB1*06:09 STQDLFLPFFSNVTWFHAIH - 433 -
HLA-DPA1*02:02/DPB1*13:01 STQDLFLPFFSNVTWFHAIH - 434 -
HLA-DPA1*04:01/DPB1*17:01 STQDLFLPFFSNVTWFHAIH - 434 -
HLA-DPA1*01:03/DPB1*04:02 TQDLFLPFFSNVTWFHAIHV - 435 -
HLA-DPA1*01:03/DPB1*105:01 TQDLFLPFFSNVTWFHAIHV - 435 -
HLA-DPA1*01:03/DPB1*04:02 LFLPFFSNVTWFHAIHV - 437 -
HLA-DPA1*01:03/DPB1*105:01 LFLPFFSNVTWFHAIHV - 437 -
HLA-DPA1*03:01/DPB1*05:01 QDLFLPFFSNVTWFHAIH - 437 -
HLA-DPA1*04:01/DPB1*26:01 TQDLFLPFFSNVTWFHAIHV - 437 -
HLA-DPA1*01:03/DPB1*04:02 STQDLFLPFFSNVTWFHAIH - 442 -
HLA-DPA1*01:03/DPB1*105:01 STQDLFLPFFSNVTWFHAIH - 442 -
HLA-DPA1*02:02/DPB1*04:01 QDLFLPFFSNVTWFHAIHV - 442 -
HLA-DRB1*14:04 TQDLFLPFFSNVTWFHAIHV - 442 -
HLA-DQA1*01:01/DQB1*05:01 LFLPFFSNVTWFHAIHV - 444 -
HLA-DQA1*02:01/DQB1*03:01 LFLPFFSNVTWFHAIH - 444 -
HLA-DQA1*02:01/DQB1*03:19 LFLPFFSNVTWFHAIH - 444 -
HLA-DPA1*04:01/DPB1*06:01 TQDLFLPFFSNVTWFHAIH - 449 -
HLA-DPA1*03:01/DPB1*06:01 LFLPFFSNVTWFHAIH - 452 -
HLA-DPA1*04:01/DPB1*05:01 DLFLPFFSNVTWFHAIHV - 452 -
HLA-DPA1*03:01/DPB1*06:01 DLFLPFFSNVTWFHAIH - 453 -
HLA-DPA1*04:01/DPB1*06:01 DLFLPFFSNVTWFHAIH - 453 -
HLA-DPA1*02:02/DPB1*04:01 TQDLFLPFFSNVTWFHAIH - 454 -
HLA-DQA1*02:01/DQB1*03:01 LFLPFFSNVTWFHAIHV - 455 -
HLA-DQA1*02:01/DQB1*03:19 LFLPFFSNVTWFHAIHV - 455 -
HLA-DRB1*01:02 QDLFLPFFSNVTWFHAIHV - 455 -
HLA-DRB1*04:07 TQDLFLPFFSNVTWFHAIH - 455 -
HLA-DRB1*04:07 QDLFLPFFSNVTWFHAIHV - 455 -
HLA-DQA1*01:02/DQB1*06:09 TQDLFLPFFSNVTWFHAIH - 456 -
HLA-DQA1*05:01/DQB1*04:02 STQDLFLPFFSNVTWFHAIH - 457 -
HLA-DPA1*04:01/DPB1*10:01 TQDLFLPFFSNVTWFHAIHV - 459 -
HLA-DPA1*04:01/DPB1*14:01 TQDLFLPFFSNVTWFHAIHV - 459 -
HLA-DPA1*04:01/DPB1*03:01 TQDLFLPFFSNVTWFHAIHV - 461 -
HLA-DPA1*02:02/DPB1*02:01 QDLFLPFFSNVTWFHAIH - 463 -
HLA-DQA1*01:03/DQB1*05:03 LFLPFFSNVTWFHAIH - 463 -
HLA-DPA1*04:01/DPB1*09:01 LFLPFFSNVTWFHAIHV - 465 -
HLA-DPA1*04:01/DPB1*09:01 QDLFLPFFSNVTWFHAIHV - 466 -
HLA-DRB1*14:04 QDLFLPFFSNVTWFHAIHV - 467 -
HLA-DRB1*08:02 LFLPFFSNVTWFHAIH - 472 -
HLA-DPA1*03:01/DPB1*13:01 QDLFLPFFSNVTWFHAIH - 473 -
HLA-DPA1*04:01/DPB1*85:01 QDLFLPFFSNVTWFHAIHV - 473 -
HLA-DQA1*02:01/DQB1*04:02 QDLFLPFFSNVTWFHAIHV - 474 -
HLA-DPA1*02:02/DPB1*11:01 LFLPFFSNVTWFHAIHV - 476 -
HLA-DPA1*03:01/DPB1*17:01 TQDLFLPFFSNVTWFHAIH - 476 -
HLA-DPA1*03:01/DPB1*01:01 HVSGTNGTKRFDNPVLPFND - 478 -
HLA-DPA1*01:03/DPB1*05:01 QDLFLPFFSNVTWFHAIHV - 479 -
HLA-DRB1*08:04 LFLPFFSNVTWFHAIHV - 479 -
HLA-DPA1*04:01/DPB1*09:01 STQDLFLPFFSNVTWFHAIH - 480 -
HLA-DQA1*02:01/DQB1*04:02 TQDLFLPFFSNVTWFHAIHV - 482 -
HLA-DPA1*02:02/DPB1*11:01 STQDLFLPFFSNVTWFHAIH - 484 -
HLA-DPA1*03:01/DPB1*85:01 QDLFLPFFSNVTWFHAIHV - 484 -
HLA-DQA1*01:03/DQB1*05:03 DLFLPFFSNVTWFHAIH - 484 -
HLA-DPA1*01:03/DPB1*13:01 STQDLFLPFFSNVTWFHAIH - 485 -
HLA-DPA1*02:01/DPB1*04:01 LFLPFFSNVTWFHAIHV - 485 -
HLA-DPA1*04:01/DPB1*26:01 STQDLFLPFFSNVTWFHAIH - 485 -
HLA-DQA1*01:01/DQB1*05:01 STQDLFLPFFSNVTWFHAIH - 486 -
HLA-DQA1*01:02/DQB1*06:09 DLFLPFFSNVTWFHAIHV - 486 -
HLA-DRB1*01:02 STQDLFLPFFSNVTWFHAIH - 487 -
HLA-DPA1*03:01/DPB1*10:01 TQDLFLPFFSNVTWFHAIHV - 488 -
HLA-DRB1*08:02 DLFLPFFSNVTWFHAIH - 488 -
HLA-DPA1*01:03/DPB1*04:02 DLFLPFFSNVTWFHAIH - 489 -
HLA-DPA1*01:03/DPB1*05:01 LFLPFFSNVTWFHAIHV - 489 -
HLA-DPA1*01:03/DPB1*105:01 DLFLPFFSNVTWFHAIH - 489 -
HLA-DQA1*04:01/DQB1*05:01 TQDLFLPFFSNVTWFHAIHV - 489 -
HLA-DPA1*03:01/DPB1*11:01 DLFLPFFSNVTWFHAIHV - 490 -
HLA-DPA1*04:01/DPB1*05:01 QDLFLPFFSNVTWFHAIH - 491 -
HLA-DPA1*02:02/DPB1*05:01 DLFLPFFSNVTWFHAIH - 493 -
HLA-DRB1*11:02 QDLFLPFFSNVTWFHAIHV - 495 -
HLA-DRB1*13:01 QDLFLPFFSNVTWFHAIHV - 495 -
HLA-DRB1*14:01 TQDLFLPFFSNVTWFHAIHV - 495 -
HLA-DRB1*13:02 TQDLFLPFFSNVTWFHAIH - 496 -
HLA-DPA1*02:02/DPB1*13:01 DLFLPFFSNVTWFHAIH - 499 -
HLA-DPA1*01:03/DPB1*11:01 QDLFLPFFSNVTWFHAIHV - 500 -
HLA-DQA1*01:03/DQB1*05:03 TQDLFLPFFSNVTWFHAIH - 500 -
HLA-DRB1*13:02 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 206 7855
HLA-DRB1*13:02 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 244 9084
HLA-DRB1*13:02 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 185 6492
HLA-DRB1*13:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 148 4680
HLA-DRB1*13:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 133 4180
HLA-DRB1*04:04 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 342 10117
HLA-DRB1*13:02 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 170 5010
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 79 2301
HLA-DRB1*15:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 48 1300
HLA-DRB1*04:04 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 261 6236
HLA-DRB1*13:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 199 4412
HLA-DRB1*15:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 135 2795
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 114 2320
HLA-DRB1*04:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 412 8147
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 38 721
HLA-DRB1*04:04 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 210 3942
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 107 1967
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRFD TWFHAISGTNGTKRFD 666 37
HLA-DRB1*15:03 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 213 3649
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 35 589
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 94 1581
HLA-DRB1*15:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 214 3593
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKRF VTWFHAISGTNGTKRF 350 21
HLA-DRB1*07:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 425 6977
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 94 1543
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 86 1363
HLA-DRB1*15:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 77 1215
HLA-DRB1*15:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 275 4303
HLA-DRB1*15:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 33 515
HLA-DRB1*15:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 74 1106
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 32 468
HLA-DRB1*15:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 84 1195
HLA-DQA1*02:01/DQB1*03:01 AIHVSGTNGTKRFDNPVLPF AISGTNGTKRFDNPVLPF 358 5015
HLA-DQA1*02:01/DQB1*03:19 AIHVSGTNGTKRFDNPVLPF AISGTNGTKRFDNPVLPF 358 5015
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 31 432
HLA-DRB1*15:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 68 941
HLA-DRB1*07:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 303 4188
HLA-DRB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 31 427
HLA-DRB1*01:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 263 3618
HLA-DQA1*01:03/DQB1*06:02 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 346 4674
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTKR NVTWFHAISGTNGTKR 269 20
HLA-DRB1*15:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 62 830
HLA-DRB1*15:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 31 413
HLA-DRB1*04:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 277 3671
HLA-DRB1*04:04 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 169 2204
HLA-DRB1*13:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 282 3654
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFDN WFHAISGTNGTKRFDN 1140 89
HLA-DRB1*07:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 90 1128
HLA-DQA1*01:03/DQB1*06:02 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 476 5870
HLA-DRB1*11:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 224 2733
HLA-DRB1*13:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 224 2733
HLA-DQA1*02:01/DQB1*03:01 HAIHVSGTNGTKRFDNPVLP HAISGTNGTKRFDNPVLP 272 3318
HLA-DQA1*02:01/DQB1*03:19 HAIHVSGTNGTKRFDNPVLP HAISGTNGTKRFDNPVLP 272 3318
HLA-DRB1*07:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 86 1036
HLA-DRB1*15:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 77 918
HLA-DRB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 35 417
HLA-DQA1*01:03/DQB1*06:02 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 252 2969
HLA-DPA1*03:01/DPB1*02:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 330 3884
HLA-DRB1*07:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 85 999
HLA-DRB1*15:03 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 62 715
HLA-DRB1*15:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 31 357
HLA-DPA1*03:01/DPB1*02:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 223 2561
HLA-DRB1*04:04 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 150 1701
HLA-DRB1*07:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 114 1289
HLA-DRB1*11:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 278 3123
HLA-DRB1*13:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 278 3123
HLA-DRB1*07:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 235 2627
HLA-DRB1*07:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 75 826
HLA-DRB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 28 305
HLA-DRB1*11:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 268 2836
HLA-DRB1*13:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 268 2836
HLA-DRB1*11:02 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 404 4221
HLA-DRB1*13:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 404 4221
HLA-DRB1*10:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 420 4315
HLA-DRB1*11:02 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 454 4654
HLA-DRB1*13:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 454 4654
HLA-DRB1*15:02 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 478 4776
HLA-DQA1*01:03/DQB1*06:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 226 2251
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 157 1551
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 157 1551
HLA-DRB1*04:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 197 1922
HLA-DQA1*02:01/DQB1*03:03 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 423 4101
HLA-DRB1*11:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 186 1793
HLA-DQA1*05:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 293 2824
HLA-DQA1*05:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 293 2824
HLA-DRB1*11:02 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 352 3392
HLA-DRB1*13:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 352 3392
HLA-DRB1*13:02 FHAIHVSGTNGTKRFDNPV FHAISGTNGTKRFDNPV 471 4521
HLA-DRB1*04:04 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 146 1393
HLA-DQA1*05:01/DQB1*03:03 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 391 3706
HLA-DRB1*07:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 72 682
HLA-DRB1*07:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 163 1511
HLA-DRB1*01:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 41 377
HLA-DRB1*11:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 305 2797
HLA-DRB1*13:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 305 2797
HLA-DQA1*01:02/DQB1*06:02 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 425 3888
HLA-DRB1*15:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 72 650
HLA-DRB1*07:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 65 582
HLA-DQA1*01:03/DQB1*06:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 207 1840
HLA-DRB1*13:02 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 402 3524
HLA-DRB1*15:03 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 62 530
HLA-DRB1*08:04 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 352 3009
HLA-DQA1*02:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 290 2474
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGTK SNVTWFHAISGTNGTK 243 29
HLA-DRB1*08:04 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 275 2301
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 91 11
HLA-DRB1*11:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 207 1699
HLA-DQA1*05:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 272 2223
HLA-DQA1*05:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 227 1792
HLA-DQA1*05:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 227 1792
HLA-DRB1*11:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 192 1515
HLA-DRB1*08:04 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 244 1920
HLA-DQA1*02:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 121 947
HLA-DQA1*02:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 121 947
HLA-DQA1*05:01/DQB1*04:02 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 389 3018
HLA-DQA1*02:01/DQB1*04:02 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 467 3604
HLA-DQA1*06:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 455 3503
HLA-DQA1*06:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 455 3503
HLA-DQA1*05:01/DQB1*04:02 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 251 1928
HLA-DQA1*01:02/DQB1*06:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 369 2816
HLA-DQA1*02:01/DQB1*03:01 AIHVSGTNGTKRFDNPV AISGTNGTKRFDNPV 330 2454
HLA-DQA1*02:01/DQB1*03:19 AIHVSGTNGTKRFDNPV AISGTNGTKRFDNPV 330 2454
HLA-DRB1*13:02 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 361 2684
HLA-DQA1*01:02/DQB1*05:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 427 3136
HLA-DRB1*07:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 65 473
HLA-DRB1*15:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 31 225
HLA-DQA1*05:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 213 1542
HLA-DRB1*11:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 285 2063
HLA-DRB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 285 2063
HLA-DRB1*15:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 66 477
HLA-DRB1*11:04 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 367 2652
HLA-DQA1*02:01/DQB1*03:01 AIHVSGTNGTKRFDNPVLP AISGTNGTKRFDNPVLP 460 3322
HLA-DQA1*02:01/DQB1*03:19 AIHVSGTNGTKRFDNPVLP AISGTNGTKRFDNPVLP 460 3322
HLA-DQA1*01:03/DQB1*06:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 218 1568
HLA-DQA1*01:03/DQB1*06:01 HAIHVSGTNGTKRFDNPVLP HAISGTNGTKRFDNPVLP 409 2917
HLA-DPA1*03:01/DPB1*02:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 134 955
HLA-DRB1*04:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 146 1036
HLA-DRB1*11:04 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 432 3053
HLA-DQA1*02:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 237 1670
HLA-DQA1*01:03/DQB1*06:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 248 1744
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 56 8
HLA-DPA1*04:01/DPB1*02:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 476 3328
HLA-DRB1*13:02 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 297 2058
HLA-DRB1*08:02 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 334 2302
HLA-DRB1*16:01 VTWFHAIHVSGTNGTKRF VTWFHAISGTNGTKRF 1658 242
