Summary

This strain contains 11 protein-level mutations:

  • 4 mutations in Spike protein: S13I, W152C, L452R, D614G
  • 1 mutation in N protein: T205I
  • 2 mutations in NS3 protein: Q57H, A99V
  • 1 mutation in NS9c protein: L52F
  • 1 mutation in NSP2 protein: T85I
  • 1 mutation in NSP12 protein: P323L
  • 1 mutation in NSP13 protein: D260Y

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

S13I

Reference  MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYY
           |||||||||||| |||||||||||||||||||||||||
Mutated    MFVFLVLLPLVSIQCVNLTTRTQLPPAYTNSFTRGVYY

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*07:01 FLVLLPLVSSQCVNL FLVLLPLVSIQCVNL 254 894
HLA-DRB1*01:02 FLVLLPLVSSQCVNL FLVLLPLVSIQCVNL 74 251
HLA-DRB1*07:01 LVLLPLVSSQCVNLT LVLLPLVSIQCVNLT 246 800
HLA-DRB1*04:04 FLVLLPLVSSQCVNL FLVLLPLVSIQCVNL 113 358
HLA-DRB1*01:01 FLVLLPLVSSQCVNL FLVLLPLVSIQCVNL 29 91
HLA-DRB1*11:02 PLVSSQCVNLTTRTQ PLVSIQCVNLTTRTQ 718 229
HLA-DRB1*13:01 PLVSSQCVNLTTRTQ PLVSIQCVNLTTRTQ 718 229
HLA-DRB1*10:01 FLVLLPLVSSQCVNL FLVLLPLVSIQCVNL 54 165
HLA-DRB1*07:01 VLLPLVSSQCVNLTT VLLPLVSIQCVNLTT 271 820
HLA-DRB1*01:01 FLVLLPLVSSQCVNLT FLVLLPLVSIQCVNLT 100 301
HLA-DRB1*04:04 VFLVLLPLVSSQCVNL VFLVLLPLVSIQCVNL 276 815
HLA-DRB1*04:04 FVFLVLLPLVSSQCVNL FVFLVLLPLVSIQCVNL 208 614
HLA-DRB1*04:04 FVFLVLLPLVSSQCV FVFLVLLPLVSIQCV 133 384
HLA-DRB1*07:01 LLPLVSSQCVNLTTR LLPLVSIQCVNLTTR 240 691
HLA-DRB1*01:01 VFLVLLPLVSSQCVNL VFLVLLPLVSIQCVNL 93 261
HLA-DRB1*04:04 VFLVLLPLVSSQCVN VFLVLLPLVSIQCVN 105 284
HLA-DRB1*07:01 LVLLPLVSSQCVNLTTR LVLLPLVSIQCVNLTTR 456 1217
HLA-DRB1*01:02 VFLVLLPLVSSQCVN VFLVLLPLVSIQCVN 72 191
HLA-DRB1*01:02 VFLVLLPLVSSQCVNL VFLVLLPLVSIQCVNL 253 669
HLA-DRB1*04:04 MFVFLVLLPLVSSQC MFVFLVLLPLVSIQC 201 509
HLA-DRB1*01:02 FLVLLPLVSSQCVNLT FLVLLPLVSIQCVNLT 266 673
HLA-DRB1*01:01 VFLVLLPLVSSQCVN VFLVLLPLVSIQCVN 27 68
HLA-DRB1*04:01 VFLVLLPLVSSQCVN VFLVLLPLVSIQCVN 463 1166
HLA-DRB1*04:04 VFLVLLPLVSSQCVNLT VFLVLLPLVSIQCVNLT 212 514
HLA-DRB1*01:02 LVLLPLVSSQCVNLT LVLLPLVSIQCVNLT 99 239
HLA-DRB1*01:01 LVLLPLVSSQCVNLT LVLLPLVSIQCVNLT 38 91
HLA-DRB1*10:01 FLVLLPLVSSQCVNLT FLVLLPLVSIQCVNLT 132 316
HLA-DRB1*04:04 MFVFLVLLPLVSSQCV MFVFLVLLPLVSIQCV 363 865
HLA-DRB1*10:01 VFLVLLPLVSSQCVNL VFLVLLPLVSIQCVNL 98 233
HLA-DRB1*04:04 MFVFLVLLPLVSSQCVN MFVFLVLLPLVSIQCVN 222 525
HLA-DRB1*01:02 FVFLVLLPLVSSQCVNL FVFLVLLPLVSIQCVNL 211 496
HLA-DRB1*04:04 FVFLVLLPLVSSQCVN FVFLVLLPLVSIQCVN 280 658
HLA-DRB1*15:01 LPLVSSQCVNLTTRT LPLVSIQCVNLTTRT 1061 452
HLA-DRB1*11:02 LPLVSSQCVNLTTRT LPLVSIQCVNLTTRT 515 221
HLA-DRB1*13:01 LPLVSSQCVNLTTRT LPLVSIQCVNLTTRT 515 221
HLA-DRB1*01:01 VFLVLLPLVSSQCVNLT VFLVLLPLVSIQCVNLT 81 188
HLA-DRB1*11:04 MFVFLVLLPLVSSQC MFVFLVLLPLVSIQC 485 1125
HLA-DRB1*01:01 FVFLVLLPLVSSQCVNL FVFLVLLPLVSIQCVNL 76 176
HLA-DRB1*10:01 VFLVLLPLVSSQCVN VFLVLLPLVSIQCVN 43 98
HLA-DRB1*01:02 FVFLVLLPLVSSQCV FVFLVLLPLVSIQCV 100 227
HLA-DRB1*11:04 FVFLVLLPLVSSQCV FVFLVLLPLVSIQCV 473 1073
HLA-DRB1*04:04 MFVFLVLLPLVSSQCVNLT MFVFLVLLPLVSIQCVNLT 443 1003
HLA-DRB1*01:02 VFLVLLPLVSSQCVNLT VFLVLLPLVSIQCVNLT 225 507
HLA-DRB1*07:01 VFLVLLPLVSSQCVN VFLVLLPLVSIQCVN 500 1125
HLA-DRB1*11:04 VFLVLLPLVSSQCVN VFLVLLPLVSIQCVN 425 948
HLA-DRB1*01:01 FLVLLPLVSSQCVNLTT FLVLLPLVSIQCVNLTT 90 199
HLA-DRB1*01:01 FVFLVLLPLVSSQCV FVFLVLLPLVSIQCV 39 86
HLA-DRB1*10:01 VFLVLLPLVSSQCVNLT VFLVLLPLVSIQCVNLT 84 184
HLA-DRB1*01:01 MFVFLVLLPLVSSQCVNLT MFVFLVLLPLVSIQCVNLT 188 411
HLA-DRB1*01:02 FLVLLPLVSSQCVNLTT FLVLLPLVSIQCVNLTT 242 519
HLA-DRB1*10:01 FLVLLPLVSSQCVNLTT FLVLLPLVSIQCVNLTT 103 220
HLA-DRB1*04:04 PLVSSQCVNLTTRTQL PLVSIQCVNLTTRTQL 853 402
HLA-DRB1*01:01 FVFLVLLPLVSSQCVNLTT FVFLVLLPLVSIQCVNLTT 201 425
HLA-DRB1*01:01 FVFLVLLPLVSSQCVN FVFLVLLPLVSIQCVN 95 200
HLA-DRB1*16:01 FLVLLPLVSSQCVNL FLVLLPLVSIQCVNL 419 875
HLA-DRB1*10:01 FVFLVLLPLVSSQCVNL FVFLVLLPLVSIQCVNL 68 142
HLA-DRB1*04:04 FLVLLPLVSSQCVNLT FLVLLPLVSIQCVNLT 293 611
HLA-DRB1*11:02 PLVSSQCVNLTTRTQLP PLVSIQCVNLTTRTQLP 877 421
HLA-DRB1*13:01 PLVSSQCVNLTTRTQLP PLVSIQCVNLTTRTQLP 877 421
HLA-DRB1*10:01 LVLLPLVSSQCVNLT LVLLPLVSIQCVNLT 77 160
HLA-DRB1*07:01 LPLVSSQCVNLTTRT LPLVSIQCVNLTTRT 364 754
HLA-DRB1*11:02 LVSSQCVNLTTRTQLPP LVSIQCVNLTTRTQLPP 992 482
HLA-DRB1*13:01 LVSSQCVNLTTRTQLPP LVSIQCVNLTTRTQLPP 992 482
HLA-DRB1*01:02 MFVFLVLLPLVSSQCVNLTT MFVFLVLLPLVSIQCVNLTT 424 867
HLA-DRB1*01:02 FVFLVLLPLVSSQCVN FVFLVLLPLVSIQCVN 263 537
HLA-DRB1*15:01 FLVLLPLVSSQCVNL FLVLLPLVSIQCVNL 244 494
HLA-DRB1*10:01 FVFLVLLPLVSSQCV FVFLVLLPLVSIQCV 45 91
HLA-DRB1*10:01 FVFLVLLPLVSSQCVNLTT FVFLVLLPLVSIQCVNLTT 153 306

W152C

Reference  VIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLM
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    VIKVCEFQFCNDPFLGVYYHKNNKSCMESEFRVYSSANNCTFEYVSQPFLM

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*01:03/DPB1*04:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 219 1104
HLA-DPA1*01:03/DPB1*04:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 302 1512
HLA-DPA1*01:03/DPB1*04:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 330 1643
HLA-DPA1*01:03/DPB1*04:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 221 1092
HLA-DPA1*01:03/DPB1*04:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 310 1528
HLA-DPA1*01:03/DPB1*04:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 257 1266
HLA-DPA1*01:03/DPB1*04:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 284 1383
HLA-DPA1*01:03/DPB1*04:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 319 1545
HLA-DPA1*01:03/DPB1*04:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 395 1909
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 166 793
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 210 1000
HLA-DPA1*01:03/DPB1*04:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 337 1599
HLA-DPA1*01:03/DPB1*02:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 202 956
HLA-DPA1*01:03/DPB1*02:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 206 972
HLA-DPA1*01:03/DPB1*04:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 455 2120
HLA-DPA1*01:03/DPB1*02:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 261 1209
HLA-DPA1*01:03/DPB1*04:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 288 1333
HLA-DPA1*01:03/DPB1*04:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 459 2122
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVYS YYHKNNKSCMESEFRVYS 408 1879
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYSSA HKNNKSCMESEFRVYSSA 321 1470
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVYSS YHKNNKSCMESEFRVYSS 372 1703
HLA-DPA1*01:03/DPB1*02:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 152 691
HLA-DPA1*01:03/DPB1*04:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 363 1649
HLA-DPA1*01:03/DPB1*02:01 HKNNKSWMESEFRVYSSA HKNNKSCMESEFRVYSSA 375 1698
HLA-DPA1*01:03/DPB1*02:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 167 756
HLA-DPA1*01:03/DPB1*04:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 300 1358
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYSSA HKNNKSCMESEFRVYSSA 212 959
HLA-DPA1*01:03/DPB1*02:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 238 1074
HLA-DPA1*01:03/DPB1*02:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 311 1402
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYSSAN KNNKSCMESEFRVYSSAN 219 987
HLA-DPA1*01:03/DPB1*02:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 154 694
HLA-DPA1*01:03/DPB1*02:01 KNNKSWMESEFRVYSSAN KNNKSCMESEFRVYSSAN 383 1724
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 158 709
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYSSAN KNNKSCMESEFRVYSSAN 343 1535
HLA-DPA1*01:03/DPB1*02:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 194 868
HLA-DPA1*01:03/DPB1*04:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 409 1822
HLA-DPA1*01:03/DPB1*04:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 254 1130
HLA-DPA1*04:01/DPB1*04:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 183 813
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVYSS YHKNNKSCMESEFRVYSS 262 1162
HLA-DPA1*03:01/DPB1*04:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 207 917
HLA-DPA1*01:03/DPB1*04:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 243 1074
HLA-DPA1*01:03/DPB1*04:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 331 1462
HLA-DPA1*01:03/DPB1*02:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 209 923
HLA-DPA1*01:03/DPB1*04:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 323 1418
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 185 812
HLA-DPA1*01:03/DPB1*02:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 209 914
HLA-DPA1*01:03/DPB1*02:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 200 874
HLA-DPA1*01:03/DPB1*02:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 184 803
HLA-DPA1*04:01/DPB1*04:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 212 925
HLA-DPA1*01:03/DPB1*02:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 205 893
HLA-DPA1*01:03/DPB1*02:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 234 1016
HLA-DPA1*01:03/DPB1*02:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 137 593
HLA-DPA1*01:03/DPB1*02:01 YHKNNKSWMESEFRVYSS YHKNNKSCMESEFRVYSS 485 2092
HLA-DPA1*01:03/DPB1*02:01 NNKSWMESEFRVYSSANN NNKSCMESEFRVYSSANN 387 1661
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVYS YYHKNNKSCMESEFRVYS 304 1304
HLA-DPA1*03:01/DPB1*04:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 164 699
HLA-DPA1*03:01/DPB1*04:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 275 1172
HLA-DPA1*04:01/DPB1*02:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 142 605
HLA-DPA1*04:01/DPB1*04:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 199 845
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 144 611
HLA-DPA1*01:03/DPB1*02:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 164 695
HLA-DPA1*01:03/DPB1*02:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 257 1086
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 272 1147
HLA-DPA1*01:03/DPB1*02:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 213 897
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 157 661
HLA-DPA1*04:01/DPB1*04:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 246 1035
HLA-DPA1*03:01/DPB1*04:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 160 672
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 200 840
HLA-DPA1*01:03/DPB1*04:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 219 914
HLA-DPA1*03:01/DPB1*04:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 208 866
HLA-DPA1*04:01/DPB1*02:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 174 722
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 166 688
HLA-DPA1*01:03/DPB1*04:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 489 2020
HLA-DPA1*04:01/DPB1*04:01 HKNNKSWMESEFRVYSSA HKNNKSCMESEFRVYSSA 400 1651
HLA-DPA1*01:03/DPB1*04:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 213 878
HLA-DPA1*04:01/DPB1*02:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 155 638
HLA-DPA1*01:03/DPB1*04:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 327 1342
HLA-DPA1*01:03/DPB1*02:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 182 746
HLA-DPA1*04:01/DPB1*04:01 KNNKSWMESEFRVYSSAN KNNKSCMESEFRVYSSAN 411 1674
HLA-DPA1*01:03/DPB1*02:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 304 1238
HLA-DPA1*01:03/DPB1*02:01 NKSWMESEFRVYSSANNC NKSCMESEFRVYSSANNC 411 1673
HLA-DPA1*03:01/DPB1*04:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 145 589
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 187 759
HLA-DPA1*01:03/DPB1*02:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 164 664
HLA-DPA1*03:01/DPB1*04:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 122 493
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 133 536
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 118 475
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 187 752
HLA-DPA1*04:01/DPB1*04:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 208 835
HLA-DPA1*01:03/DPB1*04:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 258 1034
HLA-DPA1*01:03/DPB1*02:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 217 868
HLA-DPA1*04:01/DPB1*04:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 221 883
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 138 551
HLA-DPA1*01:03/DPB1*04:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 226 902
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 152 606
HLA-DPA1*01:03/DPB1*02:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 370 1471
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 110 437
HLA-DPA1*04:01/DPB1*02:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 211 838
HLA-DPA1*01:03/DPB1*04:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 347 1373
HLA-DPA1*03:01/DPB1*04:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 126 498
HLA-DPA1*01:03/DPB1*02:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 470 1851
HLA-DPA1*04:01/DPB1*04:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 221 869
HLA-DPA1*01:03/DPB1*02:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 145 569
HLA-DPA1*04:01/DPB1*04:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 249 977
HLA-DPA1*04:01/DPB1*04:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 225 880
HLA-DPA1*03:01/DPB1*02:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 99 387
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 114 445
HLA-DPA1*03:01/DPB1*02:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 107 417
HLA-DPA1*03:01/DPB1*02:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 160 621
HLA-DPA1*04:01/DPB1*02:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 173 671
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 153 593
HLA-DPA1*04:01/DPB1*02:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 208 805
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSSANN NNKSCMESEFRVYSSANN 332 1283
HLA-DPA1*04:01/DPB1*02:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 166 640
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 164 632
HLA-DPA1*03:01/DPB1*02:01 NNKSWMESEFRVYSSANN NNKSCMESEFRVYSSANN 208 800
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 180 690
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 181 692
HLA-DPA1*04:01/DPB1*04:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 276 1051
HLA-DPA1*03:01/DPB1*04:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 169 643
HLA-DPA1*01:03/DPB1*02:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 261 993
HLA-DPA1*04:01/DPB1*04:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 170 645
HLA-DPA1*03:01/DPB1*02:01 VYYHKNNKSWMESEFRVY VYYHKNNKSCMESEFRVY 433 1642
HLA-DPA1*01:03/DPB1*02:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 226 856
HLA-DPA1*01:03/DPB1*02:01 NKSWMESEFRVYSSANNCT NKSCMESEFRVYSSANNCT 232 874
HLA-DPA1*04:01/DPB1*04:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 288 1083
HLA-DPA1*04:01/DPB1*02:01 HKNNKSWMESEFRVYSSA HKNNKSCMESEFRVYSSA 327 1229
HLA-DPA1*04:01/DPB1*04:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 341 1279
HLA-DPA1*01:03/DPB1*04:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 245 917
HLA-DPA1*01:03/DPB1*02:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 333 1244
HLA-DPA1*03:01/DPB1*04:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 145 541
HLA-DPA1*04:01/DPB1*04:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 174 648
HLA-DPA1*04:01/DPB1*02:01 KNNKSWMESEFRVYSSAN KNNKSCMESEFRVYSSAN 331 1227
HLA-DPA1*01:03/DPB1*02:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 149 552
HLA-DPA1*04:01/DPB1*02:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 251 927
HLA-DPA1*01:03/DPB1*04:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 361 1331
HLA-DPA1*03:01/DPB1*04:01 NKSWMESEFRVYSSANNC NKSCMESEFRVYSSANNC 344 1263
HLA-DPA1*04:01/DPB1*04:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 191 700
HLA-DPA1*03:01/DPB1*04:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 171 624
HLA-DPA1*04:01/DPB1*02:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 190 692
HLA-DPA1*04:01/DPB1*04:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 208 757
HLA-DPA1*01:03/DPB1*04:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 351 1276
HLA-DPA1*04:01/DPB1*02:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 188 683
HLA-DPA1*01:03/DPB1*04:01 NKSWMESEFRVYSSANNCT NKSCMESEFRVYSSANNCT 390 1414
HLA-DPA1*01:03/DPB1*02:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 476 1724
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 162 586
HLA-DPA1*01:03/DPB1*02:01 KSWMESEFRVYSSANNC KSCMESEFRVYSSANNC 260 940
HLA-DPA1*03:01/DPB1*02:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 115 415
HLA-DPA1*04:01/DPB1*04:01 NNKSWMESEFRVYSSANN NNKSCMESEFRVYSSANN 386 1386
HLA-DPA1*03:01/DPB1*02:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 102 366
HLA-DPA1*04:01/DPB1*04:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 173 619
HLA-DPA1*04:01/DPB1*02:01 YHKNNKSWMESEFRVYSS YHKNNKSCMESEFRVYSS 418 1493
HLA-DPA1*03:01/DPB1*02:01 NKSWMESEFRVYSSANNC NKSCMESEFRVYSSANNC 214 759
HLA-DPA1*04:01/DPB1*04:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 215 758
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 162 571
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 144 507
HLA-DPA1*04:01/DPB1*02:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 241 842
HLA-DPA1*04:01/DPB1*04:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 247 862
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 83 289
HLA-DPA1*04:01/DPB1*04:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 408 1419
HLA-DPA1*03:01/DPB1*02:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 122 423
HLA-DPA1*04:01/DPB1*04:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 324 1119
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 115 395
HLA-DPA1*04:01/DPB1*02:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 166 570
HLA-DPA1*04:01/DPB1*04:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 208 712
HLA-DPA1*04:01/DPB1*04:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 284 971
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 105 358
HLA-DPA1*04:01/DPB1*02:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 173 589
HLA-DPA1*03:01/DPB1*02:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 84 285
HLA-DPA1*03:01/DPB1*02:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 226 763
HLA-DPA1*03:01/DPB1*02:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 236 796
HLA-DPA1*04:01/DPB1*02:01 NNKSWMESEFRVYSSANN NNKSCMESEFRVYSSANN 313 1055
HLA-DPA1*04:01/DPB1*02:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 318 1071
HLA-DPA1*01:03/DPB1*02:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 155 522
HLA-DPA1*04:01/DPB1*04:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 212 712
HLA-DPA1*04:01/DPB1*04:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 221 741
HLA-DPA1*03:01/DPB1*04:01 KSWMESEFRVYSSANNCT KSCMESEFRVYSSANNCT 404 1352
HLA-DPA1*03:01/DPB1*02:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 98 327
HLA-DPA1*03:01/DPB1*04:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 120 400
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 167 556
HLA-DPA1*04:01/DPB1*02:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 290 964
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 140 463
HLA-DPA1*03:01/DPB1*04:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 186 614
HLA-DPA1*03:01/DPB1*02:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 147 483
HLA-DPA1*04:01/DPB1*02:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 146 479
HLA-DPA1*04:01/DPB1*04:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 216 704
HLA-DPA1*04:01/DPB1*02:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 178 580
HLA-DPA1*03:01/DPB1*02:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 86 280
HLA-DPA1*04:01/DPB1*02:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 176 569
HLA-DPA1*04:01/DPB1*02:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 147 475
HLA-DPA1*04:01/DPB1*04:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 232 746
HLA-DPA1*04:01/DPB1*04:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 150 481
HLA-DPA1*03:01/DPB1*02:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 102 327
HLA-DPA1*03:01/DPB1*04:01 NKSWMESEFRVYSSANNCT NKSCMESEFRVYSSANNCT 184 588
HLA-DPA1*04:01/DPB1*02:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 180 574
HLA-DPA1*03:01/DPB1*04:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 121 385
HLA-DPA1*01:03/DPB1*04:01 KSWMESEFRVYSSANNC KSCMESEFRVYSSANNC 435 1383
HLA-DPA1*04:01/DPB1*04:01 NKSWMESEFRVYSSANNC NKSCMESEFRVYSSANNC 413 1311
HLA-DPA1*04:01/DPB1*02:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 209 663
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 107 339
HLA-DPA1*03:01/DPB1*02:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 116 365
HLA-DPA1*03:01/DPB1*04:01 KSWMESEFRVYSSANNC KSCMESEFRVYSSANNC 203 638
HLA-DPA1*04:01/DPB1*02:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 149 468
HLA-DPA1*03:01/DPB1*02:01 KSWMESEFRVYSSANNCT KSCMESEFRVYSSANNCT 254 797
HLA-DPA1*04:01/DPB1*04:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 348 1091
HLA-DPA1*04:01/DPB1*04:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 151 472
HLA-DPA1*04:01/DPB1*02:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 171 533
HLA-DPA1*01:03/DPB1*01:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 452 1398
HLA-DPA1*04:01/DPB1*02:01 NKSWMESEFRVYSSANNC NKSCMESEFRVYSSANNC 335 1032
HLA-DPA1*01:03/DPB1*01:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 490 1507
HLA-DPA1*01:03/DPB1*04:01 NKSWMESEFRVYSSANNCTF NKSCMESEFRVYSSANNCTF 262 805
HLA-DPA1*01:03/DPB1*01:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 412 1263
HLA-DPA1*04:01/DPB1*04:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 459 1407
HLA-DPA1*03:01/DPB1*01:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 249 761
HLA-DPA1*03:01/DPB1*02:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 107 327
HLA-DPA1*04:01/DPB1*02:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 394 1203
HLA-DPA1*04:01/DPB1*02:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 130 395
HLA-DPA1*04:01/DPB1*04:01 NKSWMESEFRVYSSANNCT NKSCMESEFRVYSSANNCT 232 702
HLA-DPA1*03:01/DPB1*01:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 238 719
HLA-DRB1*13:02 VYYHKNNKSWMESEFR VYYHKNNKSCMESEFR 471 1422
HLA-DPA1*01:03/DPB1*01:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 437 1316
HLA-DPA1*01:03/DPB1*01:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 404 1201
HLA-DPA1*03:01/DPB1*01:01 YYHKNNKSWMESEFRVYS YYHKNNKSCMESEFRVYS 438 1298
HLA-DPA1*03:01/DPB1*01:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 275 814
HLA-DPA1*01:03/DPB1*04:01 KSWMESEFRVYSSANNCTF KSCMESEFRVYSSANNCTF 456 1346
HLA-DPA1*04:01/DPB1*02:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 161 474
HLA-DPA1*03:01/DPB1*04:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 131 385
HLA-DPA1*03:01/DPB1*04:01 SWMESEFRVYSSANN SCMESEFRVYSSANN 323 949
HLA-DPA1*02:01/DPB1*01:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 446 1310
HLA-DPA1*01:03/DPB1*02:01 SWMESEFRVYSSANN SCMESEFRVYSSANN 389 1140
HLA-DPA1*01:03/DPB1*02:01 NKSWMESEFRVYSSANNCTF NKSCMESEFRVYSSANNCTF 158 462
HLA-DPA1*04:01/DPB1*04:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 159 463
HLA-DPA1*03:01/DPB1*02:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 120 349
HLA-DQA1*01:02/DQB1*05:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 488 1415
HLA-DPA1*01:03/DPB1*01:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 368 1067
HLA-DPA1*04:01/DPB1*02:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 123 356
HLA-DPA1*04:01/DPB1*02:01 NKSWMESEFRVYSSANNCT NKSCMESEFRVYSSANNCT 178 515
HLA-DPA1*03:01/DPB1*02:01 NKSWMESEFRVYSSANNCT NKSCMESEFRVYSSANNCT 112 324
HLA-DPA1*03:01/DPB1*04:02 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 483 1396
HLA-DPA1*03:01/DPB1*105:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 483 1396
HLA-DPA1*01:03/DPB1*01:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 387 1117
HLA-DPA1*04:01/DPB1*02:01 KSWMESEFRVYSSANNC KSCMESEFRVYSSANNC 202 583
HLA-DPA1*01:03/DPB1*01:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 391 1127
HLA-DPA1*03:01/DPB1*01:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 210 605
HLA-DPA1*01:03/DPB1*01:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 333 958
HLA-DPA1*03:01/DPB1*01:01 YHKNNKSWMESEFRVYSS YHKNNKSCMESEFRVYSS 409 1176
HLA-DPA1*01:03/DPB1*01:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 355 1017
HLA-DPA1*01:03/DPB1*01:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 409 1169
HLA-DPA1*03:01/DPB1*01:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 187 533
HLA-DPA1*03:01/DPB1*01:01 HKNNKSWMESEFRVYSSA HKNNKSCMESEFRVYSSA 367 1043
HLA-DPA1*03:01/DPB1*02:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 75 213
HLA-DPA1*03:01/DPB1*01:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 206 585
HLA-DPA1*01:03/DPB1*01:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 373 1059
HLA-DRB1*13:02 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 396 1123
HLA-DPA1*01:03/DPB1*01:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 399 1131
HLA-DPA1*03:01/DPB1*02:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 72 204
HLA-DQA1*01:02/DQB1*05:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 462 1306
HLA-DPA1*01:03/DPB1*01:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 357 1009
HLA-DPA1*01:03/DPB1*01:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 394 1111
HLA-DPA1*02:01/DPB1*01:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 494 1392
HLA-DPA1*02:01/DPB1*01:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 403 1135
HLA-DPA1*01:03/DPB1*01:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 344 966
HLA-DPA1*03:01/DPB1*01:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 212 595
HLA-DPA1*04:01/DPB1*02:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 277 776
HLA-DPA1*04:01/DPB1*02:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 259 725
HLA-DPA1*04:01/DPB1*02:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 121 338
HLA-DPA1*01:03/DPB1*02:01 KSWMESEFRVYSSANNCTF KSCMESEFRVYSSANNCTF 275 768
HLA-DPA1*04:01/DPB1*02:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 419 1168
HLA-DPA1*01:03/DPB1*01:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 333 928