HLA-DQA1*05:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 186 1269
HLA-DQA1*05:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 186 1269
HLA-DRB1*01:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 224 1528
HLA-DRB1*13:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 307 2080
HLA-DQA1*02:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 101 684
HLA-DQA1*02:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 101 684
HLA-DRB1*10:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 21 141
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 154 23
HLA-DQA1*01:03/DQB1*06:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 219 1441
HLA-DQA1*01:02/DQB1*06:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 320 2096
HLA-DRB1*11:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 281 1834
HLA-DRB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 281 1834
HLA-DRB1*01:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 218 1420
HLA-DQA1*06:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 347 2240
HLA-DQA1*06:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 347 2240
HLA-DQA1*01:03/DQB1*06:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 223 1434
HLA-DRB1*04:04 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 334 2129
HLA-DQA1*05:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 153 975
HLA-DQA1*05:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 153 975
HLA-DRB1*04:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 132 839
HLA-DRB1*13:02 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 324 2046
HLA-DRB1*08:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 181 1136
HLA-DRB1*16:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 104 649
HLA-DRB1*16:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 95 592
HLA-DRB1*01:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 52 324
HLA-DRB1*10:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 137 849
HLA-DRB1*11:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 271 1676
HLA-DRB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 271 1676
HLA-DRB1*13:02 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 291 1791
HLA-DRB1*01:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 255 1561
HLA-DRB1*11:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 267 1632
HLA-DRB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 267 1632
HLA-DRB1*10:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 59 360
HLA-DQA1*01:02/DQB1*05:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 196 1195
HLA-DQA1*01:03/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 200 1219
HLA-DQA1*06:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 283 1718
HLA-DQA1*06:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 283 1718
HLA-DQA1*02:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 85 516
HLA-DQA1*02:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 85 516
HLA-DRB1*10:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 23 139
HLA-DRB1*04:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 125 755
HLA-DQA1*01:02/DQB1*06:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 349 2097
HLA-DQA1*01:02/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 254 1526
HLA-DQA1*05:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 179 1066
HLA-DRB1*01:02 VTWFHAIHVSGTNGTKRF VTWFHAISGTNGTKRF 1518 255
HLA-DQA1*05:01/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 488 2903
HLA-DRB1*11:04 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 385 2286
HLA-DQA1*01:03/DQB1*05:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 319 1893
HLA-DQA1*01:03/DQB1*06:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 243 1439
HLA-DRB1*08:04 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 267 1571
HLA-DQA1*01:03/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 169 993
HLA-DRB1*11:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 225 1319
HLA-DQA1*01:03/DQB1*06:09 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 461 2697
HLA-DRB1*10:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 22 128
HLA-DRB1*08:02 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 215 1250
HLA-DQA1*01:03/DQB1*06:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 247 1433
HLA-DQA1*01:03/DQB1*05:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 166 962
HLA-DRB1*11:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 215 1244
HLA-DQA1*05:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 146 841
HLA-DQA1*05:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 146 841
HLA-DRB1*11:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 233 1342
HLA-DQA1*05:01/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 385 2214
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 137 785
HLA-DQA1*02:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 201 1150
HLA-DRB1*01:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 262 1499
HLA-DRB1*13:02 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 262 1487
HLA-DQA1*01:03/DQB1*05:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 210 1187
HLA-DRB1*08:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 176 990
HLA-DRB1*01:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 230 1293
HLA-DRB1*08:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 157 880
HLA-DRB1*08:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 173 965
HLA-DQA1*02:01/DQB1*04:02 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 337 1879
HLA-DRB1*11:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 287 1600
HLA-DRB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 287 1600
HLA-DQA1*01:02/DQB1*05:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 119 661
HLA-DRB1*16:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 84 465
HLA-DRB1*04:04 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 198 1095
HLA-DQA1*05:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 165 912
HLA-DRB1*11:04 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 389 2145
HLA-DQA1*05:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 143 788
HLA-DQA1*05:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 143 788
HLA-DQA1*02:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 81 446
HLA-DQA1*02:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 81 446
HLA-DRB1*08:04 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 290 1595
HLA-DQA1*02:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 101 553
HLA-DQA1*02:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 101 553
HLA-DRB1*11:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 267 1456
HLA-DRB1*11:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 297 1617
HLA-DRB1*13:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 297 1617
HLA-DPA1*04:01/DPB1*14:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 499 2713
HLA-DRB1*15:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 65 353
HLA-DRB1*08:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 207 1121
HLA-DPA1*03:01/DPB1*01:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 357 1927
HLA-DQA1*02:01/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 424 2287
HLA-DRB1*11:04 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 366 1972
HLA-DRB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 30 161
HLA-DQA1*05:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 331 1775
HLA-DRB1*10:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 31 166
HLA-DPA1*03:01/DPB1*01:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 487 2607
HLA-DQA1*05:01/DQB1*04:02 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 188 1004
HLA-DQA1*01:03/DQB1*06:09 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 349 1839
HLA-DQA1*02:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 187 985
HLA-DQA1*01:02/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 211 1111
HLA-DRB1*01:02 TWFHAIHVSGTNGTKRFD TWFHAISGTNGTKRFD 2442 464
HLA-DRB1*07:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 71 372
HLA-DQA1*02:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 80 419
HLA-DQA1*02:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 80 419
HLA-DQA1*05:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 158 826
HLA-DPA1*03:01/DPB1*05:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 407 2121
HLA-DPA1*03:01/DPB1*02:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 429 2234
HLA-DQA1*01:02/DQB1*06:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 304 1583
HLA-DRB1*01:02 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 492 95
HLA-DQA1*02:01/DQB1*03:01 HAIHVSGTNGTKRFDNPVL HAISGTNGTKRFDNPVL 351 1814
HLA-DQA1*02:01/DQB1*03:19 HAIHVSGTNGTKRFDNPVL HAISGTNGTKRFDNPVL 351 1814
HLA-DRB1*08:04 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 295 1522
HLA-DQA1*06:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 247 1274
HLA-DQA1*06:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 247 1274
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHAIS 32 165
HLA-DRB1*10:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 26 134
HLA-DQA1*02:01/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 345 1767
HLA-DPA1*03:01/DPB1*04:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 301 1540
HLA-DQA1*05:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 311 1587
HLA-DQA1*05:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 292 1489
HLA-DQA1*05:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 186 942
HLA-DQA1*05:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 186 942
HLA-DPA1*04:01/DPB1*02:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 329 1664
HLA-DQA1*05:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 155 783
HLA-DQA1*05:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 155 783
HLA-DRB1*10:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 22 111
HLA-DQA1*01:02/DQB1*05:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 91 459
HLA-DRB1*10:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 24 121
HLA-DQA1*01:03/DQB1*05:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 133 670
HLA-DRB1*16:01 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 1122 223
HLA-DQA1*01:03/DQB1*06:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 316 1578
HLA-DRB1*08:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 161 800
HLA-DRB1*10:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 28 139
HLA-DQA1*01:02/DQB1*06:02 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 433 2148
HLA-DPA1*04:01/DPB1*14:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 475 2345
HLA-DQA1*02:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 86 424
HLA-DQA1*02:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 86 424
HLA-DPA1*02:02/DPB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 443 2180
HLA-DQA1*02:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 179 878
HLA-DRB1*07:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 63 309
HLA-DQA1*01:03/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 143 699
HLA-DQA1*05:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 164 801
HLA-DRB1*16:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 120 586
HLA-DQA1*02:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 284 1384
HLA-DQA1*06:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 234 1137
HLA-DQA1*06:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 234 1137
HLA-DRB1*04:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 148 718
HLA-DQA1*05:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 168 815
HLA-DQA1*05:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 168 815
HLA-DQA1*02:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 93 451
HLA-DQA1*02:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 93 451
HLA-DQA1*05:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 303 1468
HLA-DQA1*05:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 174 842
HLA-DRB1*16:01 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 530 110
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 164 790
HLA-DRB1*13:02 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 423 2027
HLA-DQA1*05:01/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 361 1729
HLA-DRB1*16:01 NVTWFHAIHVSGTNGTKR NVTWFHAISGTNGTKR 905 189
HLA-DRB1*01:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 228 1091
HLA-DPA1*03:01/DPB1*02:01 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 316 1510
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 121 578
HLA-DQA1*01:02/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 178 848
HLA-DQA1*01:03/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 490 2334
HLA-DQA1*01:03/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHAISGTNGTKRFDNPVL 490 2334
HLA-DPA1*04:01/DPB1*13:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 498 2366
HLA-DQA1*02:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 264 1251
HLA-DQA1*02:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 252 1185
HLA-DQA1*06:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 228 1071
HLA-DQA1*06:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 228 1071
HLA-DQA1*05:01/DQB1*03:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 185 868
HLA-DRB1*01:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 54 253
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 89 19
HLA-DPA1*03:01/DPB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 465 2175
HLA-DRB1*04:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 144 673
HLA-DQA1*05:01/DQB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 454 2117
HLA-DRB1*14:04 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 495 2298
HLA-DRB1*04:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 173 802
HLA-DPA1*02:02/DPB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 431 1996
HLA-DRB1*04:04 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 240 1110
HLA-DPA1*03:01/DPB1*02:01 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 423 1956
HLA-DQA1*01:03/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 133 614
HLA-DPA1*02:02/DPB1*01:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 413 1902
HLA-DRB1*01:02 NVTWFHAIHVSGTNGTKR NVTWFHAISGTNGTKR 1045 227
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 46 10
HLA-DRB1*08:04 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 308 1415
HLA-DQA1*05:01/DQB1*03:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 229 1052
HLA-DPA1*03:01/DPB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 391 1796
HLA-DQA1*06:01/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 469 2153
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPV FHAISGTNGTKRFDNPV 183 839
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPV FHAISGTNGTKRFDNPV 183 839