HLA-DPA1*04:01/DPB1*04:01 KSWMESEFRVYSSANNC KSCMESEFRVYSSANNC 260 720
HLA-DPA1*01:03/DPB1*01:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 348 963
HLA-DPA1*01:03/DPB1*01:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 357 987
HLA-DPA1*02:02/DPB1*04:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 484 1336
HLA-DPA1*02:01/DPB1*01:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 410 1131
HLA-DPA1*02:01/DPB1*01:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 410 1131
HLA-DPA1*02:02/DPB1*01:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 347 957
HLA-DPA1*03:01/DPB1*01:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 201 553
HLA-DPA1*03:01/DPB1*04:01 SWMESEFRVYSSANNC SCMESEFRVYSSANNC 333 916
HLA-DPA1*02:01/DPB1*01:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 409 1123
HLA-DPA1*01:03/DPB1*01:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 313 855
HLA-DPA1*02:02/DPB1*01:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 385 1051
HLA-DPA1*03:01/DPB1*01:01 KNNKSWMESEFRVYSSAN KNNKSCMESEFRVYSSAN 381 1039
HLA-DRB1*13:02 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 270 736
HLA-DPA1*03:01/DPB1*01:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 228 621
HLA-DPA1*03:01/DPB1*01:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 181 492
HLA-DRB1*13:02 GVYYHKNNKSWMESEF GVYYHKNNKSCMESEF 344 935
HLA-DPA1*01:03/DPB1*04:01 KSWMESEFRVYSSANNCTFE KSCMESEFRVYSSANNCTFE 339 921
HLA-DPA1*04:01/DPB1*01:01 YHKNNKSWMESEFRVY YHKNNKSCMESEFRVY 334 907
HLA-DPA1*03:01/DPB1*04:02 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 420 1137
HLA-DPA1*03:01/DPB1*105:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 420 1137
HLA-DPA1*01:03/DPB1*01:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 283 766
HLA-DPA1*03:01/DPB1*01:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 163 441
HLA-DPA1*02:02/DPB1*01:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 264 711
HLA-DPA1*03:01/DPB1*01:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 208 560
HLA-DPA1*03:01/DPB1*02:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 74 199
HLA-DRB1*13:02 VYYHKNNKSWMESEF VYYHKNNKSCMESEF 271 728
HLA-DPA1*02:01/DPB1*01:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 430 1154
HLA-DPA1*03:01/DPB1*01:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 208 558
HLA-DPA1*03:01/DPB1*01:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 295 791
HLA-DPA1*04:01/DPB1*01:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 322 863
HLA-DPA1*02:01/DPB1*01:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 366 978
HLA-DPA1*01:03/DPB1*01:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 368 982
HLA-DPA1*01:03/DPB1*01:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 391 1043
HLA-DPA1*02:01/DPB1*01:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 455 1212
HLA-DPA1*03:01/DPB1*01:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 147 391
HLA-DRB1*13:02 GVYYHKNNKSWMESEFR GVYYHKNNKSCMESEFR 458 1218
HLA-DPA1*01:03/DPB1*01:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 291 772
HLA-DPA1*02:01/DPB1*01:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 362 960
HLA-DPA1*04:01/DPB1*02:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 119 315
HLA-DPA1*03:01/DPB1*01:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 238 630
HLA-DPA1*03:01/DPB1*01:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 200 529
HLA-DPA1*02:01/DPB1*01:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 298 786
HLA-DPA1*03:01/DPB1*04:01 KSWMESEFRVYSSANNCTF KSCMESEFRVYSSANNCTF 203 534
HLA-DQA1*01:02/DQB1*05:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 387 1013
HLA-DPA1*03:01/DPB1*02:01 KSWMESEFRVYSSANNC KSCMESEFRVYSSANNC 135 353
HLA-DPA1*03:01/DPB1*01:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 220 575
HLA-DPA1*03:01/DPB1*04:02 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 340 887
HLA-DPA1*03:01/DPB1*105:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 340 887
HLA-DPA1*03:01/DPB1*01:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 239 623
HLA-DPA1*02:02/DPB1*01:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 280 729
HLA-DPA1*02:02/DPB1*04:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 401 1042
HLA-DPA1*01:03/DPB1*02:01 KSWMESEFRVYSSANNCTFE KSCMESEFRVYSSANNCTFE 201 522
HLA-DPA1*02:02/DPB1*01:01 KNNKSWMESEFRVYSSAN KNNKSCMESEFRVYSSAN 458 1188
HLA-DPA1*02:02/DPB1*04:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 482 1249
HLA-DPA1*02:01/DPB1*01:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 384 994
HLA-DPA1*02:01/DPB1*01:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 399 1032
HLA-DPA1*03:01/DPB1*01:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 219 565
HLA-DPA1*02:01/DPB1*01:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 389 1003
HLA-DPA1*02:01/DPB1*01:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 301 776
HLA-DPA1*02:02/DPB1*04:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 391 1008
HLA-DPA1*03:01/DPB1*04:02 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 337 867
HLA-DPA1*03:01/DPB1*105:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 337 867
HLA-DPA1*02:02/DPB1*01:01 HKNNKSWMESEFRVYSSA HKNNKSCMESEFRVYSSA 442 1135
HLA-DPA1*04:01/DPB1*01:01 KNNKSWMESEFRVYSSAN KNNKSCMESEFRVYSSAN 408 1046
HLA-DPA1*04:01/DPB1*01:01 HKNNKSWMESEFRVYSSA HKNNKSCMESEFRVYSSA 396 1015
HLA-DQA1*01:02/DQB1*05:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 232 594
HLA-DQA1*01:02/DQB1*05:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 392 1003
HLA-DPA1*04:01/DPB1*02:01 KSWMESEFRVYSSANNCT KSCMESEFRVYSSANNCT 402 1028
HLA-DPA1*02:02/DPB1*01:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 237 606
HLA-DPA1*03:01/DPB1*04:01 NKSWMESEFRVYSSANNCTF NKSCMESEFRVYSSANNCTF 135 345
HLA-DRB1*13:02 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 206 525
HLA-DPA1*02:02/DPB1*01:01 HKNNKSWMESEFRVY HKNNKSCMESEFRVY 319 812
HLA-DPA1*02:02/DPB1*02:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 405 1029
HLA-DPA1*04:01/DPB1*01:01 YYHKNNKSWMESEFRVY YYHKNNKSCMESEFRVY 357 906
HLA-DPA1*02:02/DPB1*01:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 222 563
HLA-DPA1*03:01/DPB1*01:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 150 379
HLA-DPA1*04:01/DPB1*01:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 261 659
HLA-DPA1*03:01/DPB1*04:02 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 491 1238
HLA-DPA1*03:01/DPB1*105:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 491 1238
HLA-DPA1*04:01/DPB1*04:01 NKSWMESEFRVYSSANNCTF NKSCMESEFRVYSSANNCTF 162 408
HLA-DPA1*03:01/DPB1*01:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 198 498
HLA-DPA1*02:02/DPB1*04:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 485 1218
HLA-DPA1*02:02/DPB1*04:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 453 1134
HLA-DPA1*04:01/DPB1*01:01 HKNNKSWMESEFRVYS HKNNKSCMESEFRVYS 261 653
HLA-DPA1*02:02/DPB1*02:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 429 1073
HLA-DPA1*03:01/DPB1*01:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 204 510
HLA-DPA1*02:02/DPB1*01:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 243 607
HLA-DPA1*02:01/DPB1*01:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 410 1024
HLA-DPA1*04:01/DPB1*01:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 255 634
HLA-DPA1*04:01/DPB1*01:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 216 536
HLA-DPA1*03:01/DPB1*01:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 217 537
HLA-DPA1*02:01/DPB1*01:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 357 883
HLA-DPA1*03:01/DPB1*01:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 203 502
HLA-DPA1*04:01/DPB1*01:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 231 570
HLA-DPA1*04:01/DPB1*01:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 233 574
HLA-DQA1*01:02/DQB1*05:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 223 549
HLA-DRB1*13:02 LGVYYHKNNKSWMESEF LGVYYHKNNKSCMESEF 342 841
HLA-DPA1*03:01/DPB1*02:01 SWMESEFRVYSSANN SCMESEFRVYSSANN 186 457
HLA-DRB1*13:02 LGVYYHKNNKSWMESEFRV LGVYYHKNNKSCMESEFRV 400 982
HLA-DPA1*02:02/DPB1*01:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 315 773
HLA-DPA1*04:01/DPB1*01:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 247 606
HLA-DQA1*01:02/DQB1*05:01 LGVYYHKNNKSWMESEFRV LGVYYHKNNKSCMESEFRV 439 1075
HLA-DPA1*04:01/DPB1*01:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 233 570
HLA-DPA1*02:02/DPB1*01:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 249 609
HLA-DPA1*04:01/DPB1*01:01 YHKNNKSWMESEFRVYSS YHKNNKSCMESEFRVYSS 441 1077
HLA-DPA1*02:02/DPB1*02:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 322 786
HLA-DPA1*04:01/DPB1*01:01 YHKNNKSWMESEFRVYS YHKNNKSCMESEFRVYS 284 690
HLA-DPA1*02:02/DPB1*02:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 324 786
HLA-DPA1*04:01/DPB1*04:02 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 486 1179
HLA-DPA1*04:01/DPB1*105:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 486 1179
HLA-DPA1*02:02/DPB1*01:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 445 1078
HLA-DPA1*02:02/DPB1*04:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 396 959
HLA-DPA1*03:01/DPB1*05:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 401 971
HLA-DQA1*01:03/DQB1*05:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 420 1014
HLA-DPA1*02:02/DPB1*02:01 NNKSWMESEFRVYSSA NNKSCMESEFRVYSSA 406 980
HLA-DPA1*02:02/DPB1*01:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 208 502
HLA-DPA1*02:02/DPB1*01:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 338 815
HLA-DPA1*02:02/DPB1*01:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 244 588
HLA-DPA1*03:01/DPB1*04:01 KSWMESEFRVYSSANNCTFE KSCMESEFRVYSSANNCTFE 161 387
HLA-DPA1*03:01/DPB1*04:01 SWMESEFRVYSSANNCT SCMESEFRVYSSANNCT 399 959
HLA-DPA1*02:02/DPB1*01:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 244 586
HLA-DPA1*04:01/DPB1*01:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 181 434
HLA-DPA1*02:01/DPB1*01:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 419 1004
HLA-DPA1*02:02/DPB1*04:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 468 1121
HLA-DPA1*02:02/DPB1*01:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 290 694
HLA-DPA1*02:02/DPB1*02:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 481 1151
HLA-DPA1*02:02/DPB1*01:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 222 531
HLA-DPA1*03:01/DPB1*04:02 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 460 1100
HLA-DPA1*03:01/DPB1*105:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 460 1100
HLA-DPA1*02:02/DPB1*02:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 371 887
HLA-DPA1*03:01/DPB1*02:01 SWMESEFRVYSSANNC SCMESEFRVYSSANNC 218 521
HLA-DPA1*02:02/DPB1*02:01 NKSWMESEFRVYSSAN NKSCMESEFRVYSSAN 431 1030
HLA-DPA1*04:01/DPB1*01:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 250 597
HLA-DQA1*01:03/DQB1*05:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 361 860
HLA-DRB1*13:02 LGVYYHKNNKSWMESE LGVYYHKNNKSCMESE 267 636
HLA-DPA1*02:02/DPB1*01:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 179 425
HLA-DPA1*02:02/DPB1*01:01 NNKSWMESEFRVYSSAN NNKSCMESEFRVYSSAN 249 590
HLA-DQA1*01:02/DQB1*05:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 203 481
HLA-DPA1*03:01/DPB1*05:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 336 795
HLA-DPA1*04:01/DPB1*01:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 253 598
HLA-DRB1*13:02 GVYYHKNNKSWMESE GVYYHKNNKSCMESE 210 496
HLA-DPA1*04:01/DPB1*01:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 183 432
HLA-DRB1*13:02 FLGVYYHKNNKSWMESEFRV FLGVYYHKNNKSCMESEFRV 157 370
HLA-DPA1*04:01/DPB1*01:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 234 551
HLA-DPA1*02:02/DPB1*01:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 179 420
HLA-DPA1*04:01/DPB1*04:01 KSWMESEFRVYSSANNCTF KSCMESEFRVYSSANNCTF 263 617
HLA-DPA1*02:02/DPB1*04:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 374 874
HLA-DPA1*02:02/DPB1*02:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 412 959
HLA-DPA1*04:01/DPB1*04:01 SWMESEFRVYSSANN SCMESEFRVYSSANN 397 923
HLA-DPA1*03:01/DPB1*05:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 317 736
HLA-DPA1*04:01/DPB1*01:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 250 579
HLA-DPA1*03:01/DPB1*04:02 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 294 680
HLA-DPA1*03:01/DPB1*105:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 294 680
HLA-DPA1*02:02/DPB1*01:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 221 511
HLA-DPA1*02:02/DPB1*01:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 252 582
HLA-DPA1*04:01/DPB1*01:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 220 507
HLA-DRB1*13:02 LGVYYHKNNKSWMES LGVYYHKNNKSCMES 138 318
HLA-DQA1*01:02/DQB1*05:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 204 470
HLA-DPA1*04:01/DPB1*01:01 GVYYHKNNKSWMESEFRVY GVYYHKNNKSCMESEFRVY 383 881
HLA-DQA1*01:02/DQB1*05:01 KNNKSWMESEFRVYSS KNNKSCMESEFRVYSS 349 802
HLA-DPA1*02:02/DPB1*02:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 309 710
HLA-DQA1*01:02/DQB1*05:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 338 776
HLA-DPA1*02:01/DPB1*01:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 407 934
HLA-DPA1*02:02/DPB1*02:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 489 1122
HLA-DPA1*02:02/DPB1*02:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 481 1103
HLA-DPA1*01:03/DPB1*01:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 341 780
HLA-DPA1*02:02/DPB1*01:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 259 592
HLA-DPA1*04:01/DPB1*02:01 SWMESEFRVYSSANN SCMESEFRVYSSANN 302 689
HLA-DPA1*03:01/DPB1*01:01 NNKSWMESEFRVYSSANN NNKSCMESEFRVYSSANN 353 805
HLA-DPA1*03:01/DPB1*02:01 KSWMESEFRVYSSANNCTF KSCMESEFRVYSSANNCTF 123 280
HLA-DPA1*02:02/DPB1*01:01 NNKSWMESEFRVYSSANN NNKSCMESEFRVYSSANN 432 983
HLA-DPA1*04:01/DPB1*01:01 YYHKNNKSWMESEFRVYSS YYHKNNKSCMESEFRVYSS 276 628
HLA-DPA1*04:01/DPB1*01:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 199 452
HLA-DQA1*01:02/DQB1*05:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 199 452
HLA-DRB1*13:02 PFLGVYYHKNNKSWMES PFLGVYYHKNNKSCMES 225 509
HLA-DRB1*13:02 DPFLGVYYHKNNKSWME DPFLGVYYHKNNKSCME 234 529
HLA-DPA1*02:02/DPB1*01:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 238 538
HLA-DRB1*13:02 PFLGVYYHKNNKSWMESEFR PFLGVYYHKNNKSCMESEFR 144 325
HLA-DRB1*13:02 PFLGVYYHKNNKSWME PFLGVYYHKNNKSCME 187 421
HLA-DPA1*04:01/DPB1*01:01 VYYHKNNKSWMESEFRVYS VYYHKNNKSCMESEFRVYS 300 675
HLA-DRB1*13:02 NDPFLGVYYHKNNKSWMES NDPFLGVYYHKNNKSCMES 254 571
HLA-DPA1*03:01/DPB1*02:01 NKSWMESEFRVYSSANNCTF NKSCMESEFRVYSSANNCTF 73 164
HLA-DQA1*01:02/DQB1*05:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 289 649
HLA-DPA1*04:01/DPB1*01:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 276 619
HLA-DPA1*04:01/DPB1*02:01 SWMESEFRVYSSANNC SCMESEFRVYSSANNC 346 775
HLA-DPA1*02:01/DPB1*02:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 472 1057
HLA-DRB1*13:02 NDPFLGVYYHKNNKSWMESE NDPFLGVYYHKNNKSCMESE 138 309
HLA-DRB1*13:02 DPFLGVYYHKNNKSWMESEF DPFLGVYYHKNNKSCMESEF 139 311
HLA-DPA1*02:02/DPB1*02:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 434 970
HLA-DRB1*13:02 FLGVYYHKNNKSWMESEFR FLGVYYHKNNKSCMESEFR 292 652
HLA-DPA1*04:01/DPB1*02:01 NKSWMESEFRVYSSANNCTF NKSCMESEFRVYSSANNCTF 116 259
HLA-DRB1*13:02 FLGVYYHKNNKSWMES FLGVYYHKNNKSCMES 185 413
HLA-DPA1*04:01/DPB1*04:02 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 443 988
HLA-DPA1*04:01/DPB1*105:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 443 988
HLA-DPA1*02:02/DPB1*02:01 NNKSWMESEFRVYSS NNKSCMESEFRVYSS 370 824
HLA-DRB1*13:02 CNDPFLGVYYHKNNKSWMES CNDPFLGVYYHKNNKSCMES 135 300
HLA-DQA1*01:02/DQB1*05:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 300 666
HLA-DRB1*13:02 FLGVYYHKNNKSWMESE FLGVYYHKNNKSCMESE 246 546
HLA-DQA1*01:02/DQB1*05:03 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 454 1005
HLA-DPA1*03:01/DPB1*05:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 292 646
HLA-DPA1*02:01/DPB1*01:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 425 939
HLA-DPA1*02:02/DPB1*02:01 NKSWMESEFRVYSSA NKSCMESEFRVYSSA 316 698
HLA-DQA1*01:02/DQB1*05:01 FLGVYYHKNNKSWMESEFRV FLGVYYHKNNKSCMESEFRV 217 479
HLA-DPA1*04:01/DPB1*02:01 KSWMESEFRVYSSANNCTF KSCMESEFRVYSSANNCTF 198 437
HLA-DPA1*02:01/DPB1*02:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 491 1083
HLA-DPA1*03:01/DPB1*04:02 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 304 670
HLA-DPA1*03:01/DPB1*105:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 304 670
HLA-DQA1*01:03/DQB1*05:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 397 873
HLA-DRB1*13:02 DPFLGVYYHKNNKSWMESE DPFLGVYYHKNNKSCMESE 267 587
HLA-DPA1*04:01/DPB1*01:01 LGVYYHKNNKSWMESEFRVY LGVYYHKNNKSCMESEFRVY 275 604
HLA-DRB1*13:02 PFLGVYYHKNNKSWMESEF PFLGVYYHKNNKSCMESEF 272 597
HLA-DPA1*03:01/DPB1*05:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 296 648
HLA-DRB1*13:02 CNDPFLGVYYHKNNKSWME CNDPFLGVYYHKNNKSCME 278 608
HLA-DPA1*02:02/DPB1*04:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 384 839
HLA-DPA1*04:01/DPB1*04:01 KSWMESEFRVYSSANNCTFE KSCMESEFRVYSSANNCTFE 205 447
HLA-DPA1*02:01/DPB1*01:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 279 608
HLA-DPA1*04:01/DPB1*04:01 SWMESEFRVYSSANNC SCMESEFRVYSSANNC 442 963
HLA-DPA1*02:02/DPB1*01:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 242 525
HLA-DPA1*02:02/DPB1*02:01 KNNKSWMESEFRVYS KNNKSCMESEFRVYS 415 898
HLA-DPA1*03:01/DPB1*05:01 HKNNKSWMESEFRVYSSAN HKNNKSCMESEFRVYSSAN 493 1064
HLA-DPA1*03:01/DPB1*05:01 KNNKSWMESEFRVYSSA KNNKSCMESEFRVYSSA 475 1019
HLA-DPA1*02:02/DPB1*01:01 NKSWMESEFRVYSSANNC NKSCMESEFRVYSSANNC 467 1000
HLA-DPA1*02:02/DPB1*02:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 312 666
HLA-DPA1*02:02/DPB1*01:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 279 595
HLA-DPA1*03:01/DPB1*05:01 YHKNNKSWMESEFRVYSSA YHKNNKSCMESEFRVYSSA 482 1026
HLA-DQA1*01:02/DQB1*05:01 HKNNKSWMESEFRVYSS HKNNKSCMESEFRVYSS 399 849
HLA-DPA1*02:02/DPB1*02:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 476 1011
HLA-DPA1*04:01/DPB1*01:01 NNKSWMESEFRVYSSANN NNKSCMESEFRVYSSANN 356 755
HLA-DRB1*13:02 NDPFLGVYYHKNNKSWM NDPFLGVYYHKNNKSCM 249 528
HLA-DRB1*11:02 VYYHKNNKSWMESEF VYYHKNNKSCMESEF 383 812
HLA-DRB1*13:01 VYYHKNNKSWMESEF VYYHKNNKSCMESEF 383 812
HLA-DPA1*02:02/DPB1*02:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 465 981
HLA-DPA1*03:01/DPB1*04:02 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 311 655
HLA-DPA1*03:01/DPB1*105:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 311 655
HLA-DRB1*13:02 DPFLGVYYHKNNKSWM DPFLGVYYHKNNKSCM 200 421
HLA-DPA1*02:01/DPB1*01:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 449 941
HLA-DPA1*03:01/DPB1*02:01 KSWMESEFRVYSSANNCTFE KSCMESEFRVYSSANNCTFE 89 186
HLA-DQA1*01:02/DQB1*05:03 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 423 884
HLA-DPA1*04:01/DPB1*04:01 SWMESEFRVYSSANNCT SCMESEFRVYSSANNCT 495 1033
HLA-DPA1*02:02/DPB1*02:01 KSWMESEFRVYSSAN KSCMESEFRVYSSAN 371 771
HLA-DPA1*01:03/DPB1*01:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 377 783
HLA-DRB1*13:02 FLGVYYHKNNKSWME FLGVYYHKNNKSCME 105 218
HLA-DQA1*01:03/DQB1*05:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 416 863
HLA-DPA1*03:01/DPB1*01:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 199 412
HLA-DPA1*04:01/DPB1*04:02 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 428 886
HLA-DPA1*04:01/DPB1*105:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 428 886
HLA-DRB1*13:02 PFLGVYYHKNNKSWM PFLGVYYHKNNKSCM 103 213
HLA-DPA1*01:03/DPB1*01:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 341 705
HLA-DPA1*02:02/DPB1*05:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 430 889
HLA-DPA1*02:02/DPB1*05:01 VYYHKNNKSWMESEFRVYSS VYYHKNNKSCMESEFRVYSS 493 1019
HLA-DPA1*02:01/DPB1*02:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 494 1018
HLA-DRB1*11:02 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 350 721
HLA-DRB1*13:01 GVYYHKNNKSWMESEFRVYS GVYYHKNNKSCMESEFRVYS 350 721
HLA-DPA1*02:02/DPB1*04:01 NNKSWMESEFRVYSSANNCT NNKSCMESEFRVYSSANNCT 389 801
HLA-DPA1*03:01/DPB1*01:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 123 253
HLA-DPA1*02:01/DPB1*01:01 NKSWMESEFRVYSSANN NKSCMESEFRVYSSANN 427 875
HLA-DPA1*02:02/DPB1*01:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 245 501
HLA-DQA1*01:03/DQB1*05:01 YYHKNNKSWMESEFRVYSSA YYHKNNKSCMESEFRVYSSA 430 879
HLA-DPA1*02:01/DPB1*01:01 NKSWMESEFRVYSSANNCT NKSCMESEFRVYSSANNCT 453 926
HLA-DPA1*04:01/DPB1*01:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 216 441
HLA-DPA1*02:01/DPB1*01:01 KNNKSWMESEFRVYSSANNC KNNKSCMESEFRVYSSANNC 289 586
HLA-DRB1*13:02 FCNDPFLGVYYHKNNKSWME FCNDPFLGVYYHKNNKSCME 151 306
HLA-DPA1*02:02/DPB1*01:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 163 330
HLA-DQA1*01:02/DQB1*05:01 FLGVYYHKNNKSWMESEFR FLGVYYHKNNKSCMESEFR 371 750
HLA-DPA1*02:02/DPB1*05:01 YHKNNKSWMESEFRVYSSAN YHKNNKSCMESEFRVYSSAN 428 864
HLA-DPA1*04:01/DPB1*02:01 KSWMESEFRVYSSANNCTFE KSCMESEFRVYSSANNCTFE 138 278
HLA-DPA1*02:02/DPB1*02:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 488 981
HLA-DPA1*02:02/DPB1*02:01 KSWMESEFRVYSSANNC KSCMESEFRVYSSANNC 496 997
HLA-DRB1*13:02 FCNDPFLGVYYHKNNKSWM FCNDPFLGVYYHKNNKSCM 315 633
HLA-DQA1*01:03/DQB1*05:01 FLGVYYHKNNKSWMESEFRV FLGVYYHKNNKSCMESEFRV 341 685
HLA-DPA1*01:03/DPB1*01:01 HKNNKSWMESEFRVYSSANN HKNNKSCMESEFRVYSSANN 238 478
HLA-DPA1*01:03/DPB1*01:01 NNKSWMESEFRVYSSANNC NNKSCMESEFRVYSSANNC 321 644
HLA-DPA1*03:01/DPB1*01:01 KNNKSWMESEFRVYSSANN KNNKSCMESEFRVYSSANN 173 346
HLA-DPA1*02:02/DPB1*01:01 KSWMESEFRVYSSANN KSCMESEFRVYSSANN 252 504
HLA-DPA1*03:01/DPB1*02:01 SWMESEFRVYSSANNCTF SCMESEFRVYSSANNCTF 404 808

L452R

Reference  DDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    DDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRL LDSKVGGNYNYRYRL 424 3666
HLA-DPA1*03:01/DPB1*02:01 WNSNNLDSKVGGNYNYLYRL WNSNNLDSKVGGNYNYRYRL 415 2864
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 144 966
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 249 1634
HLA-DPA1*03:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 113 734
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 392 2542
HLA-DPA1*03:01/DPB1*04:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 305 1960
HLA-DPA1*03:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 218 1391
HLA-DPA1*03:01/DPB1*04:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 256 1631
HLA-DPA1*03:01/DPB1*04:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 345 2181
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 173 1093
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 359 2266
HLA-DPA1*03:01/DPB1*04:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 401 2531
HLA-DPA1*03:01/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 172 1064
HLA-DPA1*03:01/DPB1*02:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 196 1212
HLA-DPA1*03:01/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 144 883
HLA-DPA1*03:01/DPB1*04:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 441 2693
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 218 1325
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLF DSKVGGNYNYRYRLF 261 1555
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLF NLDSKVGGNYNYRYRLF 361 2150
HLA-DPA1*03:01/DPB1*04:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 305 1801
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 309 1809
HLA-DPA1*03:01/DPB1*04:02 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 444 2598
HLA-DPA1*03:01/DPB1*105:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 444 2598
HLA-DPA1*03:01/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 143 835
HLA-DPA1*03:01/DPB1*02:01 SNNLDSKVGGNYNYLYRLF SNNLDSKVGGNYNYRYRLF 324 1887
HLA-DPA1*03:01/DPB1*02:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 252 1455
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 351 2010
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLF LDSKVGGNYNYRYRLF 295 1679
HLA-DPA1*03:01/DPB1*02:01 NLDSKVGGNYNYLYRLFR NLDSKVGGNYNYRYRLFR 455 2516
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLFRK LDSKVGGNYNYRYRLFRK 304 1659
HLA-DPA1*03:01/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 244 1247
HLA-DPA1*01:03/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 439 2221
HLA-DPA1*01:03/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 317 1603
HLA-DPA1*03:01/DPB1*01:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 342 1688
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 424 2025
HLA-DPA1*03:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 322 1525
HLA-DPA1*01:03/DPB1*02:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 457 2136
HLA-DPA1*04:01/DPB1*02:01 DSKVGGNYNYLYRLF DSKVGGNYNYRYRLF 449 2083
HLA-DPA1*04:01/DPB1*02:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 325 1506
HLA-DPA1*03:01/DPB1*01:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 422 1941
HLA-DPA1*04:01/DPB1*02:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 419 1926
HLA-DRB1*11:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 37 169
HLA-DRB1*11:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 72 326
HLA-DRB1*11:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 82 368
HLA-DPA1*03:01/DPB1*01:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 471 2092
HLA-DPA1*04:01/DPB1*02:01 LDSKVGGNYNYLYRLF LDSKVGGNYNYRYRLF 456 2007
HLA-DPA1*04:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 422 1855
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 364 1596
HLA-DPA1*03:01/DPB1*01:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 324 1420
HLA-DPA1*03:01/DPB1*01:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 478 2087
HLA-DPA1*03:01/DPB1*05:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 438 1903
HLA-DPA1*04:01/DPB1*04:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 445 1918
HLA-DPA1*04:01/DPB1*02:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 328 1408
HLA-DPA1*04:01/DPB1*04:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 499 2113
HLA-DRB1*11:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 64 271
HLA-DPA1*03:01/DPB1*01:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 337 1420
HLA-DPA1*04:01/DPB1*02:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 320 1347
HLA-DPA1*02:02/DPB1*01:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 483 2032
HLA-DPA1*04:01/DPB1*04:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 405 1699
HLA-DPA1*04:01/DPB1*02:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 380 1592
HLA-DPA1*04:01/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 306 1280
HLA-DPA1*01:03/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 390 1622
HLA-DPA1*01:03/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 458 1904
HLA-DPA1*03:01/DPB1*01:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 450 1858
HLA-DPA1*01:03/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 451 1862
HLA-DRB1*11:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 145 597
HLA-DPA1*04:01/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 275 1122
HLA-DPA1*04:01/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 228 928
HLA-DRB1*11:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 133 541
HLA-DPA1*04:01/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 255 1029
HLA-DRB1*11:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 144 581
HLA-DPA1*03:01/DPB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 321 1280
HLA-DPA1*04:01/DPB1*02:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 406 1598
HLA-DPA1*02:02/DPB1*01:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 384 1511
HLA-DPA1*02:02/DPB1*01:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 390 1497
HLA-DPA1*02:02/DPB1*01:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 354 1357
HLA-DRB1*11:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 357 1364
HLA-DRB1*11:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 281 1070
HLA-DPA1*02:02/DPB1*01:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 364 1384
HLA-DRB1*11:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 344 1295
HLA-DPA1*03:01/DPB1*05:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 489 1824
HLA-DPA1*04:01/DPB1*01:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 473 1751
HLA-DPA1*02:02/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 323 1186
HLA-DRB1*11:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 114 416
HLA-DRB1*11:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 134 485
HLA-DRB1*11:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 50 179
HLA-DRB1*11:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 102 357
HLA-DPA1*03:01/DPB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 479 1643
HLA-DPA1*03:01/DPB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 477 1634
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 216 735
HLA-DRB1*11:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 383 1300
HLA-DRB1*11:04 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 75 254
HLA-DPA1*02:02/DPB1*01:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 489 1656
HLA-DRB1*10:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 275 922
HLA-DRB1*11:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 83 278
HLA-DPA1*04:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 374 1238
HLA-DRB1*11:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 258 850
HLA-DRB1*10:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 417 1367
HLA-DPA1*04:01/DPB1*01:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 478 1566
HLA-DRB1*10:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 420 1370
HLA-DPA1*04:01/DPB1*01:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 342 1101
HLA-DPA1*04:01/DPB1*01:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 372 1195
HLA-DRB1*16:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 189 605
HLA-DPA1*04:01/DPB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 291 929
HLA-DPA1*02:02/DPB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 351 1116
HLA-DPA1*04:01/DPB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 486 1541
HLA-DRB1*11:04 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 32 101
HLA-DPA1*02:02/DPB1*05:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 425 1331
HLA-DRB1*16:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 482 1504
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 164 508
HLA-DPA1*04:01/DPB1*01:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 433 1339
HLA-DPA1*02:02/DPB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 446 1378
HLA-DPA1*03:01/DPB1*04:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 200 617
HLA-DPA1*04:01/DPB1*01:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 408 1253
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 193 592
HLA-DRB1*10:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 447 1369
HLA-DRB1*11:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 185 559
HLA-DPA1*02:02/DPB1*02:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 498 1503
HLA-DPA1*04:01/DPB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 449 1354
HLA-DQA1*01:02/DQB1*05:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 332 1000
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 314 944
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 233 699
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 356 1062
HLA-DPA1*03:01/DPB1*04:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 366 1087
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 169 501
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLFRK LDSKVGGNYNYRYRLFRK 352 1027
HLA-DQA1*01:02/DQB1*05:03 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 403 1175
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 318 923
HLA-DPA1*03:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 191 551
HLA-DQA1*01:02/DQB1*05:03 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 410 1181
HLA-DPA1*02:02/DPB1*02:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 463 1330
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 310 890
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 202 575
HLA-DRB1*11:04 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 268 759
HLA-DRB1*11:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 176 498
HLA-DPA1*04:01/DPB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 382 1077
HLA-DPA1*02:02/DPB1*02:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 356 999
HLA-DRB1*11:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 118 331
HLA-DRB1*11:04 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 70 196
HLA-DPA1*03:01/DPB1*01:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 247 691
HLA-DRB1*01:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 237 663
HLA-DRB1*16:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 400 1110
HLA-DPA1*03:01/DPB1*04:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 191 530
HLA-DQA1*01:03/DQB1*05:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 294 813
HLA-DPA1*03:01/DPB1*04:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 174 481
HLA-DPA1*03:01/DPB1*01:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 180 493
HLA-DPA1*02:02/DPB1*02:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 442 1208
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 224 610
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 209 569
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 317 859
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 192 520
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 423 1140
HLA-DPA1*03:01/DPB1*01:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 422 1133
HLA-DRB1*16:01 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 416 1115
HLA-DPA1*03:01/DPB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 250 668
HLA-DPA1*02:02/DPB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 347 927
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 234 625
HLA-DPA1*03:01/DPB1*04:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 166 442
HLA-DPA1*03:01/DPB1*01:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 232 617
HLA-DQA1*01:03/DQB1*05:01 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 389 1032
HLA-DRB1*08:04 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 141 374
HLA-DPA1*03:01/DPB1*01:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 250 663
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 188 496
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 318 838
HLA-DPA1*03:01/DPB1*04:02 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 358 941
HLA-DPA1*03:01/DPB1*105:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 358 941
HLA-DQA1*01:03/DQB1*05:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 409 1074
HLA-DRB1*11:04 GGNYNYLYRLFRKSNLKP GGNYNYRYRLFRKSNLKP 80 210
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 275 719
HLA-DQA1*01:03/DQB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 321 837
HLA-DPA1*02:02/DPB1*02:01 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 360 937
HLA-DRB1*08:02 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 293 762
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFR DSKVGGNYNYRYRLFR 235 611
HLA-DQA1*01:03/DQB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 324 842
HLA-DQA1*01:03/DQB1*05:01 NLDSKVGGNYNYLYRLFRK NLDSKVGGNYNYRYRLFRK 384 997
HLA-DRB1*12:02 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 472 1222
HLA-DPA1*03:01/DPB1*01:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 256 662
HLA-DPA1*03:01/DPB1*04:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 212 546
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 210 539
HLA-DQA1*01:02/DQB1*05:03 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 482 1236
HLA-DPA1*03:01/DPB1*04:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 214 546
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRLFR NLDSKVGGNYNYRYRLFR 492 1251
HLA-DPA1*03:01/DPB1*04:02 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 339 858
HLA-DPA1*03:01/DPB1*105:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 339 858
HLA-DQA1*01:02/DQB1*05:03 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 443 1116
HLA-DRB1*12:02 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 237 597
HLA-DQA1*01:02/DQB1*05:01 NNLDSKVGGNYNYLYRLFR NNLDSKVGGNYNYRYRLFR 273 687
HLA-DQA1*01:02/DQB1*05:03 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 437 1099
HLA-DRB1*08:04 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 305 767
HLA-DRB1*11:04 KVGGNYNYLYRLFRKSNL KVGGNYNYRYRLFRKSNL 138 346
HLA-DRB1*16:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 139 348
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 252 629
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKSNL KVGGNYNYRYRLFRKSNL 249 621
HLA-DPA1*03:01/DPB1*04:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 215 536
HLA-DQA1*01:02/DQB1*05:01 GGNYNYLYRLFRKSNL GGNYNYRYRLFRKSNL 225 560
HLA-DRB1*10:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 426 1052
HLA-DPA1*03:01/DPB1*04:02 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 316 779
HLA-DPA1*03:01/DPB1*105:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 316 779
HLA-DPA1*02:02/DPB1*01:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 248 611
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 311 766
HLA-DRB1*01:01 SKVGGNYNYLYRLFR SKVGGNYNYRYRLFR 366 900
HLA-DQA1*01:03/DQB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 346 849
HLA-DRB1*16:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 382 933
HLA-DRB1*10:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 222 539
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 353 857
HLA-DRB1*16:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 137 332
HLA-DRB1*11:04 GGNYNYLYRLFRKSNL GGNYNYRYRLFRKSNL 43 104
HLA-DRB1*11:04 VGGNYNYLYRLFRKSNLK VGGNYNYRYRLFRKSNLK 82 197
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLF LDSKVGGNYNYRYRLF 259 621
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKSNLK VGGNYNYRYRLFRKSNLK 304 728
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRL LDSKVGGNYNYRYRL 446 1065
HLA-DQA1*01:02/DQB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 166 394
HLA-DPA1*03:01/DPB1*01:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 268 633
HLA-DRB1*10:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 321 758
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKSNL VGGNYNYRYRLFRKSNL 208 491
HLA-DQA1*01:03/DQB1*06:09 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 465 1087
HLA-DPA1*03:01/DPB1*04:02 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 259 605
HLA-DPA1*03:01/DPB1*105:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 259 605
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLF DSKVGGNYNYRYRLF 283 660
HLA-DRB1*11:04 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 128 298
HLA-DRB1*08:04 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 272 633
HLA-DQA1*01:03/DQB1*06:09 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 462 1070
HLA-DQA1*01:02/DQB1*05:01 GNYNYLYRLFRKSNLK GNYNYRYRLFRKSNLK 254 588
HLA-DQA1*01:03/DQB1*06:09 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 477 1104
HLA-DPA1*02:02/DPB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 240 555
HLA-DRB1*10:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 197 455
HLA-DQA1*01:02/DQB1*05:01 SNNLDSKVGGNYNYLYRLF SNNLDSKVGGNYNYRYRLF 324 748
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKSNLK KVGGNYNYRYRLFRKSNLK 179 413
HLA-DQA1*01:02/DQB1*05:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 150 345
HLA-DRB1*11:04 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 64 147
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRKSNL SKVGGNYNYRYRLFRKSNL 163 374
HLA-DRB1*11:04 DSKVGGNYNYLYRLFRK DSKVGGNYNYRYRLFRK 154 353
HLA-DQA1*01:02/DQB1*05:01 GGNYNYLYRLFRKSNLKP GGNYNYRYRLFRKSNLKP 401 919
HLA-DRB1*16:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 271 618
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRLF NLDSKVGGNYNYRYRLF 359 818
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 151 344
HLA-DRB1*01:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 380 865
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 71 161
HLA-DRB1*10:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 291 658
HLA-DPA1*03:01/DPB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 345 780
HLA-DPA1*02:02/DPB1*01:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 204 461
HLA-DRB1*11:04 SKVGGNYNYLYRLFRK SKVGGNYNYRYRLFRK 171 386
HLA-DPA1*02:01/DPB1*01:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 450 1014
HLA-DPA1*03:01/DPB1*02:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 130 292
HLA-DQA1*01:03/DQB1*05:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 327 733
HLA-DRB1*01:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 383 858
HLA-DQA1*01:02/DQB1*05:01 NLDSKVGGNYNYLYRL NLDSKVGGNYNYRYRL 451 1009
HLA-DRB1*12:02 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 447 992
HLA-DPA1*02:01/DPB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 461 1023
HLA-DRB1*15:02 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 415 920
HLA-DRB1*01:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 207 458
HLA-DQA1*01:02/DQB1*05:03 DSKVGGNYNYLYRLFRKSNL DSKVGGNYNYRYRLFRKSNL 410 906
HLA-DRB1*01:01 NNLDSKVGGNYNYLYRLFRK NNLDSKVGGNYNYRYRLFRK 393 868
HLA-DQA1*01:02/DQB1*05:03 SKVGGNYNYLYRLFRKSNLK SKVGGNYNYRYRLFRKSNLK 413 912
HLA-DQA1*01:03/DQB1*05:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 282 622
HLA-DQA1*01:02/DQB1*05:01 GGNYNYLYRLFRKSNLK GGNYNYRYRLFRKSNLK 275 606
HLA-DPA1*03:01/DPB1*04:02 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 233 513
HLA-DPA1*03:01/DPB1*105:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 233 513
HLA-DRB1*11:04 NYNYLYRLFRKSNLKP NYNYRYRLFRKSNLKP 30 66
HLA-DQA1*01:03/DQB1*05:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 280 615
HLA-DRB1*16:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 255 560
HLA-DQA1*01:02/DQB1*05:01 VGGNYNYLYRLFRKSNLKP VGGNYNYRYRLFRKSNLKP 218 478
HLA-DPA1*02:01/DPB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 444 973
HLA-DRB1*01:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 214 468
HLA-DPA1*02:02/DPB1*01:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 181 395
HLA-DRB1*10:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 325 709
HLA-DRB1*11:04 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 50 109
HLA-DRB1*10:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 367 799
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRKSNL KVGGNYNYRYRLFRKSNL 416 904
HLA-DRB1*16:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 293 636
HLA-DPA1*02:02/DPB1*01:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 218 473
HLA-DPA1*03:01/DPB1*02:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 77 167
HLA-DPA1*03:01/DPB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 336 728
HLA-DQA1*01:02/DQB1*05:01 SNNLDSKVGGNYNYLYRLFR SNNLDSKVGGNYNYRYRLFR 212 459
HLA-DRB1*08:02 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 404 869
HLA-DPA1*02:02/DPB1*01:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 220 473
HLA-DPA1*03:01/DPB1*04:02 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 350 752
HLA-DPA1*03:01/DPB1*105:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 350 752
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKSNLK VGGNYNYRYRLFRKSNLK 446 958
HLA-DQA1*01:03/DQB1*06:09 DSKVGGNYNYLYRLFRKSNL DSKVGGNYNYRYRLFRKSNL 427 917
HLA-DRB1*11:04 VGGNYNYLYRLFRKSNL VGGNYNYRYRLFRKSNL 41 88
HLA-DRB1*01:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 462 991
HLA-DQA1*01:02/DQB1*05:03 KVGGNYNYLYRLFRKSNLKP KVGGNYNYRYRLFRKSNLKP 434 930
HLA-DRB1*11:04 GNYNYLYRLFRKSNLKPF GNYNYRYRLFRKSNLKPF 71 152
HLA-DQA1*01:02/DQB1*05:01 GNYNYLYRLFRKSNL GNYNYRYRLFRKSNL 268 573
HLA-DRB1*11:04 GNYNYLYRLFRKSNLK GNYNYRYRLFRKSNLK 29 62
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKSNL VGGNYNYRYRLFRKSNL 276 589
HLA-DPA1*03:01/DPB1*04:02 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 345 736
HLA-DPA1*03:01/DPB1*105:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 345 736
HLA-DPA1*04:01/DPB1*04:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 274 583
HLA-DQA1*01:03/DQB1*05:01 KVGGNYNYLYRLFRKSNLK KVGGNYNYRYRLFRKSNLK 243 517
HLA-DRB1*10:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 356 756
HLA-DRB1*16:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 279 592
HLA-DPA1*03:01/DPB1*01:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 273 579
HLA-DRB1*11:04 GNYNYLYRLFRKSNLKP GNYNYRYRLFRKSNLKP 25 53
HLA-DRB1*10:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 419 887
HLA-DPA1*02:02/DPB1*05:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 294 622
HLA-DPA1*02:01/DPB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 371 782
HLA-DQA1*01:02/DQB1*05:01 SKVGGNYNYLYRLFRKSNLK SKVGGNYNYRYRLFRKSNLK 140 295
HLA-DQA1*01:02/DQB1*05:01 KVGGNYNYLYRLFRKSNLKP KVGGNYNYRYRLFRKSNLKP 154 324
HLA-DPA1*02:01/DPB1*05:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 388 815
HLA-DPA1*03:01/DPB1*02:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 143 300
HLA-DPA1*03:01/DPB1*04:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 198 415
HLA-DPA1*02:02/DPB1*01:01 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 418 876
HLA-DPA1*03:01/DPB1*04:02 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 295 618
HLA-DPA1*03:01/DPB1*105:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 295 618
HLA-DQA1*01:03/DQB1*05:01 SKVGGNYNYLYRLFRKSNL SKVGGNYNYRYRLFRKSNL 238 498
HLA-DPA1*02:01/DPB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 423 885
HLA-DRB1*16:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 198 414
HLA-DQA1*01:03/DQB1*05:01 GGNYNYLYRLFRKSNL GGNYNYRYRLFRKSNL 276 575
HLA-DQA1*01:02/DQB1*05:01 GNYNYLYRLFRKSNLKP GNYNYRYRLFRKSNLKP 297 618
HLA-DPA1*02:02/DPB1*01:01 SKVGGNYNYLYRLFRKSN SKVGGNYNYRYRLFRKSN 384 799
HLA-DQA1*01:03/DQB1*05:01 VGGNYNYLYRLFRKSNLKP VGGNYNYRYRLFRKSNLKP 274 570
HLA-DQA1*01:03/DQB1*05:01 GNYNYLYRLFRKSNL GNYNYRYRLFRKSNL 304 632
HLA-DRB1*08:04 KVGGNYNYLYRLFRK KVGGNYNYRYRLFRK 311 646
HLA-DQA1*01:03/DQB1*06:09 SKVGGNYNYLYRLFRKSNLK SKVGGNYNYRYRLFRKSNLK 444 919
HLA-DPA1*02:01/DPB1*05:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 304 629
HLA-DRB1*11:04 NYNYLYRLFRKSNLKPFE NYNYRYRLFRKSNLKPFE 75 155
HLA-DRB1*11:04 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 129 266
HLA-DPA1*02:02/DPB1*01:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 216 445
HLA-DPA1*03:01/DPB1*05:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 250 515
HLA-DRB1*01:01 VGGNYNYLYRLFRKSN VGGNYNYRYRLFRKSN 490 1009
HLA-DPA1*01:03/DPB1*01:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 374 770
HLA-DRB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 484 996
HLA-DPA1*03:01/DPB1*04:02 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 336 690
HLA-DPA1*03:01/DPB1*105:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 336 690
HLA-DQA1*01:02/DQB1*05:01 DSKVGGNYNYLYRLFRKSNL DSKVGGNYNYRYRLFRKSNL 134 275
HLA-DRB1*08:04 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 212 435
HLA-DPA1*02:02/DPB1*05:01 KVGGNYNYLYRLFRKS KVGGNYNYRYRLFRKS 240 492
HLA-DPA1*03:01/DPB1*02:01 KVGGNYNYLYRLFRKSN KVGGNYNYRYRLFRKSN 69 141
HLA-DPA1*03:01/DPB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 343 699
HLA-DRB1*16:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 354 721
HLA-DQA1*01:02/DQB1*05:01 NSNNLDSKVGGNYNYLYRLF NSNNLDSKVGGNYNYRYRLF 247 503
HLA-DPA1*02:01/DPB1*01:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 325 661
HLA-DPA1*02:01/DPB1*01:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 360 732
HLA-DPA1*02:02/DPB1*05:01 SKVGGNYNYLYRLFRKS SKVGGNYNYRYRLFRKS 224 454
HLA-DPA1*02:02/DPB1*05:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 265 537
HLA-DRB1*16:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 222 449
HLA-DRB1*11:04 LDSKVGGNYNYLYRLFR LDSKVGGNYNYRYRLFR 480 969
HLA-DRB1*16:01 LDSKVGGNYNYLYRLFRKS LDSKVGGNYNYRYRLFRKS 381 768
HLA-DQA1*01:03/DQB1*05:01 GGNYNYLYRLFRKSNLK GGNYNYRYRLFRKSNLK 329 663
HLA-DPA1*02:02/DPB1*05:01 VGGNYNYLYRLFRKS VGGNYNYRYRLFRKS 198 399
HLA-DPA1*02:01/DPB1*05:01 NLDSKVGGNYNYLYRLFRKS NLDSKVGGNYNYRYRLFRKS 306 616
HLA-DPA1*04:01/DPB1*04:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 265 533
HLA-DPA1*01:03/DPB1*01:01 DSKVGGNYNYLYRLFRKSN DSKVGGNYNYRYRLFRKSN 368 739
HLA-DRB1*10:01 LDSKVGGNYNYLYRLFRKSN LDSKVGGNYNYRYRLFRKSN 241 483
HLA-DRB1*11:04 GNYNYLYRLFRKSNL GNYNYRYRLFRKSNL 21 42
HLA-DPA1*02:02/DPB1*05:01 GGNYNYLYRLFRKSN GGNYNYRYRLFRKSN 184 368
HLA-DRB1*11:04 DSKVGGNYNYLYRLFRKS DSKVGGNYNYRYRLFRKS 440 880