HLA-DRB1*11:04 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 377 1727
HLA-DRB1*11:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 386 1767
HLA-DQA1*02:01/DQB1*04:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 281 1285
HLA-DQA1*01:03/DQB1*06:09 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 309 1408
HLA-DQA1*02:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 141 640
HLA-DQA1*02:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 141 640
HLA-DQA1*02:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 155 701
HLA-DQA1*02:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 155 701
HLA-DPA1*01:03/DPB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 465 2101
HLA-DQA1*05:01/DQB1*04:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 161 727
HLA-DPA1*03:01/DPB1*17:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 478 2158
HLA-DRB1*16:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 78 352
HLA-DQA1*05:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 333 1502
HLA-DQA1*01:02/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 160 720
HLA-DRB1*13:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 318 1429
HLA-DQA1*02:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 268 1196
HLA-DQA1*06:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 402 1786
HLA-DRB1*15:01 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 77 342
HLA-DQA1*01:03/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 125 554
HLA-DPA1*03:01/DPB1*01:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 262 1159
HLA-DQA1*01:03/DQB1*06:09 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 260 1149
HLA-DQA1*05:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 254 1120
HLA-DQA1*05:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 254 1120
HLA-DQA1*02:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 188 826
HLA-DQA1*01:02/DQB1*06:02 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 367 1607
HLA-DQA1*02:01/DQB1*04:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 243 1062
HLA-DQA1*05:01/DQB1*04:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 140 611
HLA-DPA1*04:01/DPB1*14:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 407 1774
HLA-DPA1*04:01/DPB1*14:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 445 1938
HLA-DQA1*05:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 293 1274
HLA-DQA1*05:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 293 1274
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSG LPFFSNVTWFHAISG 32 139
HLA-DQA1*02:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 296 1285
HLA-DPA1*03:01/DPB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 373 1614
HLA-DQA1*05:01/DQB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 428 1850
HLA-DRB1*04:04 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 435 1879
HLA-DQA1*02:01/DQB1*03:01 HAIHVSGTNGTKRFDNP HAISGTNGTKRFDNP 260 1123
HLA-DQA1*02:01/DQB1*03:19 HAIHVSGTNGTKRFDNP HAISGTNGTKRFDNP 260 1123
HLA-DQA1*06:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 244 1048
HLA-DQA1*06:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 244 1048
HLA-DPA1*04:01/DPB1*09:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 442 1894
HLA-DQA1*02:01/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 337 1443
HLA-DRB1*10:01 TWFHAIHVSGTNGTKRFD TWFHAISGTNGTKRFD 304 71
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 143 612
HLA-DRB1*11:04 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 374 1599
HLA-DQA1*02:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 189 806
HLA-DPA1*03:01/DPB1*02:01 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 296 1261
HLA-DQA1*05:01/DQB1*03:01 HAIHVSGTNGTKRFDNP HAISGTNGTKRFDNP 499 2114
HLA-DQA1*05:01/DQB1*03:19 HAIHVSGTNGTKRFDNP HAISGTNGTKRFDNP 499 2114
HLA-DQA1*02:01/DQB1*03:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 201 850
HLA-DQA1*02:01/DQB1*03:19 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 201 850
HLA-DQA1*05:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPV FHAISGTNGTKRFDNPV 381 1611
HLA-DQA1*05:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPV FHAISGTNGTKRFDNPV 381 1611
HLA-DRB1*15:02 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 237 1002
HLA-DPA1*04:01/DPB1*05:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 422 1784
HLA-DQA1*01:03/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 409 1729
HLA-DQA1*01:03/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHAISGTNGTKRFDNPV 409 1729
HLA-DQA1*05:01/DQB1*03:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 220 930
HLA-DQA1*01:02/DQB1*06:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 299 1259
HLA-DRB1*04:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 365 1534
HLA-DRB1*08:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 249 1045
HLA-DRB1*10:01 VTWFHAIHVSGTNGTKRF VTWFHAISGTNGTKRF 155 37
HLA-DQA1*01:03/DQB1*05:03 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 485 2029
HLA-DRB1*16:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 71 297
HLA-DQA1*05:01/DQB1*03:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 293 1223
HLA-DQA1*01:03/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 173 722
HLA-DRB1*01:02 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 676 162
HLA-DQA1*01:02/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 146 609
HLA-DQA1*01:03/DQB1*05:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 119 495
HLA-DQA1*06:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 293 1216
HLA-DQA1*06:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 293 1216
HLA-DPA1*04:01/DPB1*14:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 382 1584
HLA-DQA1*06:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 389 1612
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 149 36
HLA-DPA1*04:01/DPB1*14:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 342 1414
HLA-DQA1*01:03/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 132 545
HLA-DRB1*15:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 58 239
HLA-DRB1*04:04 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 236 972
HLA-DPA1*04:01/DPB1*13:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 417 1716
HLA-DRB1*08:04 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 430 1767
HLA-DPA1*03:01/DPB1*11:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 460 1890
HLA-DQA1*05:01/DQB1*03:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 425 1744
HLA-DQA1*05:01/DQB1*03:19 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 425 1744
HLA-DPA1*04:01/DPB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 406 1664
HLA-DRB1*11:04 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 403 1647
HLA-DPA1*03:01/DPB1*17:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 409 1671
HLA-DQA1*01:03/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 153 623
HLA-DRB1*08:04 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 327 1331
HLA-DPA1*03:01/DPB1*13:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 459 1866
HLA-DPA1*04:01/DPB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 474 1924
HLA-DQA1*06:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 380 1541
HLA-DQA1*05:01/DQB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 133 539
HLA-DPA1*01:03/DPB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 439 1778
HLA-DQA1*06:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 267 1081
HLA-DQA1*06:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 267 1081
HLA-DPA1*02:02/DPB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 389 1574
HLA-DQA1*02:01/DQB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 429 1730
HLA-DRB1*10:01 NVTWFHAIHVSGTNGTKR NVTWFHAISGTNGTKR 133 33
HLA-DRB1*10:01 WFHAIHVSGTNGTKRFDN WFHAISGTNGTKRFDN 669 166
HLA-DQA1*05:01/DQB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 135 544
HLA-DQA1*01:03/DQB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 111 447
HLA-DPA1*03:01/DPB1*11:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 379 1524
HLA-DQA1*01:03/DQB1*06:02 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 476 1911
HLA-DRB1*13:02 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 247 991
HLA-DPA1*04:01/DPB1*17:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 481 1928
HLA-DQA1*05:01/DQB1*04:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 136 544
HLA-DRB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 301 1203
HLA-DQA1*01:02/DQB1*06:02 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 438 1747
HLA-DPA1*03:01/DPB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 373 1486
HLA-DPA1*03:01/DPB1*02:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 95 377
HLA-DRB1*11:04 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 445 1761
HLA-DQA1*02:01/DQB1*03:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 193 762
HLA-DQA1*01:03/DQB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 216 852
HLA-DPA1*04:01/DPB1*01:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 359 1411
HLA-DRB1*08:04 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 414 1627
HLA-DQA1*01:02/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 150 588
HLA-DQA1*01:03/DQB1*05:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 392 1533
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHAISGT 44 172
HLA-DQA1*01:02/DQB1*05:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 76 297
HLA-DQA1*01:03/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 350 1367
HLA-DQA1*01:03/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 350 1367
HLA-DQA1*05:01/DQB1*03:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 254 992
HLA-DQA1*05:01/DQB1*03:19 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 254 992
HLA-DPA1*04:01/DPB1*85:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 473 1847
HLA-DQA1*01:03/DQB1*06:09 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 256 999
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 70 18
HLA-DQA1*01:03/DQB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 221 859
HLA-DPA1*03:01/DPB1*05:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 339 1316
HLA-DPA1*04:01/DPB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 360 1397
HLA-DRB1*13:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 274 1063
HLA-DRB1*15:03 LPFFSNVTWFHAIHVSG LPFFSNVTWFHAISG 63 244
HLA-DPA1*04:01/DPB1*09:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 409 1584
HLA-DPA1*04:01/DPB1*01:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 456 1762
HLA-DQA1*03:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 420 1621
HLA-DQA1*03:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 420 1621
HLA-DPA1*03:01/DPB1*17:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 365 1408
HLA-DPA1*04:01/DPB1*14:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 365 1406
HLA-DRB1*11:04 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 444 1710
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 134 516
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 134 516
HLA-DPA1*02:02/DPB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 486 1868
HLA-DPA1*03:01/DPB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 323 1241
HLA-DPA1*04:01/DPB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 405 1553
HLA-DQA1*06:01/DQB1*03:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 414 1583
HLA-DQA1*06:01/DQB1*03:19 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 414 1583
HLA-DPA1*03:01/DPB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 270 1026
HLA-DQA1*01:02/DQB1*06:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 296 1123
HLA-DQA1*05:01/DQB1*04:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 144 546
HLA-DPA1*04:01/DPB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 496 1880
HLA-DPA1*04:01/DPB1*17:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 441 1664
HLA-DQA1*02:01/DQB1*04:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 238 898
HLA-DRB1*14:04 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 452 1705
HLA-DQA1*02:01/DQB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 415 1561
HLA-DPA1*02:02/DPB1*02:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 465 1743
HLA-DQA1*06:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 421 1578
HLA-DQA1*01:02/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 170 636
HLA-DQA1*01:03/DQB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 107 400
HLA-DPA1*01:03/DPB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 403 1505
HLA-DRB1*08:04 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 384 1433
HLA-DPA1*03:01/DPB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 341 1271
HLA-DPA1*04:01/DPB1*85:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 429 1597
HLA-DPA1*03:01/DPB1*06:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 299 1113
HLA-DPA1*03:01/DPB1*11:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 353 1314
HLA-DQA1*02:01/DQB1*03:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 224 833
HLA-DRB1*13:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 247 917
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 63 17
HLA-DQA1*01:03/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 301 1113
HLA-DQA1*01:03/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 301 1113
HLA-DPA1*03:01/DPB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 386 1425
HLA-DPA1*03:01/DPB1*105:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 386 1425
HLA-DPA1*04:01/DPB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 375 1377
HLA-DPA1*01:03/DPB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 384 1398
HLA-DPA1*03:01/DPB1*09:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 488 1774
HLA-DPA1*02:02/DPB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 454 1650
HLA-DPA1*04:01/DPB1*11:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 438 1591
HLA-DQA1*02:01/DQB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 235 852
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 53 192
HLA-DQA1*06:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 479 1733
HLA-DPA1*03:01/DPB1*17:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 341 1230
HLA-DQA1*02:01/DQB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 234 844
HLA-DQA1*01:03/DQB1*06:09 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 234 843
HLA-DQA1*06:01/DQB1*03:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 465 1675
HLA-DQA1*06:01/DQB1*03:19 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 465 1675
HLA-DRB1*15:02 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 348 1252
HLA-DRB1*04:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 145 521