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 533 192
HLA-DRB1*01:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 521 192
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 328 123
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 889 335
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTE NTSNQVAVLYQGVNCTE 281 107
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 677 258
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 243 93
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 227 87
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 130 50
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 403 155
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 136 53
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 228 89
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 176 69
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 181 71
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 150 59
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 167 66
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 200 80
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQD TPGTNTSNQVAVLYQG 276 112
HLA-DRB1*01:01 VAVLYQDVNCTEVPV VAVLYQGVNCTEVPV 347 141
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEV NTSNQVAVLYQGVNCTEV 639 263
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 413 170
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVN TPGTNTSNQVAVLYQGVN 376 155
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQD ITPGTNTSNQVAVLYQG 339 140
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVA QVAVLYQGVNCTEVPVA 814 340
HLA-DRB1*01:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 867 365
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDV ITPGTNTSNQVAVLYQGV 435 184
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDVN ITPGTNTSNQVAVLYQGVN 229 97
HLA-DQA1*01:03/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 960 408
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPV NQVAVLYQGVNCTEVPV 799 340
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 176 75
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCT TNTSNQVAVLYQGVNCT 211 90
HLA-DRB1*01:01 VAVLYQDVNCTEVPVAI VAVLYQGVNCTEVPVAI 996 428
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 292 126
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 417 181
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 852 370
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 312 136
HLA-DRB1*01:01 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 699 305
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNC GTNTSNQVAVLYQGVNC 197 86
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVP NTSNQVAVLYQGVNCTEVP 412 180
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVP TSNQVAVLYQGVNCTEVP 908 399
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 450 198
HLA-DRB1*01:01 QVAVLYQDVNCTEVP QVAVLYQGVNCTEVP 285 126
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 530 235
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDVN VITPGTNTSNQVAVLYQGVN 189 84
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDV VITPGTNTSNQVAVLYQGV 270 121
HLA-DRB1*01:01 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 450 202
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 597 268
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 838 380
HLA-DRB1*01:01 VAVLYQDVNCTEVPVA VAVLYQGVNCTEVPVA 1017 462
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 801 365
HLA-DRB1*10:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 910 416
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVA SNQVAVLYQGVNCTEVPVA 979 449
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 365 168
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 447 206
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVNC PGTNTSNQVAVLYQGVNC 425 196
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 471 218
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTE TNTSNQVAVLYQGVNCTE 477 221
HLA-DRB1*01:01 QVAVLYQDVNCTEVPV QVAVLYQGVNCTEVPV 855 397
HLA-DRB1*01:01 NQVAVLYQDVNCTEV NQVAVLYQGVNCTEV 253 118
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPVA TSNQVAVLYQGVNCTEVPVA 488 228
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNCT GTNTSNQVAVLYQGVNCT 436 204
HLA-DQA1*02:01/DQB1*03:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DQA1*02:01/DQB1*03:19 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DRB1*01:01 NQVAVLYQDVNCTEVP NQVAVLYQGVNCTEVP 887 416
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAI NQVAVLYQGVNCTEVPVAI 991 467
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 984 467
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 485 231
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 641 306
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIH QVAVLYQGVNCTEVPVAIH 1021 488
HLA-DPA1*03:01/DPB1*04:01 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 307 635
HLA-DRB1*01:01 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 850 411
HLA-DRB1*01:01 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 502 243
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVAI SNQVAVLYQGVNCTEVPVAI 481 235
HLA-DQA1*01:02/DQB1*06:02 SVITPGTNTSNQVAVLYQDV SVITPGTNTSNQVAVLYQGV 231 113
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAIH NQVAVLYQGVNCTEVPVAIH 483 237
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 936 460
HLA-DQA1*01:03/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 493 243
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTEV TNTSNQVAVLYQGVNCTEV 298 147
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVNC TPGTNTSNQVAVLYQGVNC 254 126
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQD VITPGTNTSNQVAVLYQG 681 338
HLA-DRB1*01:01 TNTSNQVAVLYQDVNCTEVP TNTSNQVAVLYQGVNCTEVP 523 260
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIHA QVAVLYQGVNCTEVPVAIHA 502 251

N protein

N

T205I

Reference  SQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQL
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SQASSRSSSRSRNSSRNSTPGSSRGISPARMAGNGGDAALALLLLDRLNQL

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*10:01 GSSRGTSPARMAGNG GSSRGISPARMAGNG 2113 434
HLA-DRB1*10:01 SSRGTSPARMAGNGG SSRGISPARMAGNGG 2254 469
HLA-DRB1*01:01 GSSRGTSPARMAGNG GSSRGISPARMAGNG 1390 386
HLA-DRB1*01:01 SSRGTSPARMAGNGG SSRGISPARMAGNGG 1480 420
HLA-DQA1*05:01/DQB1*04:02 GSSRGTSPARMAGNG GSSRGISPARMAGNG 1013 296
HLA-DRB1*01:01 PGSSRGTSPARMAGN PGSSRGISPARMAGN 1305 387
HLA-DQA1*05:01/DQB1*04:02 PGSSRGTSPARMAGN PGSSRGISPARMAGN 977 299
HLA-DQA1*05:01/DQB1*04:02 SSRGTSPARMAGNGG SSRGISPARMAGNGG 1073 329
HLA-DQA1*05:01/DQB1*04:02 RNSTPGSSRGTSPARMAGNG RNSTPGSSRGISPARMAGNG 1320 414
HLA-DQA1*05:01/DQB1*04:02 NSTPGSSRGTSPARMAGNGG NSTPGSSRGISPARMAGNGG 1352 428
HLA-DRB1*01:01 STPGSSRGTSPARMA STPGSSRGISPARMA 1360 436
HLA-DQA1*05:01/DQB1*04:02 GSSRGTSPARMAGNGG GSSRGISPARMAGNGG 1497 484
HLA-DRB1*01:01 TPGSSRGTSPARMAG TPGSSRGISPARMAG 1312 433
HLA-DQA1*05:01/DQB1*04:02 PGSSRGTSPARMAGNG PGSSRGISPARMAGNG 1482 493
HLA-DQA1*05:01/DQB1*04:02 STPGSSRGTSPARMAGNGGD STPGSSRGISPARMAGNGGD 1373 458
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDA RGISPARMAGNGGDA 754 253
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDA RGISPARMAGNGGDA 754 253
HLA-DQA1*01:02/DQB1*06:02 SRGTSPARMAGNGGD SRGISPARMAGNGGD 1409 476
HLA-DQA1*05:01/DQB1*04:02 SRNSTPGSSRGTSPARMAGN SRNSTPGSSRGISPARMAGN 1284 436
HLA-DQA1*05:01/DQB1*04:02 TPGSSRGTSPARMAGN TPGSSRGISPARMAGN 1391 482
HLA-DQA1*05:01/DQB1*04:02 TPGSSRGTSPARMAGNGGDA TPGSSRGISPARMAGNGGDA 1382 481
HLA-DQA1*01:03/DQB1*06:01 RGTSPARMAGNGGDA RGISPARMAGNGGDA 790 278
HLA-DQA1*01:02/DQB1*06:02 SSRGTSPARMAGNGGDA SSRGISPARMAGNGGDA 1222 433
HLA-DQA1*01:02/DQB1*06:01 RGTSPARMAGNGGDA RGISPARMAGNGGDA 817 291
HLA-DQA1*01:02/DQB1*06:02 SSRGTSPARMAGNGGDAALA SSRGISPARMAGNGGDAALA 1189 428
HLA-DQA1*05:01/DQB1*04:02 STPGSSRGTSPARMA STPGSSRGISPARMA 1036 374
HLA-DQA1*01:03/DQB1*06:02 RNSTPGSSRGTSPARMAGNG RNSTPGSSRGISPARMAGNG 974 353
HLA-DQA1*01:02/DQB1*06:02 TPGSSRGTSPARMAGNGGDA TPGSSRGISPARMAGNGGDA 879 319
HLA-DQA1*01:02/DQB1*06:02 PGSSRGTSPARMAGNGGDAA PGSSRGISPARMAGNGGDAA 922 335
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAA GISPARMAGNGGDAA 816 297
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAA GISPARMAGNGGDAA 816 297
HLA-DQA1*01:03/DQB1*06:02 STPGSSRGTSPARMAGNGG STPGSSRGISPARMAGNGG 1343 490
HLA-DQA1*01:02/DQB1*06:02 STPGSSRGTSPARMAGNGGD STPGSSRGISPARMAGNGGD 854 312
HLA-DQA1*01:02/DQB1*06:02 GSSRGTSPARMAGNGGDAAL GSSRGISPARMAGNGGDAAL 1007 368
HLA-DQA1*01:03/DQB1*06:02 NSTPGSSRGTSPARMAGNGG NSTPGSSRGISPARMAGNGG 948 349
HLA-DQA1*01:02/DQB1*06:02 PGSSRGTSPARMAGNGGDA PGSSRGISPARMAGNGGDA 1149 426
HLA-DQA1*01:03/DQB1*06:02 GSSRGTSPARMAGNGGDAAL GSSRGISPARMAGNGGDAAL 954 354
HLA-DQA1*01:03/DQB1*06:02 SSRGTSPARMAGNGGDA SSRGISPARMAGNGGDA 1158 430
HLA-DQA1*01:02/DQB1*06:02 SSRGTSPARMAGNGGD SSRGISPARMAGNGGD 917 342
HLA-DQA1*01:02/DQB1*06:02 NSTPGSSRGTSPARMAGNGG NSTPGSSRGISPARMAGNGG 890 332
HLA-DQA1*01:02/DQB1*06:02 GSSRGTSPARMAGNGGDAA GSSRGISPARMAGNGGDAA 1234 461
HLA-DQA1*01:03/DQB1*06:02 PGSSRGTSPARMAGNGGDA PGSSRGISPARMAGNGGDA 1317 493
HLA-DQA1*01:02/DQB1*06:02 TPGSSRGTSPARMAGNGGD TPGSSRGISPARMAGNGGD 1092 410
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAA RGISPARMAGNGGDAA 798 300
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAA RGISPARMAGNGGDAA 798 300
HLA-DQA1*01:03/DQB1*06:02 TPGSSRGTSPARMAGNGGD TPGSSRGISPARMAGNGGD 1287 484
HLA-DQA1*01:02/DQB1*06:02 RNSTPGSSRGTSPARMAGNG RNSTPGSSRGISPARMAGNG 917 345
HLA-DQA1*01:03/DQB1*06:02 STPGSSRGTSPARMAGNGGD STPGSSRGISPARMAGNGGD 914 345
HLA-DQA1*01:03/DQB1*06:02 TPGSSRGTSPARMAGNGGDA TPGSSRGISPARMAGNGGDA 921 350
HLA-DQA1*01:02/DQB1*06:02 GSSRGTSPARMAGNGG GSSRGISPARMAGNGG 805 306
HLA-DQA1*01:02/DQB1*06:01 RGTSPARMAGNGGDAA RGISPARMAGNGGDAA 886 337
HLA-DQA1*01:03/DQB1*06:02 PGSSRGTSPARMAGNGGDAA PGSSRGISPARMAGNGGDAA 931 355
HLA-DQA1*01:02/DQB1*06:02 SSRGTSPARMAGNGG SSRGISPARMAGNGG 860 329
HLA-DQA1*01:02/DQB1*06:02 STPGSSRGTSPARMAGNGG STPGSSRGISPARMAGNGG 1136 435
HLA-DQA1*01:02/DQB1*06:02 GSSRGTSPARMAGNGGD GSSRGISPARMAGNGGD 961 368
HLA-DQA1*01:02/DQB1*06:02 GSSRGTSPARMAGNG GSSRGISPARMAGNG 724 278
HLA-DQA1*01:02/DQB1*06:01 GTSPARMAGNGGDAA GISPARMAGNGGDAA 1018 391
HLA-DQA1*01:03/DQB1*06:02 SSRGTSPARMAGNGGDAALA SSRGISPARMAGNGGDAALA 1041 401
HLA-DQA1*01:02/DQB1*06:02 NSTPGSSRGTSPARMAGNG NSTPGSSRGISPARMAGNG 1162 452
HLA-DQA1*01:03/DQB1*06:02 TPGSSRGTSPARMAGNG TPGSSRGISPARMAGNG 1023 400
HLA-DQA1*01:03/DQB1*06:02 SRNSTPGSSRGTSPARMAGN SRNSTPGSSRGISPARMAGN 1103 432
HLA-DQA1*01:03/DQB1*06:02 SSRGTSPARMAGNGGD SSRGISPARMAGNGGD 967 379
HLA-DQA1*01:03/DQB1*06:02 SSRGTSPARMAGNGG SSRGISPARMAGNGG 803 315
HLA-DQA1*01:02/DQB1*06:02 PGSSRGTSPARMAGNGG PGSSRGISPARMAGNGG 947 374
HLA-DQA1*01:03/DQB1*06:02 GSSRGTSPARMAGNGGD GSSRGISPARMAGNGGD 1005 397
HLA-DQA1*01:03/DQB1*06:01 GTSPARMAGNGGDAA GISPARMAGNGGDAA 976 387
HLA-DQA1*05:01/DQB1*04:02 TPGSSRGTSPARMAG TPGSSRGISPARMAG 1029 409
HLA-DQA1*01:03/DQB1*06:02 PGSSRGTSPARMAGNGG PGSSRGISPARMAGNGG 1002 399
HLA-DQA1*01:02/DQB1*06:02 PGSSRGTSPARMAGNG PGSSRGISPARMAGNG 758 302
HLA-DQA1*01:03/DQB1*06:02 SRGTSPARMAGNGGD SRGISPARMAGNGGD 1215 485
HLA-DQA1*01:02/DQB1*06:02 TPGSSRGTSPARMAGNG TPGSSRGISPARMAGNG 915 367
HLA-DQA1*05:01/DQB1*03:01 SRGTSPARMAGNGGDA SRGISPARMAGNGGDA 587 237
HLA-DQA1*05:01/DQB1*03:19 SRGTSPARMAGNGGDA SRGISPARMAGNGGDA 587 237
HLA-DQA1*01:03/DQB1*06:02 GSSRGTSPARMAGNG GSSRGISPARMAGNG 705 285
HLA-DQA1*01:03/DQB1*06:01 RGTSPARMAGNGGDAA RGISPARMAGNGGDAA 771 317
HLA-DQA1*01:03/DQB1*06:02 STPGSSRGTSPARMAGN STPGSSRGISPARMAGN 1136 468
HLA-DQA1*01:03/DQB1*06:02 GSSRGTSPARMAGNGG GSSRGISPARMAGNGG 870 362
HLA-DQA1*05:01/DQB1*03:01 SRGTSPARMAGNGGD SRGISPARMAGNGGD 442 184
HLA-DQA1*05:01/DQB1*03:19 SRGTSPARMAGNGGD SRGISPARMAGNGGD 442 184
HLA-DQA1*01:02/DQB1*06:02 SRNSTPGSSRGTSPARMAGN SRNSTPGSSRGISPARMAGN 1006 423
HLA-DQA1*01:03/DQB1*06:01 RGTSPARMAGNGGDAAL RGISPARMAGNGGDAAL 737 311
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAA GISPARMAGNGGDAA 561 237
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAA GISPARMAGNGGDAA 561 237
HLA-DQA1*01:02/DQB1*06:02 PGSSRGTSPARMAGN PGSSRGISPARMAGN 777 329
HLA-DQA1*01:02/DQB1*06:01 RGTSPARMAGNGGDAAL RGISPARMAGNGGDAAL 745 318
HLA-DQA1*01:02/DQB1*06:01 GTSPARMAGNGGDAAL GISPARMAGNGGDAAL 972 420
HLA-DQA1*01:03/DQB1*06:02 PGSSRGTSPARMAGNG PGSSRGISPARMAGNG 822 359
HLA-DQA1*05:01/DQB1*03:01 SRGTSPARMAGNGGDAA SRGISPARMAGNGGDAA 689 301
HLA-DQA1*05:01/DQB1*03:19 SRGTSPARMAGNGGDAA SRGISPARMAGNGGDAA 689 301
HLA-DQA1*05:01/DQB1*03:01 RGTSPARMAGNGGDAAL RGISPARMAGNGGDAAL 836 367
HLA-DQA1*05:01/DQB1*03:19 RGTSPARMAGNGGDAAL RGISPARMAGNGGDAAL 836 367
HLA-DQA1*01:03/DQB1*06:02 PGSSRGTSPARMAGN PGSSRGISPARMAGN 749 330
HLA-DQA1*01:02/DQB1*06:02 STPGSSRGTSPARMAGN STPGSSRGISPARMAGN 1008 445
HLA-DQA1*01:03/DQB1*06:01 SRGTSPARMAGNGGDAA SRGISPARMAGNGGDAA 517 233
HLA-DQA1*01:03/DQB1*06:02 TPGSSRGTSPARMAGN TPGSSRGISPARMAGN 913 415
HLA-DQA1*01:02/DQB1*06:01 SRGTSPARMAGNGGD SRGISPARMAGNGGD 448 204
HLA-DQA1*01:02/DQB1*06:02 TPGSSRGTSPARMAGN TPGSSRGISPARMAGN 820 375
HLA-DQA1*05:01/DQB1*06:01 SRGTSPARMAGNGGD SRGISPARMAGNGGD 979 449
HLA-DQA1*05:01/DQB1*03:01 SSRGTSPARMAGNGGD SSRGISPARMAGNGGD 463 213
HLA-DQA1*05:01/DQB1*03:19 SSRGTSPARMAGNGGD SSRGISPARMAGNGGD 463 213
HLA-DQA1*01:03/DQB1*06:01 SRGTSPARMAGNGGD SRGISPARMAGNGGD 405 188
HLA-DQA1*05:01/DQB1*03:03 SRGTSPARMAGNGGD SRGISPARMAGNGGD 885 415
HLA-DQA1*05:01/DQB1*03:03 PGSSRGTSPARMAGNG PGSSRGISPARMAGNG 712 336
HLA-DQA1*01:03/DQB1*06:01 SRGTSPARMAGNGGDA SRGISPARMAGNGGDA 500 236
HLA-DQA1*05:01/DQB1*03:03 TPGSSRGTSPARMAGN TPGSSRGISPARMAGN 670 317
HLA-DQA1*05:01/DQB1*03:01 GTSPARMAGNGGDAAL GISPARMAGNGGDAAL 731 348
HLA-DQA1*05:01/DQB1*03:19 GTSPARMAGNGGDAAL GISPARMAGNGGDAAL 731 348
HLA-DQA1*01:02/DQB1*06:01 SRGTSPARMAGNGGDA SRGISPARMAGNGGDA 539 259
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDAA RGISPARMAGNGGDAA 484 233
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDAA RGISPARMAGNGGDAA 484 233
HLA-DQA1*05:01/DQB1*03:03 TPGSSRGTSPARMAGNGGD TPGSSRGISPARMAGNGGD 1001 482
HLA-DQA1*05:01/DQB1*03:03 NSTPGSSRGTSPARMAGNG NSTPGSSRGISPARMAGNG 887 429
HLA-DQA1*05:01/DQB1*03:03 GSSRGTSPARMAGNGG GSSRGISPARMAGNGG 711 344
HLA-DQA1*05:01/DQB1*03:03 STPGSSRGTSPARMAGNGG STPGSSRGISPARMAGNGG 934 452
HLA-DQA1*02:01/DQB1*03:01 RGTSPARMAGNGGDA RGISPARMAGNGGDA 436 211
HLA-DQA1*02:01/DQB1*03:19 RGTSPARMAGNGGDA RGISPARMAGNGGDA 436 211
HLA-DQA1*05:01/DQB1*03:01 GSSRGTSPARMAGNGGDAA GSSRGISPARMAGNGGDAA 690 334
HLA-DQA1*05:01/DQB1*03:19 GSSRGTSPARMAGNGGDAA GSSRGISPARMAGNGGDAA 690 334
HLA-DQA1*05:01/DQB1*03:01 SSRGTSPARMAGNGGDA SSRGISPARMAGNGGDA 593 290
HLA-DQA1*05:01/DQB1*03:19 SSRGTSPARMAGNGGDA SSRGISPARMAGNGGDA 593 290
HLA-DQA1*01:02/DQB1*06:01 SRGTSPARMAGNGGDAA SRGISPARMAGNGGDAA 528 259
HLA-DQA1*01:03/DQB1*06:01 STPGSSRGTSPARMAGNGGD STPGSSRGISPARMAGNGGD 318 156
HLA-DQA1*01:03/DQB1*06:01 GTSPARMAGNGGDAAL GISPARMAGNGGDAAL 853 419
HLA-DQA1*01:03/DQB1*06:01 NSTPGSSRGTSPARMAGNGG NSTPGSSRGISPARMAGNGG 323 159
HLA-DQA1*05:01/DQB1*03:01 SSRGTSPARMAGNGGDAAL SSRGISPARMAGNGGDAAL 719 354
HLA-DQA1*05:01/DQB1*03:19 SSRGTSPARMAGNGGDAAL SSRGISPARMAGNGGDAAL 719 354
HLA-DQA1*02:01/DQB1*03:01 GTSPARMAGNGGDAAL GISPARMAGNGGDAAL 495 244
HLA-DQA1*02:01/DQB1*03:19 GTSPARMAGNGGDAAL GISPARMAGNGGDAAL 495 244
HLA-DQA1*05:01/DQB1*03:01 SSRGTSPARMAGNGG SSRGISPARMAGNGG 332 164
HLA-DQA1*05:01/DQB1*03:19 SSRGTSPARMAGNGG SSRGISPARMAGNGG 332 164
HLA-DQA1*05:01/DQB1*03:03 SSRGTSPARMAGNGGD SSRGISPARMAGNGGD 826 409
HLA-DQA1*05:01/DQB1*03:03 GSSRGTSPARMAGNGGDAA GSSRGISPARMAGNGGDAA 1001 496
HLA-DQA1*05:01/DQB1*03:03 TPGSSRGTSPARMAGNG TPGSSRGISPARMAGNG 888 441
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGNGGDA PGSSRGISPARMAGNGGDA 652 326
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGNGGDA PGSSRGISPARMAGNGGDA 652 326

NS3 protein

NS3

Q57H

Reference  TATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCN
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TATIPIQASLPFGWLIVGVALLAVFHSASKIITLKKRWQLALSKGVHFVCN

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:01 IVGVALLAVFQSASK IVGVALLAVFHSASK 445 112
HLA-DRB1*11:01 VGVALLAVFQSASKII VGVALLAVFHSASKII 794 204
HLA-DRB1*11:01 VGVALLAVFQSASKI VGVALLAVFHSASKI 334 86
HLA-DRB1*11:01 IVGVALLAVFQSASKI IVGVALLAVFHSASKI 853 223
HLA-DRB1*11:01 GVALLAVFQSASKII GVALLAVFHSASKII 325 86
HLA-DRB1*11:01 LIVGVALLAVFQSASK LIVGVALLAVFHSASK 1141 316
HLA-DRB1*11:01 LIVGVALLAVFQSASKI LIVGVALLAVFHSASKI 567 170
HLA-DRB1*11:01 IVGVALLAVFQSASKII IVGVALLAVFHSASKII 505 153
HLA-DRB1*11:01 WLIVGVALLAVFQSASK WLIVGVALLAVFHSASK 755 240
HLA-DRB1*11:01 FGWLIVGVALLAVFQSASKI FGWLIVGVALLAVFHSASKI 1042 343
HLA-DRB1*11:04 VGVALLAVFQSASKII VGVALLAVFHSASKII 336 113
HLA-DRB1*11:01 GWLIVGVALLAVFQSASKII GWLIVGVALLAVFHSASKII 972 331
HLA-DRB1*11:04 LIVGVALLAVFQSAS LIVGVALLAVFHSAS 707 245
HLA-DRB1*01:01 LIVGVALLAVFQSAS LIVGVALLAVFHSAS 238 83
HLA-DRB1*11:01 WLIVGVALLAVFQSASKII WLIVGVALLAVFHSASKII 1372 479
HLA-DRB1*11:04 WLIVGVALLAVFQSASKII WLIVGVALLAVFHSASKII 785 275
HLA-DRB1*11:01 PFGWLIVGVALLAVFQSASK PFGWLIVGVALLAVFHSASK 1217 436
HLA-DRB1*11:04 IVGVALLAVFQSASKI IVGVALLAVFHSASKI 343 123
HLA-DRB1*01:01 WLIVGVALLAVFQSA WLIVGVALLAVFHSA 328 118
HLA-DRB1*11:04 GWLIVGVALLAVFQSASKII GWLIVGVALLAVFHSASKII 602 220
HLA-DRB1*11:04 GWLIVGVALLAVFQSASKI GWLIVGVALLAVFHSASKI 804 298
HLA-DRB1*01:01 LIVGVALLAVFQSASK LIVGVALLAVFHSASK 396 148
HLA-DRB1*11:04 IVGVALLAVFQSASKII IVGVALLAVFHSASKII 219 82
HLA-DQA1*05:01/DQB1*04:02 LIVGVALLAVFQSASKIITL LIVGVALLAVFHSASKIITL 1119 419
HLA-DRB1*11:04 LIVGVALLAVFQSASK LIVGVALLAVFHSASK 445 167
HLA-DRB1*11:04 FGWLIVGVALLAVFQSASKI FGWLIVGVALLAVFHSASKI 611 232
HLA-DRB1*07:01 VGVALLAVFQSASKI VGVALLAVFHSASKI 259 99
HLA-DRB1*11:04 WLIVGVALLAVFQSASK WLIVGVALLAVFHSASK 318 122
HLA-DRB1*07:01 IVGVALLAVFQSASKI IVGVALLAVFHSASKI 652 251
HLA-DQA1*05:01/DQB1*04:02 IVGVALLAVFQSASKIITLK IVGVALLAVFHSASKIITLK 757 296
HLA-DRB1*01:02 LIVGVALLAVFQSAS LIVGVALLAVFHSAS 716 280
HLA-DRB1*11:04 LIVGVALLAVFQSASKI LIVGVALLAVFHSASKI 230 90
HLA-DRB1*01:01 WLIVGVALLAVFQSAS WLIVGVALLAVFHSAS 687 272
HLA-DQA1*02:01/DQB1*04:02 GVALLAVFQSASKIIT GVALLAVFHSASKIIT 1216 482
HLA-DRB1*07:01 FGWLIVGVALLAVFQSASKI FGWLIVGVALLAVFHSASKI 677 269
HLA-DRB1*11:04 IVGVALLAVFQSASK IVGVALLAVFHSASK 140 56
HLA-DRB1*11:04 PFGWLIVGVALLAVFQSASK PFGWLIVGVALLAVFHSASK 740 296
HLA-DQA1*05:01/DQB1*04:02 WLIVGVALLAVFQSASKIIT WLIVGVALLAVFHSASKIIT 1211 485
HLA-DRB1*07:01 GWLIVGVALLAVFQSASKI GWLIVGVALLAVFHSASKI 941 380
HLA-DRB1*10:01 WLIVGVALLAVFQSA WLIVGVALLAVFHSA 260 106
HLA-DQA1*05:01/DQB1*04:02 GVALLAVFQSASKIITL GVALLAVFHSASKIITL 710 290
HLA-DQA1*02:01/DQB1*04:02 VALLAVFQSASKIITL VALLAVFHSASKIITL 979 400
HLA-DQA1*02:01/DQB1*04:02 ALLAVFQSASKIITL ALLAVFHSASKIITL 592 242
HLA-DRB1*11:04 FGWLIVGVALLAVFQSASK FGWLIVGVALLAVFHSASK 951 389
HLA-DQA1*05:01/DQB1*04:02 VGVALLAVFQSASKIITLK VGVALLAVFHSASKIITLK 879 360
HLA-DQA1*02:01/DQB1*04:02 IVGVALLAVFQSASKIITLK IVGVALLAVFHSASKIITLK 1126 470
HLA-DQA1*02:01/DQB1*04:02 VALLAVFQSASKIIT VALLAVFHSASKIIT 696 291
HLA-DRB1*01:02 IVGVALLAVFQSASK IVGVALLAVFHSASK 288 122
HLA-DRB1*11:04 VGVALLAVFQSASKI VGVALLAVFHSASKI 101 43
HLA-DRB1*07:01 LIVGVALLAVFQSASKIITL LIVGVALLAVFHSASKIITL 68 29
HLA-DRB1*07:01 LIVGVALLAVFQSASKI LIVGVALLAVFHSASKI 565 241
HLA-DQA1*05:01/DQB1*04:02 VALLAVFQSASKIITL VALLAVFHSASKIITL 615 265
HLA-DQA1*05:01/DQB1*04:02 VGVALLAVFQSASKIITLKK VGVALLAVFHSASKIITLKK 537 234
HLA-DQA1*02:01/DQB1*04:02 GVALLAVFQSASKIITL GVALLAVFHSASKIITL 1141 498
HLA-DRB1*01:01 IVGVALLAVFQSASK IVGVALLAVFHSASK 96 42
HLA-DRB1*08:04 LIVGVALLAVFQSAS LIVGVALLAVFHSAS 768 340
HLA-DRB1*10:01 LIVGVALLAVFQSAS LIVGVALLAVFHSAS 149 66
HLA-DRB1*11:04 VGVALLAVFQSASKIITL VGVALLAVFHSASKIITL 715 317
HLA-DRB1*07:01 IVGVALLAVFQSASKIITL IVGVALLAVFHSASKIITL 81 36
HLA-DRB1*01:02 LIVGVALLAVFQSASK LIVGVALLAVFHSASK 899 400
HLA-DQA1*05:01/DQB1*04:02 VGVALLAVFQSASKIIT VGVALLAVFHSASKIIT 793 353
HLA-DRB1*11:04 LIVGVALLAVFQSASKIITL LIVGVALLAVFHSASKIITL 321 143
HLA-DRB1*01:01 WLIVGVALLAVFQSASK WLIVGVALLAVFHSASK 240 107
HLA-DQA1*05:01/DQB1*04:02 GVALLAVFQSASKIIT GVALLAVFHSASKIIT 670 299
HLA-DRB1*11:04 IVGVALLAVFQSASKIIT IVGVALLAVFHSASKIIT 908 406
HLA-DQA1*02:01/DQB1*04:02 ALLAVFQSASKIITLK ALLAVFHSASKIITLK 715 324
HLA-DRB1*11:04 IVGVALLAVFQSASKIITL IVGVALLAVFHSASKIITL 386 175
HLA-DRB1*11:04 GVALLAVFQSASKII GVALLAVFHSASKII 97 44
HLA-DRB1*11:04 LIVGVALLAVFQSASKIIT LIVGVALLAVFHSASKIIT 461 210
HLA-DRB1*08:02 LIVGVALLAVFQSAS LIVGVALLAVFHSAS 1011 461
HLA-DRB1*01:01 GWLIVGVALLAVFQSAS GWLIVGVALLAVFHSAS 399 182
HLA-DRB1*10:01 GWLIVGVALLAVFQS GWLIVGVALLAVFHS 303 139
HLA-DQA1*05:01/DQB1*04:02 ALLAVFQSASKIITL ALLAVFHSASKIITL 340 156
HLA-DQA1*05:01/DQB1*04:02 GVALLAVFQSASKIITLKK GVALLAVFHSASKIITLKK 632 291
HLA-DRB1*08:04 LIVGVALLAVFQSASKIITL LIVGVALLAVFHSASKIITL 373 173
HLA-DQA1*02:01/DQB1*04:02 GVALLAVFQSASKII GVALLAVFHSASKII 895 417
HLA-DRB1*04:04 WLIVGVALLAVFQSA WLIVGVALLAVFHSA 420 197
HLA-DRB1*08:02 GWLIVGVALLAVFQSASKII GWLIVGVALLAVFHSASKII 624 293
HLA-DQA1*05:01/DQB1*04:02 ALLAVFQSASKIITLK ALLAVFHSASKIITLK 430 202
HLA-DRB1*01:02 WLIVGVALLAVFQSA WLIVGVALLAVFHSA 827 389
HLA-DRB1*11:04 WLIVGVALLAVFQSASKIIT WLIVGVALLAVFHSASKIIT 363 171
HLA-DRB1*11:01 LIVGVALLAVFQSASKIIT LIVGVALLAVFHSASKIIT 458 216
HLA-DRB1*07:01 VGVALLAVFQSASKIITL VGVALLAVFHSASKIITL 159 75
HLA-DQA1*02:01/DQB1*04:02 GVALLAVFQSASKIITLKK GVALLAVFHSASKIITLKK 985 465
HLA-DRB1*08:04 GWLIVGVALLAVFQSASKII GWLIVGVALLAVFHSASKII 542 256
HLA-DRB1*15:03 IVGVALLAVFQSASKIITL IVGVALLAVFHSASKIITL 602 286
HLA-DRB1*15:01 LIVGVALLAVFQSAS LIVGVALLAVFHSAS 826 393
HLA-DRB1*10:01 WLIVGVALLAVFQSAS WLIVGVALLAVFHSAS 298 142
HLA-DRB1*11:04 GVALLAVFQSASKIIT GVALLAVFHSASKIIT 197 94
HLA-DQA1*02:01/DQB1*04:02 VGVALLAVFQSASKIITLKK VGVALLAVFHSASKIITLKK 823 393
HLA-DQA1*05:01/DQB1*04:02 GVALLAVFQSASKIITLKKR GVALLAVFHSASKIITLKKR 437 209
HLA-DQA1*05:01/DQB1*04:02 VALLAVFQSASKIIT VALLAVFHSASKIIT 378 181
HLA-DRB1*11:04 VGVALLAVFQSASKIIT VGVALLAVFHSASKIIT 148 71
HLA-DQA1*02:01/DQB1*04:02 VALLAVFQSASKIITLK VALLAVFHSASKIITLK 884 425
HLA-DQA1*05:01/DQB1*04:02 VALLAVFQSASKIITLK VALLAVFHSASKIITLK 509 245
HLA-DRB1*08:04 WLIVGVALLAVFQSASKIIT WLIVGVALLAVFHSASKIIT 421 203
HLA-DRB1*10:01 GWLIVGVALLAVFQSAS GWLIVGVALLAVFHSAS 196 95
HLA-DQA1*05:01/DQB1*04:02 GVALLAVFQSASKII GVALLAVFHSASKII 528 256
HLA-DRB1*11:01 WLIVGVALLAVFQSASKIIT WLIVGVALLAVFHSASKIIT 313 153
HLA-DRB1*08:02 IVGVALLAVFQSASK IVGVALLAVFHSASK 353 173
HLA-DRB1*08:04 VGVALLAVFQSASKII VGVALLAVFHSASKII 366 180
HLA-DQA1*05:01/DQB1*04:02 VGVALLAVFQSASKII VGVALLAVFHSASKII 921 454
HLA-DRB1*15:03 WLIVGVALLAVFQSASKII WLIVGVALLAVFHSASKII 790 390
HLA-DRB1*07:01 LIVGVALLAVFQSASKII LIVGVALLAVFHSASKII 309 153
HLA-DRB1*08:02 FGWLIVGVALLAVFQSASKI FGWLIVGVALLAVFHSASKI 644 319
HLA-DRB1*11:04 IVGVALLAVFQSASKIITLK IVGVALLAVFHSASKIITLK 169 84
HLA-DRB1*07:01 GWLIVGVALLAVFQSASKII GWLIVGVALLAVFHSASKII 98 49
HLA-DRB1*15:03 LIVGVALLAVFQSASKIITL LIVGVALLAVFHSASKIITL 380 190

A99V

Reference  SKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRII
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SKGVHFVCNLLLLFVTVYSHLLLVAVGLEAPFLYLYALVYFLQSINFVRII