HLA-DPA1*04:01/DPB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 334 1200
HLA-DRB1*15:03 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHAIS 61 219
HLA-DQA1*05:01/DQB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 143 513
HLA-DQA1*01:02/DQB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 223 798
HLA-DQA1*01:02/DQB1*06:02 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 324 1159
HLA-DRB1*04:04 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 222 794
HLA-DPA1*04:01/DPB1*17:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 395 1411
HLA-DPA1*04:01/DPB1*01:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 267 953
HLA-DQA1*01:03/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 280 994
HLA-DQA1*01:03/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 280 994
HLA-DQA1*02:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 363 1288
HLA-DQA1*05:01/DQB1*04:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 169 599
HLA-DQA1*02:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 141 499
HLA-DQA1*02:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 141 499
HLA-DPA1*02:02/DPB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 427 1510
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 185 654
HLA-DPA1*04:01/DPB1*05:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 354 1251
HLA-DPA1*01:03/DPB1*02:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 323 1141
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 77 272
HLA-DQA1*01:03/DQB1*06:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 289 1020
HLA-DQA1*06:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 383 1351
HLA-DQA1*06:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 383 1351
HLA-DPA1*02:02/DPB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 306 1076
HLA-DPA1*04:01/DPB1*03:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 403 1416
HLA-DRB1*14:04 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 395 1387
HLA-DPA1*04:01/DPB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 373 1309
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRFDNP TWFHAISGTNGTKRFDNP 81 283
HLA-DPA1*03:01/DPB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 237 828
HLA-DPA1*03:01/DPB1*105:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 237 828
HLA-DQA1*03:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 359 1254
HLA-DQA1*03:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 359 1254
HLA-DPA1*02:02/DPB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 377 1316
HLA-DRB1*11:01 VTWFHAIHVSGTNGTKRF VTWFHAISGTNGTKRF 1428 412
HLA-DQA1*01:03/DQB1*06:02 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 396 1371
HLA-DRB1*16:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 59 204
HLA-DQA1*02:01/DQB1*04:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 247 854
HLA-DQA1*01:02/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 191 659
HLA-DQA1*02:01/DQB1*03:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 224 770
HLA-DPA1*02:02/DPB1*02:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 343 1179
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 126 433
HLA-DPA1*03:01/DPB1*17:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 280 961
HLA-DPA1*04:01/DPB1*85:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 348 1194
HLA-DRB1*01:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 239 817
HLA-DPA1*03:01/DPB1*02:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 63 215
HLA-DQA1*02:01/DQB1*03:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 270 921
HLA-DPA1*04:01/DPB1*09:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 374 1275
HLA-DQA1*06:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 381 1292
HLA-DQA1*06:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 381 1292
HLA-DQA1*02:01/DQB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 243 824
HLA-DRB1*15:02 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 129 437
HLA-DQA1*01:03/DQB1*06:09 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 225 762
HLA-DPA1*04:01/DPB1*85:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 381 1290
HLA-DPA1*04:01/DPB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 282 954
HLA-DPA1*04:01/DPB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 439 1479
HLA-DRB1*01:01 FSNVTWFHAIHVSGTNGT FSNVTWFHAISGTNGT 195 58
HLA-DQA1*01:02/DQB1*06:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 319 1071
HLA-DRB1*16:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 138 463
HLA-DQA1*05:01/DQB1*06:09 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 500 1677
HLA-DRB1*10:01 SNVTWFHAIHVSGTNGTK SNVTWFHAISGTNGTK 124 37
HLA-DPA1*01:03/DPB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 370 1238
HLA-DPA1*03:01/DPB1*09:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 451 1509
HLA-DPA1*03:01/DPB1*06:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 285 953
HLA-DRB1*15:01 LFLPFFSNVTWFHAIHVSG LFLPFFSNVTWFHAISG 47 157
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 48 160
HLA-DPA1*03:01/DPB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 254 846
HLA-DQA1*06:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 411 1368
HLA-DQA1*06:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 411 1368
HLA-DQA1*01:02/DQB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 220 729
HLA-DPA1*03:01/DPB1*11:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 303 1003
HLA-DRB1*15:02 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 201 665
HLA-DQA1*03:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 325 1075
HLA-DQA1*03:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 325 1075
HLA-DPA1*04:01/DPB1*10:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 447 1478
HLA-DPA1*04:01/DPB1*17:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 376 1242
HLA-DQA1*01:02/DQB1*06:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 293 965
HLA-DRB1*13:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 257 846
HLA-DQA1*01:03/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 275 904
HLA-DQA1*01:03/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 275 904
HLA-DPA1*02:02/DPB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 433 1423
HLA-DPA1*03:01/DPB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 189 621
HLA-DRB1*16:01 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 799 244
HLA-DPA1*02:02/DPB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 474 1552
HLA-DQA1*01:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 481 1574
HLA-DPA1*04:01/DPB1*02:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 241 788
HLA-DRB1*14:04 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 384 1255
HLA-DQA1*05:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 346 1130
HLA-DRB1*13:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 249 812
HLA-DQA1*01:03/DQB1*04:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 497 1620
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 106 344
HLA-DQA1*01:03/DQB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 94 305
HLA-DPA1*02:02/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 218 707
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 128 414
HLA-DPA1*04:01/DPB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 362 1170
HLA-DRB1*14:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 498 1605
HLA-DQA1*01:02/DQB1*05:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 69 222
HLA-DQA1*01:03/DQB1*05:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 343 1102
HLA-DPA1*04:01/DPB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 288 924
HLA-DPA1*01:03/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 308 987
HLA-DQA1*03:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 309 990
HLA-DQA1*03:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 309 990
HLA-DRB1*15:03 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 176 563
HLA-DQA1*05:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 299 956
HLA-DQA1*05:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 299 956
HLA-DRB1*15:03 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 320 1021
HLA-DPA1*04:01/DPB1*17:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 361 1151
HLA-DPA1*04:01/DPB1*17:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 324 1028
HLA-DRB1*08:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 323 1024
HLA-DPA1*04:01/DPB1*11:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 317 1004
HLA-DQA1*01:02/DQB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 61 193
HLA-DQA1*01:02/DQB1*06:02 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 403 1272
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 45 142
HLA-DRB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 365 1150
HLA-DRB1*10:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 40 126
HLA-DPA1*04:01/DPB1*26:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 454 1429
HLA-DRB1*15:03 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHAISGT 96 302
HLA-DRB1*11:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 206 647
HLA-DPA1*04:01/DPB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 263 825
HLA-DQA1*01:02/DQB1*05:01 AIHVSGTNGTKRFDNPVLPF AISGTNGTKRFDNPVLPF 472 1480
HLA-DPA1*03:01/DPB1*09:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 454 1423
HLA-DRB1*15:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 46 144
HLA-DQA1*01:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 478 1496
HLA-DPA1*04:01/DPB1*09:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 360 1126
HLA-DQA1*01:03/DQB1*06:01 HAIHVSGTNGTKRFDNP HAISGTNGTKRFDNP 419 1309
HLA-DPA1*01:03/DPB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 491 1533
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 118 367
HLA-DRB1*14:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 463 1436
HLA-DQA1*01:02/DQB1*06:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 337 1045
HLA-DPA1*04:01/DPB1*11:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 372 1152
HLA-DPA1*03:01/DPB1*04:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 194 600
HLA-DRB1*04:04 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 206 637
HLA-DQA1*01:03/DQB1*05:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 296 915
HLA-DPA1*03:01/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 144 445
HLA-DPA1*03:01/DPB1*02:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 57 176
HLA-DRB1*11:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 356 1098
HLA-DPA1*04:01/DPB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 231 712
HLA-DQA1*02:01/DQB1*04:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 284 874
HLA-DQA1*01:03/DQB1*05:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 287 882
HLA-DPA1*04:01/DPB1*10:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 433 1330
HLA-DPA1*04:01/DPB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 332 1019
HLA-DPA1*03:01/DPB1*06:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 231 709
HLA-DPA1*02:02/DPB1*02:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 318 974
HLA-DQA1*01:03/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 291 891
HLA-DQA1*01:03/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 291 891
HLA-DRB1*04:04 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 270 826
HLA-DPA1*03:01/DPB1*09:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 402 1229
HLA-DQA1*03:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 320 978
HLA-DQA1*03:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 320 978
HLA-DQA1*02:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 296 904
HLA-DPA1*01:03/DPB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 448 1368
HLA-DPA1*01:03/DPB1*02:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 199 606
HLA-DPA1*03:01/DPB1*04:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 117 356
HLA-DPA1*04:01/DPB1*03:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 437 1327
HLA-DRB1*01:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 31 94
HLA-DRB1*15:02 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 115 347
HLA-DPA1*04:01/DPB1*85:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 351 1059
HLA-DRB1*04:04 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 359 1083
HLA-DPA1*03:01/DPB1*04:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 214 645
HLA-DPA1*03:01/DPB1*105:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 214 645
HLA-DPA1*04:01/DPB1*11:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 290 872
HLA-DPA1*03:01/DPB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 208 625
HLA-DQA1*04:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 496 1489
HLA-DRB1*15:03 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 62 186
HLA-DQA1*01:03/DQB1*06:02 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 345 1034
HLA-DPA1*04:01/DPB1*06:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 316 944
HLA-DPA1*03:01/DPB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 222 663
HLA-DPA1*02:02/DPB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 206 614
HLA-DQA1*03:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 358 1067
HLA-DQA1*03:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 358 1067
HLA-DPA1*04:01/DPB1*09:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 335 998
HLA-DPA1*04:01/DPB1*10:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 411 1224
HLA-DQA1*01:03/DQB1*06:09 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 252 750
HLA-DPA1*02:02/DPB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 417 1241
HLA-DPA1*04:01/DPB1*09:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 358 1065
HLA-DQA1*01:03/DQB1*05:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 75 223
HLA-DPA1*03:01/DPB1*10:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 496 1474
HLA-DQA1*01:03/DQB1*06:09 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 236 701
HLA-DPA1*04:01/DPB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 228 677
HLA-DPA1*04:01/DPB1*10:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 380 1128
HLA-DPA1*01:03/DPB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 442 1312
HLA-DQA1*02:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 116 344
HLA-DQA1*02:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 116 344
HLA-DQA1*06:01/DQB1*03:01 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 316 935
HLA-DQA1*06:01/DQB1*03:19 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 316 935
HLA-DPA1*03:01/DPB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 311 920
HLA-DPA1*04:01/DPB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 207 612