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*05:01/DQB1*03:01 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 214 1143
HLA-DQA1*05:01/DQB1*03:19 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 214 1143
HLA-DQA1*05:01/DQB1*03:01 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 179 918
HLA-DQA1*05:01/DQB1*03:19 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 179 918
HLA-DQA1*02:01/DQB1*03:01 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 112 560
HLA-DQA1*02:01/DQB1*03:19 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 112 560
HLA-DQA1*02:01/DQB1*03:01 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 96 478
HLA-DQA1*02:01/DQB1*03:19 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 96 478
HLA-DQA1*02:01/DQB1*03:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 89 431
HLA-DQA1*02:01/DQB1*03:19 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 89 431
HLA-DQA1*02:01/DQB1*03:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 98 469
HLA-DQA1*02:01/DQB1*03:19 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 98 469
HLA-DQA1*02:01/DQB1*03:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 205 980
HLA-DQA1*02:01/DQB1*03:19 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 205 980
HLA-DQA1*05:01/DQB1*03:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 177 846
HLA-DQA1*05:01/DQB1*03:19 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 177 846
HLA-DQA1*05:01/DQB1*03:01 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 216 1023
HLA-DQA1*05:01/DQB1*03:19 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 216 1023
HLA-DQA1*05:01/DQB1*03:01 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 245 1158
HLA-DQA1*05:01/DQB1*03:19 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 245 1158
HLA-DQA1*02:01/DQB1*03:01 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 109 514
HLA-DQA1*02:01/DQB1*03:19 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 109 514
HLA-DQA1*02:01/DQB1*03:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 199 921
HLA-DQA1*02:01/DQB1*03:19 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 199 921
HLA-DQA1*02:01/DQB1*03:01 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 206 936
HLA-DQA1*02:01/DQB1*03:19 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 206 936
HLA-DQA1*02:01/DQB1*03:01 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 227 1031
HLA-DQA1*02:01/DQB1*03:19 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 227 1031
HLA-DQA1*05:01/DQB1*03:01 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 302 1360
HLA-DQA1*05:01/DQB1*03:19 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 302 1360
HLA-DQA1*02:01/DQB1*03:01 HLLLVAAGLEAPFLYLYALV HLLLVAVGLEAPFLYLYALV 235 1058
HLA-DQA1*02:01/DQB1*03:19 HLLLVAAGLEAPFLYLYALV HLLLVAVGLEAPFLYLYALV 235 1058
HLA-DQA1*02:01/DQB1*03:01 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 120 539
HLA-DQA1*02:01/DQB1*03:19 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 120 539
HLA-DQA1*05:01/DQB1*03:01 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 316 1416
HLA-DQA1*05:01/DQB1*03:19 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 316 1416
HLA-DQA1*02:01/DQB1*03:01 YSHLLLVAAGLEAPFLYLYA YSHLLLVAVGLEAPFLYLYA 208 926
HLA-DQA1*02:01/DQB1*03:19 YSHLLLVAAGLEAPFLYLYA YSHLLLVAVGLEAPFLYLYA 208 926
HLA-DQA1*02:01/DQB1*03:01 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 126 557
HLA-DQA1*02:01/DQB1*03:19 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 126 557
HLA-DQA1*02:01/DQB1*03:01 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 246 1086
HLA-DQA1*02:01/DQB1*03:19 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 246 1086
HLA-DQA1*05:01/DQB1*03:01 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 252 1108
HLA-DQA1*05:01/DQB1*03:19 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 252 1108
HLA-DQA1*02:01/DQB1*03:01 SHLLLVAAGLEAPFLYLYAL SHLLLVAVGLEAPFLYLYAL 216 949
HLA-DQA1*02:01/DQB1*03:19 SHLLLVAAGLEAPFLYLYAL SHLLLVAVGLEAPFLYLYAL 216 949
HLA-DQA1*05:01/DQB1*03:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 212 930
HLA-DQA1*05:01/DQB1*03:19 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 212 930
HLA-DQA1*02:01/DQB1*03:01 YSHLLLVAAGLEAPFLYL YSHLLLVAVGLEAPFLYL 306 1308
HLA-DQA1*02:01/DQB1*03:19 YSHLLLVAAGLEAPFLYL YSHLLLVAVGLEAPFLYL 306 1308
HLA-DQA1*02:01/DQB1*03:01 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 151 640
HLA-DQA1*02:01/DQB1*03:19 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 151 640
HLA-DQA1*05:01/DQB1*03:01 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 310 1302
HLA-DQA1*05:01/DQB1*03:19 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 310 1302
HLA-DQA1*02:01/DQB1*03:01 YSHLLLVAAGLEAPFLYLY YSHLLLVAVGLEAPFLYLY 245 1024
HLA-DQA1*02:01/DQB1*03:19 YSHLLLVAAGLEAPFLYLY YSHLLLVAVGLEAPFLYLY 245 1024
HLA-DQA1*05:01/DQB1*03:01 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 212 885
HLA-DQA1*05:01/DQB1*03:19 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 212 885
HLA-DQA1*02:01/DQB1*03:01 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 107 443
HLA-DQA1*02:01/DQB1*03:19 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 107 443
HLA-DQA1*02:01/DQB1*03:01 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 242 996
HLA-DQA1*02:01/DQB1*03:19 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 242 996
HLA-DQA1*02:01/DQB1*03:01 LLLVAAGLEAPFLYLYALVY LLLVAVGLEAPFLYLYALVY 275 1131
HLA-DQA1*02:01/DQB1*03:19 LLLVAAGLEAPFLYLYALVY LLLVAVGLEAPFLYLYALVY 275 1131
HLA-DQA1*05:01/DQB1*03:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 439 1797
HLA-DQA1*05:01/DQB1*03:19 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 439 1797
HLA-DQA1*02:01/DQB1*03:01 HLLLVAAGLEAPFLYLYAL HLLLVAVGLEAPFLYLYAL 271 1103
HLA-DQA1*02:01/DQB1*03:19 HLLLVAAGLEAPFLYLYAL HLLLVAVGLEAPFLYLYAL 271 1103
HLA-DQA1*03:01/DQB1*03:01 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 436 1762
HLA-DQA1*03:01/DQB1*03:19 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 436 1762
HLA-DQA1*02:01/DQB1*03:01 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 154 620
HLA-DQA1*02:01/DQB1*03:19 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 154 620
HLA-DQA1*02:01/DQB1*03:01 SHLLLVAAGLEAPFLYLY SHLLLVAVGLEAPFLYLY 318 1280
HLA-DQA1*02:01/DQB1*03:19 SHLLLVAAGLEAPFLYLY SHLLLVAVGLEAPFLYLY 318 1280
HLA-DQA1*02:01/DQB1*03:01 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 278 1117
HLA-DQA1*02:01/DQB1*03:19 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 278 1117
HLA-DQA1*02:01/DQB1*03:01 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 149 598
HLA-DQA1*02:01/DQB1*03:19 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 149 598
HLA-DQA1*02:01/DQB1*03:01 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 284 1139
HLA-DQA1*02:01/DQB1*03:19 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 284 1139
HLA-DQA1*02:01/DQB1*03:01 SHLLLVAAGLEAPFLYLYA SHLLLVAVGLEAPFLYLYA 255 1017
HLA-DQA1*02:01/DQB1*03:19 SHLLLVAAGLEAPFLYLYA SHLLLVAVGLEAPFLYLYA 255 1017
HLA-DQA1*02:01/DQB1*03:01 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 122 486
HLA-DQA1*02:01/DQB1*03:19 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 122 486
HLA-DQA1*05:01/DQB1*03:01 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 368 1463
HLA-DQA1*05:01/DQB1*03:19 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 368 1463
HLA-DQA1*02:01/DQB1*03:01 HLLLVAAGLEAPFLYLYA HLLLVAVGLEAPFLYLYA 339 1340
HLA-DQA1*02:01/DQB1*03:19 HLLLVAAGLEAPFLYLYA HLLLVAVGLEAPFLYLYA 339 1340
HLA-DQA1*05:01/DQB1*03:01 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 442 1741
HLA-DQA1*05:01/DQB1*03:19 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 442 1741
HLA-DQA1*02:01/DQB1*03:01 VYSHLLLVAAGLEAPFLY VYSHLLLVAVGLEAPFLY 314 1232
HLA-DQA1*02:01/DQB1*03:19 VYSHLLLVAAGLEAPFLY VYSHLLLVAVGLEAPFLY 314 1232
HLA-DQA1*02:01/DQB1*03:01 LLVAAGLEAPFLYLYA LLVAVGLEAPFLYLYA 137 537
HLA-DQA1*02:01/DQB1*03:19 LLVAAGLEAPFLYLYA LLVAVGLEAPFLYLYA 137 537
HLA-DQA1*05:01/DQB1*03:01 LLVAAGLEAPFLYLYA LLVAVGLEAPFLYLYA 285 1114
HLA-DQA1*05:01/DQB1*03:19 LLVAAGLEAPFLYLYA LLVAVGLEAPFLYLYA 285 1114
HLA-DQA1*05:01/DQB1*03:01 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 373 1436
HLA-DQA1*05:01/DQB1*03:19 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 373 1436
HLA-DQA1*05:01/DQB1*03:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 320 1228
HLA-DQA1*05:01/DQB1*03:19 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 320 1228
HLA-DQA1*06:01/DQB1*03:01 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 264 1011
HLA-DQA1*06:01/DQB1*03:19 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 264 1011
HLA-DQA1*02:01/DQB1*03:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 146 555
HLA-DQA1*02:01/DQB1*03:19 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 146 555
HLA-DQA1*05:01/DQB1*03:01 YSHLLLVAAGLEAPFLYLYA YSHLLLVAVGLEAPFLYLYA 447 1696
HLA-DQA1*05:01/DQB1*03:19 YSHLLLVAAGLEAPFLYLYA YSHLLLVAVGLEAPFLYLYA 447 1696
HLA-DQA1*02:01/DQB1*03:01 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 176 667
HLA-DQA1*02:01/DQB1*03:19 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 176 667
HLA-DQA1*02:01/DQB1*03:01 LLVAAGLEAPFLYLYALVYF LLVAVGLEAPFLYLYALVYF 304 1151
HLA-DQA1*02:01/DQB1*03:19 LLVAAGLEAPFLYLYALVYF LLVAVGLEAPFLYLYALVYF 304 1151
HLA-DQA1*03:01/DQB1*03:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 403 1523
HLA-DQA1*03:01/DQB1*03:19 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 403 1523
HLA-DQA1*05:01/DQB1*03:01 SHLLLVAAGLEAPFLYLYAL SHLLLVAVGLEAPFLYLYAL 471 1774
HLA-DQA1*05:01/DQB1*03:19 SHLLLVAAGLEAPFLYLYAL SHLLLVAVGLEAPFLYLYAL 471 1774
HLA-DQA1*06:01/DQB1*03:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 281 1054
HLA-DQA1*06:01/DQB1*03:19 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 281 1054
HLA-DQA1*02:01/DQB1*03:01 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 170 636
HLA-DQA1*02:01/DQB1*03:19 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 170 636
HLA-DQA1*02:01/DQB1*03:01 LLLVAAGLEAPFLYLYALV LLLVAVGLEAPFLYLYALV 315 1174
HLA-DQA1*02:01/DQB1*03:19 LLLVAAGLEAPFLYLYALV LLLVAVGLEAPFLYLYALV 315 1174
HLA-DQA1*02:01/DQB1*03:01 LLLVAAGLEAPFLYLYAL LLLVAVGLEAPFLYLYAL 389 1446
HLA-DQA1*02:01/DQB1*03:19 LLLVAAGLEAPFLYLYAL LLLVAVGLEAPFLYLYAL 389 1446
HLA-DQA1*05:01/DQB1*03:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 438 1628
HLA-DQA1*05:01/DQB1*03:19 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 438 1628
HLA-DQA1*03:01/DQB1*03:01 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 460 1691
HLA-DQA1*03:01/DQB1*03:19 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 460 1691
HLA-DQA1*06:01/DQB1*03:01 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 281 1032
HLA-DQA1*06:01/DQB1*03:19 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 281 1032
HLA-DQA1*06:01/DQB1*03:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 255 931
HLA-DQA1*06:01/DQB1*03:19 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 255 931
HLA-DQA1*05:01/DQB1*03:01 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 272 989
HLA-DQA1*05:01/DQB1*03:19 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 272 989
HLA-DQA1*02:01/DQB1*03:01 TVYSHLLLVAAGLEAPFL TVYSHLLLVAVGLEAPFL 366 1328
HLA-DQA1*02:01/DQB1*03:19 TVYSHLLLVAAGLEAPFL TVYSHLLLVAVGLEAPFL 366 1328
HLA-DQA1*06:01/DQB1*03:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 500 1784
HLA-DQA1*06:01/DQB1*03:19 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 500 1784
HLA-DQA1*06:01/DQB1*03:01 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 487 1735
HLA-DQA1*06:01/DQB1*03:19 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 487 1735
HLA-DQA1*02:01/DQB1*03:01 FVTVYSHLLLVAAGLEAPF FVTVYSHLLLVAVGLEAPF 360 1278
HLA-DQA1*02:01/DQB1*03:19 FVTVYSHLLLVAAGLEAPF FVTVYSHLLLVAVGLEAPF 360 1278
HLA-DQA1*06:01/DQB1*03:01 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 305 1068
HLA-DQA1*06:01/DQB1*03:19 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 305 1068
HLA-DQA1*06:01/DQB1*03:01 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 380 1321
HLA-DQA1*06:01/DQB1*03:19 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 380 1321
HLA-DQA1*06:01/DQB1*03:01 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 314 1085
HLA-DQA1*06:01/DQB1*03:19 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 314 1085
HLA-DQA1*06:01/DQB1*03:01 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 283 970
HLA-DQA1*06:01/DQB1*03:19 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 283 970
HLA-DQA1*05:01/DQB1*03:01 LLVAAGLEAPFLYLYAL LLVAVGLEAPFLYLYAL 440 1502
HLA-DQA1*05:01/DQB1*03:19 LLVAAGLEAPFLYLYAL LLVAVGLEAPFLYLYAL 440 1502
HLA-DQA1*03:01/DQB1*03:01 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 441 1502
HLA-DQA1*03:01/DQB1*03:19 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 441 1502
HLA-DQA1*02:01/DQB1*03:01 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 207 702
HLA-DQA1*02:01/DQB1*03:19 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 207 702
HLA-DQA1*06:01/DQB1*03:01 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 398 1340
HLA-DQA1*06:01/DQB1*03:19 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 398 1340
HLA-DQA1*03:01/DQB1*03:01 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 489 1644
HLA-DQA1*03:01/DQB1*03:19 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 489 1644
HLA-DQA1*03:01/DQB1*03:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 446 1491
HLA-DQA1*03:01/DQB1*03:19 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 446 1491
HLA-DQA1*06:01/DQB1*03:01 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 388 1288
HLA-DQA1*06:01/DQB1*03:19 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 388 1288
HLA-DQA1*06:01/DQB1*03:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 500 1653
HLA-DQA1*06:01/DQB1*03:19 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 500 1653
HLA-DQA1*02:01/DQB1*03:01 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 154 506
HLA-DQA1*02:01/DQB1*03:19 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 154 506
HLA-DQA1*02:01/DQB1*03:01 LLVAAGLEAPFLYLYALV LLVAVGLEAPFLYLYALV 445 1460
HLA-DQA1*02:01/DQB1*03:19 LLVAAGLEAPFLYLYALV LLVAVGLEAPFLYLYALV 445 1460
HLA-DQA1*03:01/DQB1*03:01 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 461 1508
HLA-DQA1*03:01/DQB1*03:19 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 461 1508
HLA-DQA1*06:01/DQB1*03:01 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 418 1367
HLA-DQA1*06:01/DQB1*03:19 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 418 1367
HLA-DQA1*02:01/DQB1*03:01 VTVYSHLLLVAAGLEAPF VTVYSHLLLVAVGLEAPF 466 1518
HLA-DQA1*02:01/DQB1*03:19 VTVYSHLLLVAAGLEAPF VTVYSHLLLVAVGLEAPF 466 1518
HLA-DQA1*02:01/DQB1*03:01 LLVAAGLEAPFLYLYALVY LLVAVGLEAPFLYLYALVY 359 1168
HLA-DQA1*02:01/DQB1*03:19 LLVAAGLEAPFLYLYALVY LLVAVGLEAPFLYLYALVY 359 1168
HLA-DQA1*06:01/DQB1*03:01 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 337 1094
HLA-DQA1*06:01/DQB1*03:19 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 337 1094
HLA-DQA1*05:01/DQB1*03:01 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 475 1541
HLA-DQA1*05:01/DQB1*03:19 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 475 1541
HLA-DQA1*06:01/DQB1*03:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 335 1078
HLA-DQA1*06:01/DQB1*03:19 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 335 1078
HLA-DQA1*02:01/DQB1*03:01 LLVAAGLEAPFLYLYAL LLVAVGLEAPFLYLYAL 204 651
HLA-DQA1*02:01/DQB1*03:19 LLVAAGLEAPFLYLYAL LLVAVGLEAPFLYLYAL 204 651
HLA-DRB1*11:02 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 1389 436
HLA-DRB1*13:01 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 1389 436
HLA-DQA1*06:01/DQB1*03:01 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 453 1433
HLA-DQA1*06:01/DQB1*03:19 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 453 1433
HLA-DQA1*06:01/DQB1*03:01 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 319 1005
HLA-DQA1*06:01/DQB1*03:19 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 319 1005
HLA-DQA1*05:01/DQB1*03:01 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 312 974
HLA-DQA1*05:01/DQB1*03:19 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 312 974
HLA-DQA1*03:01/DQB1*03:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 467 1421
HLA-DQA1*03:01/DQB1*03:19 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 467 1421
HLA-DQA1*02:01/DQB1*03:01 LVAAGLEAPFLYLYAL LVAVGLEAPFLYLYAL 198 595
HLA-DQA1*02:01/DQB1*03:19 LVAAGLEAPFLYLYAL LVAVGLEAPFLYLYAL 198 595
HLA-DQA1*06:01/DQB1*03:01 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 471 1408
HLA-DQA1*06:01/DQB1*03:19 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 471 1408
HLA-DQA1*06:01/DQB1*03:01 LLVAAGLEAPFLYLYA LLVAVGLEAPFLYLYA 369 1095
HLA-DQA1*06:01/DQB1*03:19 LLVAAGLEAPFLYLYA LLVAVGLEAPFLYLYA 369 1095
HLA-DQA1*02:01/DQB1*03:01 LVAAGLEAPFLYLYALVYFL LVAVGLEAPFLYLYALVYFL 393 1154
HLA-DQA1*02:01/DQB1*03:19 LVAAGLEAPFLYLYALVYFL LVAVGLEAPFLYLYALVYFL 393 1154
HLA-DQA1*05:01/DQB1*03:01 LVAAGLEAPFLYLYAL LVAVGLEAPFLYLYAL 422 1228
HLA-DQA1*05:01/DQB1*03:19 LVAAGLEAPFLYLYAL LVAVGLEAPFLYLYAL 422 1228
HLA-DQA1*03:01/DQB1*03:01 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 481 1391
HLA-DQA1*03:01/DQB1*03:19 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 481 1391
HLA-DQA1*04:01/DQB1*03:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 297 851
HLA-DQA1*04:01/DQB1*03:19 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 297 851
HLA-DQA1*04:01/DQB1*03:01 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 280 798
HLA-DQA1*04:01/DQB1*03:19 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 280 798
HLA-DQA1*02:01/DQB1*03:01 VYSHLLLVAAGLEAP VYSHLLLVAVGLEAP 277 780
HLA-DQA1*02:01/DQB1*03:19 VYSHLLLVAAGLEAP VYSHLLLVAVGLEAP 277 780
HLA-DQA1*04:01/DQB1*03:01 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 325 913
HLA-DQA1*04:01/DQB1*03:19 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 325 913
HLA-DQA1*04:01/DQB1*03:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 322 902
HLA-DQA1*04:01/DQB1*03:19 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 322 902