HLA-DPA1*01:03/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 361 1064
HLA-DPA1*04:01/DPB1*03:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 406 1196
HLA-DPA1*01:03/DPB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 476 1402
HLA-DPA1*04:01/DPB1*11:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 257 756
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 33 97
HLA-DQA1*01:02/DQB1*06:09 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 491 1443
HLA-DPA1*04:01/DPB1*85:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 322 944
HLA-DQA1*06:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 342 1001
HLA-DQA1*06:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 342 1001
HLA-DPA1*04:01/DPB1*14:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 450 1315
HLA-DQA1*01:03/DQB1*06:02 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 353 1031
HLA-DQA1*01:02/DQB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 60 175
HLA-DQA1*05:01/DQB1*03:01 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 195 567
HLA-DQA1*05:01/DQB1*03:19 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 195 567
HLA-DPA1*04:01/DPB1*26:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 437 1270
HLA-DPA1*03:01/DPB1*85:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 339 984
HLA-DQA1*01:03/DQB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 497 1442
HLA-DRB1*04:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 149 432
HLA-DRB1*14:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 471 1359
HLA-DPA1*02:02/DPB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 384 1106
HLA-DQA1*01:03/DQB1*05:03 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 248 714
HLA-DQA1*03:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 458 1316
HLA-DQA1*03:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 458 1316
HLA-DPA1*04:01/DPB1*02:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 154 442
HLA-DPA1*04:01/DPB1*06:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 304 872
HLA-DPA1*03:01/DPB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 285 816
HLA-DQA1*01:03/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 335 958
HLA-DQA1*01:03/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 335 958
HLA-DQA1*05:01/DQB1*04:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 256 731
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 69 197
HLA-DRB1*15:03 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 110 314
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 109 311
HLA-DPA1*04:01/DPB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 252 719
HLA-DPA1*03:01/DPB1*02:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 163 465
HLA-DQA1*05:01/DQB1*06:09 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 499 1423
HLA-DQA1*02:01/DQB1*03:03 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 500 1425
HLA-DRB1*14:04 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 415 1180
HLA-DPA1*01:03/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 393 1117
HLA-DRB1*15:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 31 88
HLA-DRB1*15:03 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 105 298
HLA-DRB1*14:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 484 1373
HLA-DPA1*03:01/DPB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 196 556
HLA-DRB1*16:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 189 536
HLA-DQA1*05:01/DQB1*06:09 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 471 1335
HLA-DQA1*05:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 280 793
HLA-DQA1*01:03/DQB1*06:02 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 311 880
HLA-DPA1*01:03/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 285 806
HLA-DPA1*03:01/DPB1*01:01 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 453 1281
HLA-DQA1*01:03/DQB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 84 237
HLA-DPA1*02:02/DPB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 475 1340
HLA-DPA1*02:02/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 401 1131
HLA-DRB1*04:01 NVTWFHAIHVSGTNGTKR NVTWFHAISGTNGTKR 692 246
HLA-DPA1*04:01/DPB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 288 810
HLA-DQA1*02:01/DQB1*03:01 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 106 298
HLA-DQA1*02:01/DQB1*03:19 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 106 298
HLA-DPA1*04:01/DPB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 481 1352
HLA-DPA1*04:01/DPB1*105:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 481 1352
HLA-DPA1*03:01/DPB1*85:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 430 1207
HLA-DQA1*01:03/DQB1*06:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 243 682
HLA-DPA1*03:01/DPB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 124 348
HLA-DQA1*01:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 491 1377
HLA-DPA1*04:01/DPB1*14:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 420 1177
HLA-DPA1*03:01/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 161 450
HLA-DRB1*01:02 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 327 117
HLA-DPA1*02:02/DPB1*02:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 290 810
HLA-DPA1*04:01/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 213 594
HLA-DQA1*01:01/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 496 1383
HLA-DPA1*01:03/DPB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 382 1064
HLA-DQA1*03:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 433 1206
HLA-DQA1*03:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 433 1206
HLA-DQA1*01:03/DQB1*06:09 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 245 682
HLA-DQA1*01:03/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 379 1052
HLA-DQA1*01:03/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 379 1052
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 255 92
HLA-DPA1*03:01/DPB1*02:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 48 133
HLA-DPA1*03:01/DPB1*04:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 100 277
HLA-DQA1*01:02/DQB1*05:01 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 250 691
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 38 105
HLA-DPA1*01:03/DPB1*02:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 177 489
HLA-DRB1*04:04 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 206 568
HLA-DRB1*15:01 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 53 146
HLA-DPA1*04:01/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 157 431
HLA-DPA1*04:01/DPB1*04:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 414 1133
HLA-DQA1*02:01/DQB1*04:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 373 1020
HLA-DQA1*03:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 350 956
HLA-DQA1*03:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 350 956
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHAISG 102 278
HLA-DPA1*02:01/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 386 1051
HLA-DRB1*11:01 NVTWFHAIHVSGTNGTKR NVTWFHAISGTNGTKR 980 360
HLA-DPA1*04:01/DPB1*06:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 271 737
HLA-DRB1*14:04 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 412 1117
HLA-DQA1*02:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 96 260
HLA-DQA1*02:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 96 260
HLA-DQA1*01:03/DQB1*05:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 314 850
HLA-DPA1*04:01/DPB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 241 652
HLA-DRB1*04:07 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHAIS 1028 380
HLA-DQA1*01:03/DQB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 483 1306
HLA-DRB1*08:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 384 1038
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNGT FSNVTWFHAISGTNGT 316 853
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 43 16
HLA-DRB1*15:02 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHAISGT 105 282
HLA-DPA1*03:01/DPB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 250 671
HLA-DRB1*15:01 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 444 1187
HLA-DPA1*02:02/DPB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 188 501
HLA-DPA1*02:02/DPB1*02:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 266 708
HLA-DQA1*01:03/DQB1*05:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 286 757
HLA-DPA1*03:01/DPB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 184 487
HLA-DPA1*03:01/DPB1*105:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 184 487
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 64 169
HLA-DRB1*04:01 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 425 1121
HLA-DPA1*03:01/DPB1*01:01 IHVSGTNGTKRFDNPVLPFN ISGTNGTKRFDNPVLPFN 469 1237
HLA-DPA1*02:01/DPB1*02:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 491 1292
HLA-DPA1*01:03/DPB1*02:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 153 402
HLA-DPA1*03:01/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 206 540
HLA-DRB1*16:01 SNVTWFHAIHVSGTNGTK SNVTWFHAISGTNGTK 625 239
HLA-DPA1*04:01/DPB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 232 606
HLA-DQA1*01:02/DQB1*06:02 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 323 843
HLA-DRB1*01:02 SNVTWFHAIHVSGTNGTK SNVTWFHAISGTNGTK 746 286
HLA-DQA1*05:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 245 639
HLA-DQA1*05:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 245 639
HLA-DPA1*02:02/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 336 876
HLA-DQA1*01:02/DQB1*06:02 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 380 988
HLA-DPA1*02:02/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 367 953
HLA-DRB1*08:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 384 995
HLA-DPA1*04:01/DPB1*26:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 448 1159
HLA-DQA1*02:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 249 643
HLA-DPA1*03:01/DPB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 278 717
HLA-DQA1*05:01/DQB1*03:03 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 452 1165
HLA-DQA1*01:01/DQB1*05:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHAIS 453 1166
HLA-DPA1*04:01/DPB1*01:01 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 401 1031
HLA-DPA1*04:01/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 199 510
HLA-DRB1*01:02 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 835 326
HLA-DPA1*04:01/DPB1*26:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 414 1058
HLA-DQA1*01:03/DQB1*06:02 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 356 909
HLA-DQA1*05:01/DQB1*06:09 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 451 1150
HLA-DPA1*01:03/DPB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 258 657
HLA-DPA1*02:01/DPB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 348 885
HLA-DPA1*04:01/DPB1*02:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 139 353
HLA-DPA1*04:01/DPB1*04:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 443 1125
HLA-DPA1*04:01/DPB1*105:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 443 1125
HLA-DQA1*01:02/DQB1*06:09 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHAISGTNGTK 458 1162
HLA-DQA1*05:01/DQB1*06:09 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 476 1206
HLA-DRB1*01:02 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 722 285
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKRFDN VTWFHAISGTNGTKRFDN 49 124
HLA-DQA1*05:01/DQB1*03:03 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 274 693
HLA-DPA1*03:01/DPB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 242 612
HLA-DQA1*01:03/DQB1*06:01 FHAIHVSGTNGTKRFDNPV FHAISGTNGTKRFDNPV 347 877
HLA-DQA1*01:03/DQB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 86 217
HLA-DPA1*03:01/DPB1*04:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 324 817
HLA-DPA1*01:03/DPB1*04:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 382 961
HLA-DRB1*04:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHAISG 379 151
HLA-DRB1*15:03 LFLPFFSNVTWFHAIHVSG LFLPFFSNVTWFHAISG 93 233
HLA-DRB1*04:07 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHAISG 1233 493
HLA-DRB1*04:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHAIS 312 125
HLA-DRB1*15:02 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 97 242
HLA-DPA1*03:01/DPB1*04:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 87 217
HLA-DQA1*05:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 226 563
HLA-DPA1*04:01/DPB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 143 356
HLA-DQA1*02:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 92 229
HLA-DQA1*02:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 92 229
HLA-DQA1*01:03/DQB1*06:02 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 300 745
HLA-DPA1*01:03/DPB1*02:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 137 339
HLA-DPA1*04:01/DPB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 292 721
HLA-DPA1*04:01/DPB1*04:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 257 633
HLA-DQA1*01:02/DQB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 54 133
HLA-DQA1*06:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 300 737
HLA-DQA1*06:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 300 737
HLA-DQA1*05:01/DQB1*03:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 342 840
HLA-DQA1*05:01/DQB1*03:19 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 342 840
HLA-DQA1*02:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 230 564
HLA-DQA1*05:01/DQB1*06:09 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 477 1169
HLA-DPA1*02:01/DPB1*02:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 427 1046
HLA-DQA1*01:02/DQB1*05:03 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 386 944
HLA-DPA1*03:01/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 199 486
HLA-DRB1*08:02 NVTWFHAIHVSGTNGTKR NVTWFHAISGTNGTKR 757 310
HLA-DRB1*16:01 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 269 656
HLA-DQA1*01:03/DQB1*05:01 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 437 1065
HLA-DQA1*01:02/DQB1*06:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 472 1150
HLA-DQA1*01:03/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 480 1168
HLA-DQA1*01:03/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 480 1168
HLA-DPA1*03:01/DPB1*05:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 470 1143
HLA-DPA1*03:01/DPB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 109 265
HLA-DQA1*01:03/DQB1*06:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 485 1179
HLA-DPA1*02:02/DPB1*01:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 358 870
HLA-DRB1*08:02 VTWFHAIHVSGTNGTKRF VTWFHAISGTNGTKRF 882 364
HLA-DPA1*03:01/DPB1*02:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 43 104
HLA-DRB1*11:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 307 740
HLA-DPA1*02:02/DPB1*01:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 182 438
HLA-DPA1*04:01/DPB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 123 296
HLA-DQA1*01:02/DQB1*06:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 382 919
HLA-DQA1*02:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 97 233
HLA-DQA1*02:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 97 233
HLA-DPA1*04:01/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 257 616
HLA-DPA1*02:02/DPB1*13:01 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 494 1183
HLA-DRB1*04:07 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 476 1139
HLA-DRB1*07:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 133 318
HLA-DPA1*01:03/DPB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 222 530
HLA-DQA1*05:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 198 472
HLA-DQA1*05:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 198 472
HLA-DRB1*01:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHAISGTNGTKR 248 591
HLA-DQA1*02:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 118 281
HLA-DQA1*02:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 118 281
HLA-DPA1*04:01/DPB1*01:01 AIHVSGTNGTKRFDNPVLPF AISGTNGTKRFDNPVLPF 489 1163
HLA-DQA1*01:02/DQB1*05:01 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 258 613
HLA-DPA1*03:01/DPB1*04:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 176 418
HLA-DPA1*03:01/DPB1*105:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 176 418
HLA-DRB1*01:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 286 678
HLA-DQA1*01:02/DQB1*05:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 46 109
HLA-DRB1*11:01 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 656 277
HLA-DPA1*04:01/DPB1*02:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 118 279
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 33 78
HLA-DRB1*04:04 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 196 463
HLA-DPA1*03:01/DPB1*02:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 133 314
HLA-DQA1*01:03/DQB1*06:09 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 296 698
HLA-DRB1*16:01 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 290 123
HLA-DPA1*04:01/DPB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 389 917
HLA-DPA1*04:01/DPB1*105:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 389 917
HLA-DQA1*05:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 227 535
HLA-DQA1*01:02/DQB1*05:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 160 377
HLA-DQA1*01:03/DQB1*05:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 286 672
HLA-DQA1*02:01/DQB1*03:03 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 331 777
HLA-DQA1*01:03/DQB1*05:03 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 280 657
HLA-DRB1*16:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 433 185
HLA-DPA1*03:01/DPB1*04:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 80 187
HLA-DPA1*02:02/DPB1*02:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 258 603
HLA-DRB1*15:02 LPFFSNVTWFHAIHVSG LPFFSNVTWFHAISG 95 222
HLA-DQA1*02:01/DQB1*04:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 378 883
HLA-DQA1*05:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 210 490
HLA-DQA1*01:02/DQB1*06:09 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHAISGTNGT 408 951
HLA-DPA1*04:01/DPB1*01:01 IHVSGTNGTKRFDNPVLPFN ISGTNGTKRFDNPVLPFN 384 895
HLA-DRB1*15:02 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 312 726
HLA-DPA1*02:01/DPB1*02:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 391 909
HLA-DQA1*05:01/DQB1*03:03 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHAISGT 337 783
HLA-DRB1*07:01 VTWFHAIHVSGTNGTKRF VTWFHAISGTNGTKRF 855 368
HLA-DPA1*02:02/DPB1*04:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 491 1140
HLA-DPA1*01:03/DPB1*04:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 451 1046
HLA-DPA1*01:03/DPB1*105:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 451 1046
HLA-DRB1*10:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 47 109
HLA-DQA1*02:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 105 243
HLA-DQA1*02:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 105 243
HLA-DQA1*01:02/DQB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 49 113
HLA-DRB1*04:01 SNVTWFHAIHVSGTNGTK SNVTWFHAISGTNGTK 717 311
HLA-DPA1*01:03/DPB1*01:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 200 461
HLA-DPA1*02:01/DPB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 305 702
HLA-DPA1*04:01/DPB1*04:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 215 493
HLA-DQA1*01:03/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 478 1093
HLA-DQA1*01:03/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 478 1093
HLA-DPA1*03:01/DPB1*01:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 100 228
HLA-DQA1*02:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 179 407
HLA-DQA1*02:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 179 407
HLA-DRB1*13:02 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 414 941
HLA-DRB1*07:01 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 77 175
HLA-DQA1*01:02/DQB1*06:01 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 275 622
HLA-DRB1*04:01 VTWFHAIHVSGTNGTKRF VTWFHAISGTNGTKRF 653 289
HLA-DQA1*02:01/DQB1*03:01 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 89 201
HLA-DQA1*02:01/DQB1*03:19 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 89 201
HLA-DRB1*04:04 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 160 361
HLA-DQA1*02:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 235 530
HLA-DQA1*02:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 157 354
HLA-DQA1*02:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 157 354
HLA-DQA1*05:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 211 475
HLA-DRB1*11:01 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 233 524
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTNG FFSNVTWFHAISGTNG 279 626
HLA-DPA1*04:01/DPB1*01:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 111 249
HLA-DQA1*01:03/DQB1*06:01 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 200 447
HLA-DRB1*11:01 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 324 145
HLA-DQA1*02:01/DQB1*03:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 167 373
HLA-DQA1*02:01/DQB1*03:19 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 167 373
HLA-DQA1*01:03/DQB1*06:09 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 451 1006
HLA-DRB1*07:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 101 225
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 31 69
HLA-DQA1*05:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 220 489
HLA-DQA1*05:01/DQB1*04:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 267 593
HLA-DPA1*04:01/DPB1*02:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 414 918
HLA-DRB1*07:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 143 317
HLA-DPA1*04:01/DPB1*04:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 385 852
HLA-DPA1*04:01/DPB1*105:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 385 852
HLA-DRB1*04:07 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 393 868
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHAISGT 97 214
HLA-DRB1*11:01 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 203 447
HLA-DPA1*02:02/DPB1*04:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 451 991
HLA-DQA1*01:02/DQB1*06:01 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 223 490
HLA-DPA1*04:01/DPB1*04:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 184 404
HLA-DQA1*06:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 289 634
HLA-DQA1*06:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 289 634
HLA-DRB1*04:07 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 455 998
HLA-DQA1*01:02/DQB1*05:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHAISGTNGTKRF 290 636
HLA-DPA1*01:03/DPB1*04:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHAISGTNG 340 745
HLA-DQA1*06:01/DQB1*03:01 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 279 611
HLA-DQA1*06:01/DQB1*03:19 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 279 611
HLA-DPA1*03:01/DPB1*01:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 281 614
HLA-DRB1*15:01 DLFLPFFSNVTWFHAIHVS DLFLPFFSNVTWFHAIS 49 107
HLA-DPA1*04:01/DPB1*02:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 109 238
HLA-DPA1*03:01/DPB1*04:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 280 610
HLA-DQA1*05:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 191 415
HLA-DQA1*05:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 191 415
HLA-DQA1*01:03/DQB1*06:02 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 360 782
HLA-DPA1*01:03/DPB1*02:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 122 264
HLA-DPA1*03:01/DPB1*02:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 38 82
HLA-DQA1*02:01/DQB1*06:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 489 1055
HLA-DPA1*03:01/DPB1*01:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 351 756
HLA-DRB1*07:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 92 198
HLA-DQA1*05:01/DQB1*04:02 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 362 779
HLA-DPA1*04:01/DPB1*01:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 265 569
HLA-DQA1*01:02/DQB1*06:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 367 788
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDNP FHAISGTNGTKRFDNP 279 599
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDNP FHAISGTNGTKRFDNP 279 599
HLA-DRB1*01:02 NVTWFHAIHVSGTNGTKRFD NVTWFHAISGTNGTKRFD 373 800
HLA-DRB1*10:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 42 90
HLA-DQA1*01:02/DQB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 49 105
HLA-DQA1*05:01/DQB1*03:03 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 266 569
HLA-DQA1*01:02/DQB1*06:01 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 360 770
HLA-DPA1*04:01/DPB1*04:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 363 774
HLA-DPA1*04:01/DPB1*105:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 363 774
HLA-DRB1*07:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 116 247
HLA-DQA1*01:01/DQB1*05:01 DLFLPFFSNVTWFHAIHVS DLFLPFFSNVTWFHAIS 333 707
HLA-DQA1*01:03/DQB1*06:09 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 412 874
HLA-DQA1*01:02/DQB1*06:02 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 324 687
HLA-DQA1*01:02/DQB1*06:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 494 1047
HLA-DQA1*01:02/DQB1*06:01 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 201 426
HLA-DPA1*04:01/DPB1*04:02 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 307 650
HLA-DPA1*04:01/DPB1*105:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 307 650
HLA-DRB1*04:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHAISGT 428 203
HLA-DRB1*04:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 173 364
HLA-DRB1*11:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHAIS 932 443
HLA-DRB1*10:01 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 29 61
HLA-DQA1*01:02/DQB1*06:01 SNVTWFHAIHVSGTNGT SNVTWFHAISGTNGT 212 445
HLA-DPA1*01:03/DPB1*04:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHAISGTN 284 596
HLA-DQA1*05:01/DQB1*03:01 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 165 346
HLA-DQA1*05:01/DQB1*03:19 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 165 346
HLA-DQA1*01:02/DQB1*06:01 FSNVTWFHAIHVSGTNG FSNVTWFHAISGTNG 236 494
HLA-DPA1*03:01/DPB1*13:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 464 971
HLA-DQA1*06:01/DQB1*03:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 475 994
HLA-DQA1*06:01/DQB1*03:19 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 475 994
HLA-DPA1*03:01/DPB1*04:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 163 341
HLA-DPA1*03:01/DPB1*105:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 163 341
HLA-DRB1*04:01 LPFFSNVTWFHAIHVSG LPFFSNVTWFHAISG 188 90
HLA-DQA1*01:03/DQB1*05:01 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 309 645
HLA-DRB1*11:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHAISGTNG 299 624
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTKR NVTWFHAISGTNGTKR 308 642
HLA-DQA1*02:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 237 494
HLA-DPA1*02:02/DPB1*02:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 234 486
HLA-DQA1*01:03/DQB1*05:01 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 247 513
HLA-DRB1*01:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 56 27
HLA-DRB1*15:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHAIS 96 199
HLA-DQA1*01:03/DQB1*06:01 WFHAIHVSGTNGTKRFDNP WFHAISGTNGTKRFDNP 278 576
HLA-DQA1*01:03/DQB1*06:01 TWFHAIHVSGTNGTKRF TWFHAISGTNGTKRF 169 350
HLA-DRB1*01:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHAIS 205 99
HLA-DQA1*01:02/DQB1*05:03 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHAIS 188 389
HLA-DQA1*01:02/DQB1*06:01 NVTWFHAIHVSGTNGTK NVTWFHAISGTNGTK 209 432
HLA-DPA1*02:02/DPB1*13:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHAISGT 409 845
HLA-DQA1*02:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTK FSNVTWFHAISGTNGTK 234 483
HLA-DQA1*03:01/DQB1*03:01 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 439 906
HLA-DQA1*03:01/DQB1*03:19 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 439 906
HLA-DQA1*05:01/DQB1*03:03 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 302 623
HLA-DQA1*05:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 240 495
HLA-DQA1*05:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 240 495
HLA-DRB1*10:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHAIS 101 49
HLA-DQA1*05:01/DQB1*06:01 WFHAIHVSGTNGTKRFD WFHAISGTNGTKRFD 444 915
HLA-DRB1*04:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHAIS 136 66
HLA-DPA1*04:01/DPB1*04:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 166 342
HLA-DQA1*01:02/DQB1*05:03 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 159 327
HLA-DQA1*01:03/DQB1*05:01 VTWFHAIHVSGTNGTKR VTWFHAISGTNGTKR 442 909
HLA-DRB1*01:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 314 153
HLA-DPA1*02:02/DPB1*04:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 423 868
HLA-DQA1*06:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 313 641
HLA-DQA1*06:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 313 641
HLA-DQA1*01:03/DQB1*03:01 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 488 997
HLA-DQA1*01:03/DQB1*03:19 FHAIHVSGTNGTKRFDN FHAISGTNGTKRFDN 488 997
HLA-DQA1*01:02/DQB1*06:01 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 233 475
HLA-DRB1*10:01 FSNVTWFHAIHVSGTNGT FSNVTWFHAISGTNGT 112 55
HLA-DQA1*05:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 360 733
HLA-DQA1*05:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHAISGTN 360 733
HLA-DPA1*03:01/DPB1*01:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 92 187
HLA-DPA1*01:03/DPB1*04:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 255 518
HLA-DPA1*01:03/DPB1*02:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 98 199
HLA-DPA1*04:01/DPB1*01:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 104 211
HLA-DPA1*03:01/DPB1*01:01 QDLFLPFFSNVTWFHAIHVS QDLFLPFFSNVTWFHAIS 71 144
HLA-DQA1*01:03/DQB1*06:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHAISGTNGT 346 699
HLA-DPA1*02:01/DPB1*01:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHAISGT 289 583
HLA-DRB1*04:04 VTWFHAIHVSGTNGTKRFD VTWFHAISGTNGTKRFD 303 611
HLA-DQA1*05:01/DQB1*03:01 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 249 502
HLA-DQA1*05:01/DQB1*03:19 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 249 502
HLA-DQA1*02:01/DQB1*03:01 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 130 262
HLA-DQA1*02:01/DQB1*03:19 FFSNVTWFHAIHVSGTN FFSNVTWFHAISGTN 130 262
HLA-DQA1*05:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 204 411
HLA-DQA1*05:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 204 411
HLA-DPA1*02:01/DPB1*02:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 353 711
HLA-DPA1*03:01/DPB1*04:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHAISG 72 145
HLA-DQA1*01:02/DQB1*06:01 TWFHAIHVSGTNGTKRFDN TWFHAISGTNGTKRFDN 300 604
HLA-DRB1*07:01 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHAISGT 98 197
HLA-DRB1*15:02 LFLPFFSNVTWFHAIHVSG LFLPFFSNVTWFHAISG 102 205
HLA-DQA1*01:02/DQB1*05:01 SNVTWFHAIHVSGTNGTKR SNVTWFHAISGTNGTKR 133 267
HLA-DRB1*01:02 NVTWFHAIHVSGTNGTKRF NVTWFHAISGTNGTKRF 486 243

Y144 deletion

Reference  IVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFE
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    IVNNATNVVIKVCEFQFCNDPFLGVYHKNNKSWMESEFRVYSSANNCTFE

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*04:01 VCEFQFCNDPFLGVYY - 60 -
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY - 63 -
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY - 66 -
HLA-DPA1*04:01/DPB1*04:01 VCEFQFCNDPFLGVYY - 73 -
HLA-DPA1*03:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYY - 74 -
HLA-DPA1*03:01/DPB1*04:01 KVCEFQFCNDPFLGVYY - 75 -
HLA-DPA1*01:03/DPB1*04:01 VCEFQFCNDPFLGVYY - 79 -
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVYSSA - 83 -
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVYY - 85 -
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYY - 86 -
HLA-DPA1*04:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY - 93 -
HLA-DPA1*01:03/DPB1*04:01 KVCEFQFCNDPFLGVYY - 94 -
HLA-DPA1*04:01/DPB1*04:01 KVCEFQFCNDPFLGVYY - 94 -
HLA-DPA1*01:03/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY - 97 -
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGVYY - 98 -
HLA-DPA1*03:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY - 102 -
HLA-DPA1*03:01/DPB1*04:02 VVIKVCEFQFCNDPFLGVYY - 102 -
HLA-DPA1*03:01/DPB1*105:01 VVIKVCEFQFCNDPFLGVYY - 102 -
HLA-DQA1*01:02/DQB1*05:01 VVIKVCEFQFCNDPFLGVYY - 103 -
HLA-DPA1*04:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYY - 104 -
HLA-DPA1*03:01/DPB1*04:02 VCEFQFCNDPFLGVYY - 107 -
HLA-DPA1*03:01/DPB1*105:01 VCEFQFCNDPFLGVYY - 107 -
HLA-DPA1*04:01/DPB1*02:01 VCEFQFCNDPFLGVYY - 108 -
HLA-DPA1*04:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY - 110 -
HLA-DPA1*03:01/DPB1*01:01 VCEFQFCNDPFLGVYY - 114 -
HLA-DPA1*01:03/DPB1*04:01 VIKVCEFQFCNDPFLGVYY - 121 -
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVYSSA - 122 -
HLA-DPA1*02:02/DPB1*01:01 VCEFQFCNDPFLGVYY - 124 -
HLA-DPA1*03:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYY - 125 -
HLA-DQA1*01:02/DQB1*05:01 VCEFQFCNDPFLGVYY - 125 -
HLA-DPA1*03:01/DPB1*04:02 KVCEFQFCNDPFLGVYY - 126 -
HLA-DPA1*03:01/DPB1*105:01 KVCEFQFCNDPFLGVYY - 126 -
HLA-DPA1*01:03/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY - 127 -
HLA-DPA1*03:01/DPB1*04:02 VIKVCEFQFCNDPFLGVYY - 130 -
HLA-DPA1*03:01/DPB1*105:01 VIKVCEFQFCNDPFLGVYY - 130 -
HLA-DPA1*04:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYY - 131 -
HLA-DPA1*04:01/DPB1*02:01 KVCEFQFCNDPFLGVYY - 131 -
HLA-DPA1*02:02/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY - 133 -
HLA-DPA1*03:01/DPB1*01:01 KVCEFQFCNDPFLGVYY - 135 -
HLA-DPA1*03:01/DPB1*04:01 IKVCEFQFCNDPFLGVYY - 135 -
HLA-DQA1*01:02/DQB1*05:01 VIKVCEFQFCNDPFLGVYY - 136 -
HLA-DPA1*02:01/DPB1*01:01 VCEFQFCNDPFLGVYY - 137 -
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVYSS - 138 -
HLA-DPA1*04:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY - 140 -
HLA-DPA1*03:01/DPB1*01:01 YYHKNNKSWMESEFRVYSSA - 147 -
HLA-DPA1*04:01/DPB1*02:01 YYHKNNKSWMESEFRVYSSA - 147 -
HLA-DPA1*01:03/DPB1*01:01 VCEFQFCNDPFLGVYY - 150 -
HLA-DPA1*04:01/DPB1*01:01 VCEFQFCNDPFLGVYY - 151 -
HLA-DPA1*01:03/DPB1*02:01 YYHKNNKSWMESEFRVYSSA - 152 -
HLA-DPA1*02:02/DPB1*01:01 KVCEFQFCNDPFLGVYY - 153 -
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVYY - 158 -
HLA-DPA1*01:03/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY - 159 -
HLA-DPA1*02:02/DPB1*01:01 VIKVCEFQFCNDPFLGVYY - 162 -
HLA-DPA1*02:01/DPB1*01:01 KVCEFQFCNDPFLGVYY - 167 -
HLA-DQA1*01:02/DQB1*05:01 KVCEFQFCNDPFLGVYY - 168 -
HLA-DPA1*02:01/DPB1*01:01 VVIKVCEFQFCNDPFLGVYY - 169 -
HLA-DPA1*04:01/DPB1*04:01 YYHKNNKSWMESEFRVYSSA - 174 -
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGVYY - 178 -
HLA-DPA1*02:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYY - 179 -
HLA-DPA1*02:02/DPB1*01:01 YYHKNNKSWMESEFRVYSSA - 179 -
HLA-DPA1*01:03/DPB1*02:01 VIKVCEFQFCNDPFLGVYY - 181 -
HLA-DPA1*01:03/DPB1*01:01 VIKVCEFQFCNDPFLGVYY - 182 -
HLA-DPA1*04:01/DPB1*01:01 YYHKNNKSWMESEFRVYSSA - 183 -
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLGVYY - 184 -
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVYSS - 185 -
HLA-DPA1*04:01/DPB1*04:01 IKVCEFQFCNDPFLGVYY - 185 -
HLA-DPA1*04:01/DPB1*01:01 VIKVCEFQFCNDPFLGVYY - 186 -
HLA-DPA1*04:01/DPB1*01:01 KVCEFQFCNDPFLGVYY - 188 -
HLA-DPA1*01:03/DPB1*01:01 KVCEFQFCNDPFLGVYY - 189 -
HLA-DPA1*02:02/DPB1*04:01 VCEFQFCNDPFLGVYY - 201 -
HLA-DQA1*01:02/DQB1*05:01 YYHKNNKSWMESEFRVYSSA - 204 -
HLA-DPA1*03:01/DPB1*05:01 VVIKVCEFQFCNDPFLGVYY - 209 -
HLA-DPA1*01:03/DPB1*04:01 YYHKNNKSWMESEFRVYSSA - 219 -
HLA-DPA1*03:01/DPB1*01:01 YYHKNNKSWMESEFRVYSS - 219 -
HLA-DQA1*01:02/DQB1*05:01 IKVCEFQFCNDPFLGVYY - 222 -
HLA-DPA1*03:01/DPB1*01:01 IKVCEFQFCNDPFLGVYY - 227 -
HLA-DPA1*02:02/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY - 231 -
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVY - 236 -
HLA-DPA1*04:01/DPB1*02:01 YYHKNNKSWMESEFRVYSS - 241 -
HLA-DPA1*01:03/DPB1*04:01 IKVCEFQFCNDPFLGVYY - 244 -
HLA-DPA1*02:02/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY - 246 -
HLA-DPA1*02:02/DPB1*04:01 KVCEFQFCNDPFLGVYY - 250 -
HLA-DPA1*02:02/DPB1*01:01 IKVCEFQFCNDPFLGVYY - 252 -
HLA-DPA1*02:02/DPB1*02:01 VCEFQFCNDPFLGVYY - 256 -
HLA-DPA1*01:03/DPB1*02:01 YYHKNNKSWMESEFRVYSS - 261 -
HLA-DPA1*04:01/DPB1*02:01 IKVCEFQFCNDPFLGVYY - 261 -
HLA-DPA1*04:01/DPB1*04:02 VVIKVCEFQFCNDPFLGVYY - 261 -
HLA-DPA1*04:01/DPB1*105:01 VVIKVCEFQFCNDPFLGVYY - 261 -
HLA-DPA1*02:01/DPB1*04:01 VCEFQFCNDPFLGVYY - 265 -
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVY - 272 -
HLA-DPA1*02:02/DPB1*04:01 VIKVCEFQFCNDPFLGVYY - 273 -
HLA-DPA1*03:01/DPB1*01:01 YYHKNNKSWMESEFRVY - 275 -
HLA-DPA1*04:01/DPB1*01:01 YYHKNNKSWMESEFRVYSS - 276 -
HLA-DPA1*04:01/DPB1*04:01 YYHKNNKSWMESEFRVYSS - 276 -
HLA-DPA1*04:01/DPB1*04:02 VCEFQFCNDPFLGVYY - 276 -
HLA-DPA1*04:01/DPB1*105:01 VCEFQFCNDPFLGVYY - 276 -
HLA-DPA1*01:03/DPB1*01:01 YYHKNNKSWMESEFRVYSSA - 283 -
HLA-DPA1*03:01/DPB1*04:02 IKVCEFQFCNDPFLGVYY - 287 -
HLA-DPA1*03:01/DPB1*105:01 IKVCEFQFCNDPFLGVYY - 287 -
HLA-DPA1*02:02/DPB1*01:01 YYHKNNKSWMESEFRVYSS - 290 -
HLA-DPA1*03:01/DPB1*05:01 YYHKNNKSWMESEFRVYSSA - 292 -
HLA-DPA1*03:01/DPB1*05:01 VIKVCEFQFCNDPFLGVYY - 295 -
HLA-DPA1*02:01/DPB1*01:01 YYHKNNKSWMESEFRVYSSA - 298 -
HLA-DPA1*02:01/DPB1*01:01 IKVCEFQFCNDPFLGVYY - 301 -
HLA-DPA1*02:01/DPB1*04:01 VVIKVCEFQFCNDPFLGVYY - 303 -
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVYS - 304 -
HLA-DPA1*02:02/DPB1*02:01 KVCEFQFCNDPFLGVYY - 308 -
HLA-DQA1*01:03/DQB1*05:01 VVIKVCEFQFCNDPFLGVYY - 309 -
HLA-DPA1*02:01/DPB1*04:01 KVCEFQFCNDPFLGVYY - 315 -
HLA-DPA1*04:01/DPB1*01:01 IKVCEFQFCNDPFLGVYY - 321 -
HLA-DPA1*02:02/DPB1*02:01 YYHKNNKSWMESEFRVYSSA - 324 -
HLA-DPA1*02:02/DPB1*02:01 VIKVCEFQFCNDPFLGVYY - 326 -
HLA-DPA1*04:01/DPB1*04:02 VIKVCEFQFCNDPFLGVYY - 328 -
HLA-DPA1*04:01/DPB1*105:01 VIKVCEFQFCNDPFLGVYY - 328 -
HLA-DPA1*04:01/DPB1*04:02 KVCEFQFCNDPFLGVYY - 332 -
HLA-DPA1*04:01/DPB1*105:01 KVCEFQFCNDPFLGVYY - 332 -
HLA-DPA1*02:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVYY - 338 -
HLA-DQA1*01:02/DQB1*05:01 YYHKNNKSWMESEFRVYSS - 338 -
HLA-DQA1*01:03/DQB1*05:01 VCEFQFCNDPFLGVYY - 339 -
HLA-DPA1*03:01/DPB1*04:02 YYHKNNKSWMESEFRVYSSA - 340 -
HLA-DPA1*03:01/DPB1*105:01 YYHKNNKSWMESEFRVYSSA - 340 -
HLA-DPA1*03:01/DPB1*05:01 VCEFQFCNDPFLGVYY - 345 -
HLA-DQA1*01:02/DQB1*06:09 VCEFQFCNDPFLGVYY - 346 -
HLA-DPA1*01:03/DPB1*01:01 IKVCEFQFCNDPFLGVYY - 354 -
HLA-DPA1*04:01/DPB1*01:01 YYHKNNKSWMESEFRVY - 357 -
HLA-DPA1*01:03/DPB1*04:02 VVIKVCEFQFCNDPFLGVYY - 361 -
HLA-DPA1*01:03/DPB1*105:01 VVIKVCEFQFCNDPFLGVYY - 361 -
HLA-DPA1*02:01/DPB1*04:01 VIKVCEFQFCNDPFLGVYY - 372 -
HLA-DPA1*03:01/DPB1*05:01 KVCEFQFCNDPFLGVYY - 373 -
HLA-DPA1*04:01/DPB1*05:01 YYHKNNKSWMESEFRVYSSA - 381 -
HLA-DPA1*02:02/DPB1*01:01 YYHKNNKSWMESEFRVY - 385 -
HLA-DQA1*01:03/DQB1*05:01 VIKVCEFQFCNDPFLGVYY - 391 -
HLA-DPA1*02:01/DPB1*02:01 VCEFQFCNDPFLGVYY - 392 -
HLA-DPA1*04:01/DPB1*02:01 YYHKNNKSWMESEFRVY - 394 -
HLA-DPA1*01:03/DPB1*04:01 YYHKNNKSWMESEFRVYSS - 395 -
HLA-DPA1*04:01/DPB1*05:01 VVIKVCEFQFCNDPFLGVYY - 398 -
HLA-DPA1*02:02/DPB1*04:01 YYHKNNKSWMESEFRVYSSA - 401 -
HLA-DPA1*01:03/DPB1*01:01 YYHKNNKSWMESEFRVYSS - 404 -
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLGVYY - 406 -
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVYS - 408 -
HLA-DPA1*04:01/DPB1*04:01 YYHKNNKSWMESEFRVY - 408 -
HLA-DPA1*01:03/DPB1*04:02 VCEFQFCNDPFLGVYY - 416 -
HLA-DPA1*01:03/DPB1*105:01 VCEFQFCNDPFLGVYY - 416 -
HLA-DPA1*02:02/DPB1*05:01 YYHKNNKSWMESEFRVYSSA - 430 -
HLA-DQA1*01:03/DQB1*05:01 KVCEFQFCNDPFLGVYY - 430 -
HLA-DQA1*01:03/DQB1*05:01 YYHKNNKSWMESEFRVYSSA - 430 -
HLA-DPA1*02:02/DPB1*04:01 IKVCEFQFCNDPFLGVYY - 437 -
HLA-DPA1*03:01/DPB1*01:01 YYHKNNKSWMESEFRVYS - 438 -
HLA-DQA1*01:02/DQB1*05:03 VCEFQFCNDPFLGVYY - 443 -
HLA-DQA1*01:02/DQB1*06:04 VCEFQFCNDPFLGVYY - 443 -
HLA-DQA1*01:02/DQB1*06:09 VVIKVCEFQFCNDPFLGVYY - 443 -
HLA-DPA1*02:01/DPB1*02:01 KVCEFQFCNDPFLGVYY - 447 -
HLA-DPA1*02:02/DPB1*05:01 VVIKVCEFQFCNDPFLGVYY - 450 -
HLA-DPA1*02:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYY - 453 -
HLA-DQA1*01:02/DQB1*05:03 YYHKNNKSWMESEFRVYSSA - 454 -
HLA-DQA1*01:02/DQB1*06:09 VIKVCEFQFCNDPFLGVYY - 454 -
HLA-DQA1*01:02/DQB1*06:09 KVCEFQFCNDPFLGVYY - 458 -
HLA-DQA1*01:01/DQB1*05:01 VCEFQFCNDPFLGVYY - 462 -
HLA-DPA1*01:03/DPB1*04:02 KVCEFQFCNDPFLGVYY - 464 -
HLA-DPA1*01:03/DPB1*105:01 KVCEFQFCNDPFLGVYY - 464 -
HLA-DQA1*01:01/DQB1*05:01 VVIKVCEFQFCNDPFLGVYY - 468 -
HLA-DRB1*10:01 VVIKVCEFQFCNDPFLGVYY - 470 -
HLA-DPA1*01:03/DPB1*02:01 YYHKNNKSWMESEFRVY - 476 -
HLA-DPA1*01:03/DPB1*01:01 YYHKNNKSWMESEFRVY - 490 -
HLA-DQA1*01:02/DQB1*06:09 YYHKNNKSWMESEFRVYSSA - 492 -
HLA-DPA1*02:01/DPB1*01:01 YYHKNNKSWMESEFRVYSS - 494 -
HLA-DQA1*01:01/DQB1*05:01 VIKVCEFQFCNDPFLGVYY - 494 -
HLA-DRB1*10:01 VCEFQFCNDPFLGVYY - 496 -
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 113 6575
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 122 6663
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 81 4033
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 87 4236
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 145 6936
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 87 3969
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 101 3890
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 90 3360
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 104 3719
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 104 3705
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 122 4052
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWM DPFLGVYHKNNKSWM 102 3095
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 92 2779
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 120 3545
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 228 6720
HLA-DRB1*15:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 123 3367
HLA-DRB1*15:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 120 3276
HLA-DRB1*15:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 119 3235
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 130 3519
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 401 10412
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 84 2135
HLA-DRB1*15:01 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 131 3317
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMES PFLGVYHKNNKSWMES 171 4212
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 266 6552
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 434 10577
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 89 2141
HLA-DRB1*15:01 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 132 3156
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 158 3767
HLA-DRB1*15:01 FLGVYYHKNNKSWMESEFR FLGVYHKNNKSWMESEFR 152 3597
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWME PFLGVYHKNNKSWME 141 3325
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 67 1560
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 490 10991
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 291 6504
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 135 2987
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 141 2992
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 336 6882
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 178 3643
HLA-DRB1*15:01 QFCNDPFLGVYYHKNNKSW QFCNDPFLGVYHKNNKSW 214 4353
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 146 2954
HLA-DPA1*01:03/DPB1*02:01 CNDPFLGVYYHKNNKSWM CNDPFLGVYHKNNKSWM 193 3863
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 98 1949
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 354 6899
HLA-DPA1*01:03/DPB1*02:01 NDPFLGVYYHKNNKSWME NDPFLGVYHKNNKSWME 210 3994
HLA-DRB1*04:04 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 326 6010
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 87 1598
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 111 2036
HLA-DRB1*04:04 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 323 5909
HLA-DRB1*04:04 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 332 6030
HLA-DRB1*15:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 68 1231
HLA-DRB1*15:01 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 68 1225
HLA-DRB1*15:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 71 1275
HLA-DRB1*15:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 67 1203
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 334 5931
HLA-DRB1*04:04 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 342 6048
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 109 1919
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 381 6614
HLA-DRB1*15:01 LGVYYHKNNKSWMESEFRV LGVYHKNNKSWMESEFRV 320 5528
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 101 1742
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 91 1564
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 218 3729
HLA-DRB1*15:01 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 77 1302
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 343 5663
HLA-DPA1*01:03/DPB1*04:01 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 364 6000
HLA-DRB1*15:01 FLGVYYHKNNKSWMESEFRV FLGVYHKNNKSWMESEFRV 92 1500
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 432 6949
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 489 7849
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 489 7849
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 111 1771
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 337 5358
HLA-DRB1*04:04 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 377 5993
HLA-DRB1*04:04 FLGVYYHKNNKSWMESEFR FLGVYHKNNKSWMESEFR 396 6252
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 99 1542
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 373 5783
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 290 4479
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 290 4479
HLA-DPA1*01:03/DPB1*02:01 QFCNDPFLGVYYHKNNKSW QFCNDPFLGVYHKNNKSW 79 1213
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 179 2743
HLA-DPA1*01:03/DPB1*02:01 DPFLGVYYHKNNKSWMES DPFLGVYHKNNKSWMES 274 4171
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 132 2003
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 361 5457
HLA-DRB1*15:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFLGVYHKNNKSWM 79 1194
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKS FCNDPFLGVYHKNNKS 85 1283
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 430 6391
HLA-DRB1*04:02 FLGVYYHKNNKSWMESEFRV FLGVYHKNNKSWMESEFRV 248 3662
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 314 4603
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 314 4603
HLA-DRB1*04:02 FLGVYYHKNNKSWMESEFR FLGVYHKNNKSWMESEFR 388 5618
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 98 1407
HLA-DRB1*04:02 QFCNDPFLGVYYHKNNKSWM QFCNDPFLGVYHKNNKSWM 229 3281
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 466 6676
HLA-DRB1*04:02 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 222 3140
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 73 1029
HLA-DRB1*04:02 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 210 2939
HLA-DRB1*15:03 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 328 4566
HLA-DRB1*04:02 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 206 2862
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 445 6179
HLA-DRB1*15:03 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 316 4385
HLA-DRB1*04:02 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 215 2979
HLA-DRB1*04:02 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 207 2865
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 252 3475
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 134 1846
HLA-DRB1*15:03 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 318 4338
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 275 3751
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 279 3801
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 392 5333
HLA-DPA1*01:03/DPB1*04:01 DPFLGVYYHKNNKSWM DPFLGVYHKNNKSWM 409 5559
HLA-DRB1*15:03 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 311 4198
HLA-DRB1*04:02 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 358 4825
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNK FCNDPFLGVYHKNNK 80 1076
HLA-DRB1*15:03 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 344 4619
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 223 2975
HLA-DPA1*04:01/DPB1*02:01 DPFLGVYYHKNNKSWM DPFLGVYHKNNKSWM 112 1494
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 106 1411
HLA-DRB1*15:01 FQFCNDPFLGVYYHKNNKSW FQFCNDPFLGVYHKNNKSW 123 1619
HLA-DRB1*04:02 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 354 4551
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 277 3558
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 293 3752
HLA-DRB1*15:01 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 81 1030
HLA-DRB1*04:02 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 338 4275
HLA-DRB1*15:03 FLGVYYHKNNKSWMESEFR FLGVYHKNNKSWMESEFR 380 4806
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 326 4117
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 237 2963
HLA-DRB1*15:01 FLGVYYHKNNKSWMESE FLGVYHKNNKSWMESE 92 1150
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 315 3919
HLA-DPA1*03:01/DPB1*02:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 140 1740
HLA-DRB1*15:01 LGVYYHKNNKSWMESEFRVY LGVYHKNNKSWMESEFRVY 177 2196
HLA-DRB1*04:02 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 335 4136
HLA-DRB1*04:02 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 348 4248
HLA-DRB1*15:01 LGVYYHKNNKSWMESEF LGVYHKNNKSWMESEF 199 2428
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 168 2049
HLA-DRB1*15:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 81 984
HLA-DPA1*03:01/DPB1*04:02 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 346 4158
HLA-DPA1*03:01/DPB1*105:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 346 4158
HLA-DRB1*04:02 FQFCNDPFLGVYYHKNNKSW FQFCNDPFLGVYHKNNKSW 371 4458
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 360 4324
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWME PFLGVYHKNNKSWME 150 1788
HLA-DRB1*15:01 PFLGVYYHKNNKSWMES PFLGVYHKNNKSWMES 83 984
HLA-DPA1*04:01/DPB1*02:01 PFLGVYYHKNNKSWMES PFLGVYHKNNKSWMES 186 2203
HLA-DPA1*04:01/DPB1*04:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 307 3620
HLA-DPA1*02:02/DPB1*01:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 335 3905
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 355 4122
HLA-DRB1*15:03 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 170 1967
HLA-DRB1*15:03 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 170 1962
HLA-DRB1*04:04 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 240 2756
HLA-DRB1*15:03 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 179 2052
HLA-DRB1*15:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFLGVYHKNNKS 476 5429
HLA-DRB1*15:03 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 173 1972
HLA-DRB1*15:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 135 1516
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 436 4893
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 436 4893
HLA-DRB1*04:04 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 239 2682
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 143 1598
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 71 793
HLA-DRB1*04:04 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 248 2767
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 291 3235
HLA-DPA1*01:03/DPB1*02:01 QFCNDPFLGVYYHKNNKSWM QFCNDPFLGVYHKNNKSWM 55 610
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 206 2270
HLA-DPA1*01:03/DPB1*04:01 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 220 2423
HLA-DRB1*15:02 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 479 5274
HLA-DPA1*03:01/DPB1*02:01 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 133 1455
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 152 1662
HLA-DRB1*04:04 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 248 2708
HLA-DRB1*15:02 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 471 5137
HLA-DRB1*15:03 QFCNDPFLGVYYHKNNKSW QFCNDPFLGVYHKNNKSW 480 5228
HLA-DRB1*04:02 LGVYYHKNNKSWMESEFRVY LGVYHKNNKSWMESEFRVY 485 5263
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 441 4773
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 441 4773
HLA-DRB1*15:02 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 490 5282
HLA-DPA1*02:01/DPB1*01:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 372 3967
HLA-DPA1*02:01/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 495 5223
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 300 3136
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 481 4974
HLA-DRB1*04:04 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 266 2743
HLA-DRB1*15:03 QFCNDPFLGVYYHKNNKSWM QFCNDPFLGVYHKNNKSWM 183 1887
HLA-DPA1*03:01/DPB1*04:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 316 3244
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMES PFLGVYHKNNKSWMES 169 1734
HLA-DRB1*04:04 FLGVYYHKNNKSWMESE FLGVYHKNNKSWMESE 260 2667
HLA-DRB1*15:03 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 188 1924
HLA-DPA1*01:03/DPB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 460 4684
HLA-DPA1*04:01/DPB1*04:01 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 270 2740
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 461 4675
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 461 4675
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 380 3839
HLA-DPA1*04:01/DPB1*04:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 319 3218
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 325 3259
HLA-DPA1*02:02/DPB1*01:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 224 2227
HLA-DPA1*03:01/DPB1*02:01 DPFLGVYYHKNNKSWM DPFLGVYHKNNKSWM 133 1318
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWME PFLGVYHKNNKSWME 150 1486
HLA-DRB1*15:03 FLGVYYHKNNKSWMESEFRV FLGVYHKNNKSWMESEFRV 208 2059
HLA-DRB1*04:04 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 235 2319
HLA-DPA1*02:01/DPB1*01:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 392 3845
HLA-DRB1*04:04 PFLGVYYHKNNKSWMES PFLGVYHKNNKSWMES 235 2301
HLA-DPA1*01:03/DPB1*01:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 487 4751
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 313 3049
HLA-DPA1*04:01/DPB1*02:01 CNDPFLGVYYHKNNKSWM CNDPFLGVYHKNNKSWM 200 1946
HLA-DRB1*15:02 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 491 4771
HLA-DRB1*04:04 FLGVYYHKNNKSWMESEFRV FLGVYHKNNKSWMESEFRV 308 2979
HLA-DRB1*04:04 QFCNDPFLGVYYHKNNKSWM QFCNDPFLGVYHKNNKSWM 295 2845
HLA-DRB1*04:04 NDPFLGVYYHKNNKSWM NDPFLGVYHKNNKSWM 248 2377
HLA-DPA1*03:01/DPB1*02:01 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 141 1349
HLA-DPA1*04:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSW QFCNDPFLGVYHKNNKSW 85 812
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 336 3199
HLA-DRB1*04:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 482 4576
HLA-DRB1*04:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 482 4550
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 442 4167
HLA-DPA1*03:01/DPB1*04:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 258 2430
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWME DPFLGVYHKNNKSWME 377 3541
HLA-DRB1*15:02 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 261 2445
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 253 2358
HLA-DPA1*01:03/DPB1*02:01 PFLGVYYHKNNKSWMESE PFLGVYHKNNKSWMESE 451 4203
HLA-DPA1*03:01/DPB1*04:02 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 461 4296
HLA-DPA1*03:01/DPB1*105:01 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 461 4296
HLA-DPA1*04:01/DPB1*02:01 FCNDPFLGVYYHKNNKS FCNDPFLGVYHKNNKS 93 866
HLA-DRB1*04:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 469 4364
HLA-DPA1*02:02/DPB1*01:01 CNDPFLGVYYHKNNKS CNDPFLGVYHKNNKS 260 2419
HLA-DPA1*04:01/DPB1*02:01 NDPFLGVYYHKNNKSWME NDPFLGVYHKNNKSWME 217 2011
HLA-DRB1*15:02 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 255 2362
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 411 3785
HLA-DPA1*04:01/DPB1*04:02 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 451 4145
HLA-DPA1*04:01/DPB1*105:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 451 4145
HLA-DRB1*01:01 DPFLGVYYHKNNKSWMESE DPFLGVYHKNNKSWMESE 402 3692
HLA-DRB1*15:01 GVYYHKNNKSWMESEFR GVYHKNNKSWMESEFR 491 4459
HLA-DRB1*15:02 DPFLGVYYHKNNKSWMESEF DPFLGVYHKNNKSWMESEF 268 2409
HLA-DPA1*02:01/DPB1*01:01 DPFLGVYYHKNNKSWM DPFLGVYHKNNKSWM 421 3778
HLA-DPA1*03:01/DPB1*04:01 NDPFLGVYYHKNNKSW NDPFLGVYHKNNKSW 326 2917
HLA-DRB1*01:01 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 405 3615
HLA-DRB1*15:02 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 252 2241
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMESEF PFLGVYHKNNKSWMESEF 496 4409
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 356 3143
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSWMES CNDPFLGVYHKNNKSWMES 332 2910
HLA-DRB1*15:01 EFQFCNDPFLGVYYHKNNKS EFQFCNDPFLGVYHKNNKS 244 2135
HLA-DRB1*01:01 NDPFLGVYYHKNNKSWMES NDPFLGVYHKNNKSWMES 397 3464
HLA-DPA1*01:03/DPB1*02:01 FQFCNDPFLGVYYHKNNKS FQFCNDPFLGVYHKNNKS 66 574
HLA-DRB1*01:01 CNDPFLGVYYHKNNKSWME CNDPFLGVYHKNNKSWME 419 3631
HLA-DRB1*04:04 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 401 3474
HLA-DRB1*15:02 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 279 2405
HLA-DPA1*03:01/DPB1*04:01 PFLGVYYHKNNKSWMES PFLGVYHKNNKSWMES 424 3653
HLA-DPA1*04:01/DPB1*04:02 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 484 4158
HLA-DPA1*04:01/DPB1*105:01 NDPFLGVYYHKNNKSWMESE NDPFLGVYHKNNKSWMESE 484 4158
HLA-DPA1*03:01/DPB1*02:01 QFCNDPFLGVYYHKNNKSW QFCNDPFLGVYHKNNKSW 76 645
HLA-DPA1*04:01/DPB1*04:01 DPFLGVYYHKNNKSWM DPFLGVYHKNNKSWM 339 2871
HLA-DPA1*03:01/DPB1*04:02 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 372 3144
HLA-DPA1*03:01/DPB1*105:01 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYHKNNKSWM 372 3144
HLA-DPA1*02:02/DPB1*02:01 CNDPFLGVYYHKNNKSW CNDPFLGVYHKNNKSW 418 3520
HLA-DPA1*01:03/DPB1*02:01 FCNDPFLGVYYHKNNKSW FCNDPFLGVYHKNNKSW 160 1341
HLA-DPA1*02:01/DPB1*01:01 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYHKNNKSWME 268 2238
HLA-DPA1*03:01/DPB1*04:02 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 492 4071
HLA-DPA1*03:01/DPB1*105:01 PFLGVYYHKNNKSWMESEFR PFLGVYHKNNKSWMESEFR 492 4071
HLA-DRB1*01:01 FLGVYYHKNNKSWMESEFR FLGVYHKNNKSWMESEFR 447