HLA-DQA1*04:01/DQB1*03:01 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 496 1386
HLA-DQA1*04:01/DQB1*03:19 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 496 1386
HLA-DQA1*04:01/DQB1*03:01 YSHLLLVAAGLEAPFLYL YSHLLLVAVGLEAPFLYL 481 1335
HLA-DQA1*04:01/DQB1*03:19 YSHLLLVAAGLEAPFLYL YSHLLLVAVGLEAPFLYL 481 1335
HLA-DQA1*02:01/DQB1*03:01 TVYSHLLLVAAGLEAP TVYSHLLLVAVGLEAP 297 814
HLA-DQA1*02:01/DQB1*03:19 TVYSHLLLVAAGLEAP TVYSHLLLVAVGLEAP 297 814
HLA-DQA1*04:01/DQB1*03:01 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 352 963
HLA-DQA1*04:01/DQB1*03:19 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 352 963
HLA-DQA1*05:01/DQB1*03:03 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 455 1241
HLA-DQA1*05:01/DQB1*03:03 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 462 1256
HLA-DQA1*04:01/DQB1*03:01 VYSHLLLVAAGLEAPFLY VYSHLLLVAVGLEAPFLY 486 1320
HLA-DQA1*04:01/DQB1*03:19 VYSHLLLVAAGLEAPFLY VYSHLLLVAVGLEAPFLY 486 1320
HLA-DQA1*04:01/DQB1*03:01 YSHLLLVAAGLEAPFLYLY YSHLLLVAVGLEAPFLYLY 492 1336
HLA-DQA1*04:01/DQB1*03:19 YSHLLLVAAGLEAPFLYLY YSHLLLVAVGLEAPFLYLY 492 1336
HLA-DQA1*04:01/DQB1*03:01 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 273 737
HLA-DQA1*04:01/DQB1*03:19 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 273 737
HLA-DQA1*04:01/DQB1*03:01 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 372 989
HLA-DQA1*04:01/DQB1*03:19 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 372 989
HLA-DQA1*04:01/DQB1*03:01 SHLLLVAAGLEAPFLYLY SHLLLVAVGLEAPFLYLY 488 1297
HLA-DQA1*04:01/DQB1*03:19 SHLLLVAAGLEAPFLYLY SHLLLVAVGLEAPFLYLY 488 1297
HLA-DQA1*05:01/DQB1*03:03 YSHLLLVAAGLEAPFLYLYA YSHLLLVAVGLEAPFLYLYA 451 1194
HLA-DQA1*04:01/DQB1*03:01 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 349 921
HLA-DQA1*04:01/DQB1*03:19 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 349 921
HLA-DQA1*05:01/DQB1*04:02 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 383 1002
HLA-DQA1*04:01/DQB1*03:01 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 294 766
HLA-DQA1*04:01/DQB1*03:19 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 294 766
HLA-DQA1*02:01/DQB1*03:03 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 393 1021
HLA-DQA1*04:01/DQB1*03:01 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 320 831
HLA-DQA1*04:01/DQB1*03:19 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 320 831
HLA-DQA1*06:01/DQB1*03:01 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 463 1202
HLA-DQA1*06:01/DQB1*03:19 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 463 1202
HLA-DQA1*05:01/DQB1*03:03 SHLLLVAAGLEAPFLYLYAL SHLLLVAVGLEAPFLYLYAL 481 1241
HLA-DQA1*04:01/DQB1*03:01 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 497 1280
HLA-DQA1*04:01/DQB1*03:19 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 497 1280
HLA-DQA1*01:02/DQB1*06:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 285 733
HLA-DQA1*01:02/DQB1*06:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 298 762
HLA-DQA1*05:01/DQB1*03:03 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 467 1192
HLA-DQA1*02:01/DQB1*03:03 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 394 1004
HLA-DQA1*02:01/DQB1*03:03 YSHLLLVAAGLEAPFLYLYA YSHLLLVAVGLEAPFLYLYA 394 1003
HLA-DQA1*02:01/DQB1*03:01 LVAAGLEAPFLYLYALV LVAVGLEAPFLYLYALV 300 763
HLA-DQA1*02:01/DQB1*03:19 LVAAGLEAPFLYLYALV LVAVGLEAPFLYLYALV 300 763
HLA-DQA1*02:01/DQB1*03:01 VTVYSHLLLVAAGLEAP VTVYSHLLLVAVGLEAP 424 1073
HLA-DQA1*02:01/DQB1*03:19 VTVYSHLLLVAAGLEAP VTVYSHLLLVAVGLEAP 424 1073
HLA-DQA1*01:03/DQB1*06:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 283 709
HLA-DQA1*05:01/DQB1*03:03 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 487 1219
HLA-DQA1*04:01/DQB1*03:01 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 392 972
HLA-DQA1*04:01/DQB1*03:19 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 392 972
HLA-DQA1*01:03/DQB1*06:01 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 402 993
HLA-DQA1*01:02/DQB1*06:01 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 342 843
HLA-DQA1*02:01/DQB1*03:03 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 446 1099
HLA-DQA1*01:03/DQB1*06:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 313 766
HLA-DQA1*01:02/DQB1*06:01 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 324 790
HLA-DQA1*01:03/DQB1*06:01 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 359 875
HLA-DQA1*01:03/DQB1*06:01 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 345 839
HLA-DQA1*05:01/DQB1*03:03 YSHLLLVAAGLEAPFLYLY YSHLLLVAVGLEAPFLYLY 489 1186
HLA-DQA1*02:01/DQB1*03:03 SHLLLVAAGLEAPFLYLYAL SHLLLVAVGLEAPFLYLYAL 433 1050
HLA-DQA1*01:02/DQB1*06:01 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 345 833
HLA-DQA1*04:01/DQB1*03:01 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 384 927
HLA-DQA1*04:01/DQB1*03:19 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 384 927
HLA-DQA1*05:01/DQB1*03:03 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 487 1170
HLA-DQA1*01:02/DQB1*06:01 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 310 744
HLA-DQA1*02:01/DQB1*03:03 YSHLLLVAAGLEAPFLYLY YSHLLLVAVGLEAPFLYLY 444 1064
HLA-DRB1*01:01 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 53 127
HLA-DQA1*04:01/DQB1*03:01 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 442 1058
HLA-DQA1*04:01/DQB1*03:19 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 442 1058
HLA-DQA1*04:01/DQB1*03:01 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 383 916
HLA-DQA1*04:01/DQB1*03:19 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 383 916
HLA-DQA1*05:01/DQB1*03:03 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 284 678
HLA-DQA1*02:01/DQB1*03:03 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 401 956
HLA-DRB1*01:01 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 60 142
HLA-DQA1*04:01/DQB1*03:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 346 817
HLA-DQA1*04:01/DQB1*03:19 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 346 817
HLA-DQA1*01:02/DQB1*06:01 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 382 901
HLA-DQA1*02:01/DQB1*03:03 HLLLVAAGLEAPFLYLYALV HLLLVAVGLEAPFLYLYALV 485 1143
HLA-DQA1*01:03/DQB1*06:01 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 399 937
HLA-DQA1*05:01/DQB1*04:02 VYSHLLLVAAGLEAP VYSHLLLVAVGLEAP 423 991
HLA-DQA1*01:02/DQB1*06:02 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 439 1028
HLA-DQA1*01:03/DQB1*06:01 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 334 781
HLA-DQA1*01:02/DQB1*06:02 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 436 1018
HLA-DQA1*01:02/DQB1*06:02 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 466 1088
HLA-DPA1*04:01/DPB1*03:01 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 272 635
HLA-DQA1*01:02/DQB1*06:02 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 451 1052
HLA-DQA1*01:02/DQB1*06:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 329 767
HLA-DQA1*02:01/DQB1*03:03 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 262 609
HLA-DQA1*01:02/DQB1*06:02 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 390 905
HLA-DPA1*04:01/DPB1*03:01 FVTVYSHLLLVAAGLEAPF FVTVYSHLLLVAVGLEAPF 364 844
HLA-DRB1*10:01 VTVYSHLLLVAAGLEAPF VTVYSHLLLVAVGLEAPF 135 311
HLA-DPA1*04:01/DPB1*03:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 270 622
HLA-DQA1*01:03/DQB1*06:01 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 432 994
HLA-DQA1*05:01/DQB1*03:03 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 306 704
HLA-DRB1*01:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 60 138
HLA-DPA1*04:01/DPB1*03:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 269 618
HLA-DQA1*05:01/DQB1*03:03 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 360 826
HLA-DQA1*01:02/DQB1*06:02 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 471 1079
HLA-DQA1*01:03/DQB1*06:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 403 923
HLA-DQA1*05:01/DQB1*03:03 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 328 750
HLA-DRB1*01:01 LLFVTVYSHLLLVAAGLEAP LLFVTVYSHLLLVAVGLEAP 53 121
HLA-DRB1*01:02 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 558 245
HLA-DQA1*02:01/DQB1*03:03 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 446 1015
HLA-DPA1*04:01/DPB1*03:01 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 270 614
HLA-DRB1*10:01 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 66 150
HLA-DQA1*02:01/DQB1*03:03 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 430 977
HLA-DQA1*01:03/DQB1*03:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 490 1109
HLA-DQA1*01:03/DQB1*03:19 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 490 1109
HLA-DQA1*05:01/DQB1*03:03 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 259 586
HLA-DQA1*01:02/DQB1*06:01 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 347 784
HLA-DRB1*01:02 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 347 783
HLA-DQA1*01:02/DQB1*06:02 FVTVYSHLLLVAAGLEAPF FVTVYSHLLLVAVGLEAPF 449 1009
HLA-DQA1*05:01/DQB1*03:03 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 374 840
HLA-DQA1*05:01/DQB1*03:03 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 256 574
HLA-DQA1*01:02/DQB1*06:02 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 293 656
HLA-DQA1*01:02/DQB1*06:02 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 477 1067
HLA-DQA1*02:01/DQB1*03:03 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 475 1061
HLA-DQA1*05:01/DQB1*04:02 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 412 920
HLA-DRB1*10:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 69 154
HLA-DPA1*04:01/DPB1*03:01 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 371 828
HLA-DRB1*10:01 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 62 138
HLA-DRB1*10:01 LLLFVTVYSHLLLVAAGLEA LLLFVTVYSHLLLVAVGLEA 93 207
HLA-DQA1*02:01/DQB1*03:03 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 223 496
HLA-DQA1*05:01/DQB1*03:03 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 407 905
HLA-DQA1*05:01/DQB1*03:03 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 379 841
HLA-DQA1*01:02/DQB1*06:01 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 339 752
HLA-DPA1*04:01/DPB1*14:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 266 590
HLA-DQA1*04:01/DQB1*03:01 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 453 1003
HLA-DQA1*04:01/DQB1*03:19 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 453 1003
HLA-DQA1*04:01/DQB1*03:01 LLVAAGLEAPFLYLYA LLVAVGLEAPFLYLYA 382 845
HLA-DQA1*04:01/DQB1*03:19 LLVAAGLEAPFLYLYA LLVAVGLEAPFLYLYA 382 845
HLA-DQA1*01:02/DQB1*06:02 VTVYSHLLLVAAGLEAPF VTVYSHLLLVAVGLEAPF 483 1067
HLA-DPA1*04:01/DPB1*03:01 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 293 647
HLA-DPA1*04:01/DPB1*14:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 267 587
HLA-DQA1*01:02/DQB1*06:02 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 301 661
HLA-DQA1*01:02/DQB1*06:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 441 966
HLA-DQA1*01:03/DQB1*06:02 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 462 1010
HLA-DQA1*05:01/DQB1*03:03 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 355 776
HLA-DQA1*01:02/DQB1*06:02 LLLVAAGLEAPFLYL LLLVAVGLEAPFLYL 448 979
HLA-DQA1*01:02/DQB1*06:01 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 376 821
HLA-DPA1*04:01/DPB1*14:01 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 360 786
HLA-DQA1*01:02/DQB1*06:02 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 324 707
HLA-DRB1*01:02 LLFVTVYSHLLLVAAGLEAP LLFVTVYSHLLLVAVGLEAP 380 829
HLA-DRB1*10:01 TVYSHLLLVAAGLEAPFL TVYSHLLLVAVGLEAPFL 145 316
HLA-DQA1*02:01/DQB1*03:03 SHLLLVAAGLEAPFLYLYA SHLLLVAVGLEAPFLYLYA 483 1052
HLA-DQA1*01:02/DQB1*06:01 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 354 771
HLA-DQA1*01:02/DQB1*06:02 FVTVYSHLLLVAAGLE FVTVYSHLLLVAVGLE 362 788
HLA-DPA1*04:01/DPB1*14:01 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 269 585
HLA-DQA1*01:02/DQB1*06:02 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 268 582
HLA-DQA1*01:02/DQB1*06:01 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 327 710
HLA-DRB1*10:01 LLFVTVYSHLLLVAAGLEAP LLFVTVYSHLLLVAVGLEAP 65 141
HLA-DRB1*10:01 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 78 169
HLA-DQA1*01:03/DQB1*06:02 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 436 943
HLA-DQA1*05:01/DQB1*03:03 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 302 653
HLA-DQA1*02:01/DQB1*03:03 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 262 566
HLA-DPA1*04:01/DPB1*14:01 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 280 604
HLA-DPA1*04:01/DPB1*14:01 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 353 760
HLA-DQA1*01:03/DQB1*06:02 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 393 846
HLA-DQA1*02:01/DQB1*03:03 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 309 664
HLA-DRB1*10:01 FVTVYSHLLLVAAGLEAPF FVTVYSHLLLVAVGLEAPF 74 159
HLA-DQA1*01:03/DQB1*06:01 SHLLLVAAGLEAPFLYL SHLLLVAVGLEAPFLYL 391 840
HLA-DQA1*05:01/DQB1*03:03 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 314 674
HLA-DQA1*01:02/DQB1*06:02 FVTVYSHLLLVAAGL FVTVYSHLLLVAVGL 396 850
HLA-DQA1*02:01/DQB1*03:03 LFVTVYSHLLLVAAGLEAPF LFVTVYSHLLLVAVGLEAPF 494 1060
HLA-DRB1*01:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 62 133
HLA-DQA1*01:02/DQB1*06:02 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 243 521
HLA-DRB1*10:01 LLLLFVTVYSHLLLVAAGLE LLLLFVTVYSHLLLVAVGLE 121 259
HLA-DPA1*04:01/DPB1*03:01 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 358 765
HLA-DPA1*04:01/DPB1*03:01 LLFVTVYSHLLLVAAGLEAP LLFVTVYSHLLLVAVGLEAP 300 641
HLA-DQA1*01:03/DQB1*06:02 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 461 985
HLA-DQA1*02:01/DQB1*03:03 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 230 491
HLA-DPA1*04:01/DPB1*14:01 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 384 817
HLA-DQA1*02:01/DQB1*03:03 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 291 619
HLA-DQA1*05:01/DQB1*03:03 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 333 708
HLA-DQA1*01:02/DQB1*06:02 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 303 644
HLA-DQA1*01:02/DQB1*06:01 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 434 922
HLA-DRB1*01:01 LLLFVTVYSHLLLVAAGLEA LLLFVTVYSHLLLVAVGLEA 82 174
HLA-DQA1*01:02/DQB1*06:02 FVTVYSHLLLVAAGLEA FVTVYSHLLLVAVGLEA 307 651
HLA-DQA1*01:02/DQB1*06:02 LFVTVYSHLLLVAAGLE LFVTVYSHLLLVAVGLE 371 786
HLA-DPA1*04:01/DPB1*03:01 LFVTVYSHLLLVAAGLEAP LFVTVYSHLLLVAVGLEAP 406 860
HLA-DQA1*01:03/DQB1*06:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 419 887
HLA-DQA1*01:02/DQB1*06:02 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 351 743
HLA-DRB1*10:01 VTVYSHLLLVAAGLEA VTVYSHLLLVAVGLEA 60 127
HLA-DQA1*01:03/DQB1*06:01 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 398 841
HLA-DPA1*04:01/DPB1*14:01 VYSHLLLVAAGLEAPFLYLY VYSHLLLVAVGLEAPFLYLY 292 617
HLA-DRB1*01:02 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 337 712
HLA-DRB1*10:01 VTVYSHLLLVAAGLE VTVYSHLLLVAVGLE 36 76
HLA-DRB1*10:01 FVTVYSHLLLVAAGLEAP FVTVYSHLLLVAVGLEAP 145 306
HLA-DQA1*02:01/DQB1*03:01 TVYSHLLLVAAGLEA TVYSHLLLVAVGLEA 479 1009
HLA-DQA1*02:01/DQB1*03:19 TVYSHLLLVAAGLEA TVYSHLLLVAVGLEA 479 1009
HLA-DPA1*04:01/DPB1*03:01 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 394 829
HLA-DQA1*02:01/DQB1*03:03 HLLLVAAGLEAPFLYL HLLLVAVGLEAPFLYL 282 592
HLA-DQA1*05:01/DQB1*03:03 LLLVAAGLEAPFLYLYA LLLVAVGLEAPFLYLYA 483 1013
HLA-DRB1*10:01 LFVTVYSHLLLVAAGLEA LFVTVYSHLLLVAVGLEA 175 367
HLA-DRB1*01:02 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 320 671
HLA-DRB1*10:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 73 153
HLA-DRB1*10:01 FVTVYSHLLLVAAGLE FVTVYSHLLLVAVGLE 76 159
HLA-DPA1*04:01/DPB1*03:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 274 573
HLA-DQA1*01:02/DQB1*06:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 414 865
HLA-DQA1*01:02/DQB1*06:02 VTVYSHLLLVAAGLEA VTVYSHLLLVAVGLEA 318 664
HLA-DQA1*01:02/DQB1*06:01 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 368 768
HLA-DQA1*02:01/DQB1*03:03 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 291 607
HLA-DPA1*04:01/DPB1*03:01 VTVYSHLLLVAAGLEA VTVYSHLLLVAVGLEA 327 681
HLA-DQA1*02:01/DQB1*03:03 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 308 641
HLA-DRB1*15:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 226 470
HLA-DQA1*02:01/DQB1*03:03 SHLLLVAAGLEAPFLY SHLLLVAVGLEAPFLY 260 540
HLA-DQA1*02:01/DQB1*03:01 VAAGLEAPFLYLYAL VAVGLEAPFLYLYAL 392 813
HLA-DQA1*02:01/DQB1*03:19 VAAGLEAPFLYLYAL VAVGLEAPFLYLYAL 392 813
HLA-DQA1*01:03/DQB1*06:01 LLVAAGLEAPFLYLY LLVAVGLEAPFLYLY 402 833
HLA-DRB1*10:01 TVYSHLLLVAAGLEA TVYSHLLLVAVGLEA 29 60
HLA-DQA1*05:01/DQB1*04:02 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 431 891
HLA-DRB1*10:01 FVTVYSHLLLVAAGLEA FVTVYSHLLLVAVGLEA 46 95
HLA-DQA1*02:01/DQB1*03:03 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 345 712
HLA-DRB1*01:02 VAAGLEAPFLYLYAL VAVGLEAPFLYLYAL 751 364
HLA-DPA1*04:01/DPB1*14:01 FVTVYSHLLLVAAGLEAPF FVTVYSHLLLVAVGLEAPF 369 761
HLA-DQA1*01:02/DQB1*06:02 VTVYSHLLLVAAGLE VTVYSHLLLVAVGLE 307 633
HLA-DQA1*01:03/DQB1*06:02 YSHLLLVAAGLEAPF YSHLLLVAVGLEAPF 374 771
HLA-DQA1*01:02/DQB1*06:01 SHLLLVAAGLEAPFLYLYAL SHLLLVAVGLEAPFLYLYAL 433 891
HLA-DQA1*01:03/DQB1*06:01 YSHLLLVAAGLEAPFLY YSHLLLVAVGLEAPFLY 364 748
HLA-DQA1*01:02/DQB1*06:02 HLLLVAAGLEAPFLYLY HLLLVAVGLEAPFLYLY 456 937
HLA-DQA1*04:01/DQB1*06:01 HLLLVAAGLEAPFLY HLLLVAVGLEAPFLY 499 1025
HLA-DQA1*01:02/DQB1*06:01 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 400 821
HLA-DQA1*01:03/DQB1*06:01 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 369 756
HLA-DQA1*02:01/DQB1*03:03 LLLVAAGLEAPFLYLY LLLVAVGLEAPFLYLY 325 665
HLA-DRB1*01:02 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 220 450
HLA-DRB1*01:02 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 317 648
HLA-DRB1*10:01 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 48 98
HLA-DQA1*01:03/DQB1*06:01 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 384 781
HLA-DQA1*02:01/DQB1*03:02 VYSHLLLVAAGLEAPFLYL VYSHLLLVAVGLEAPFLYL 470 955
HLA-DRB1*10:01 LLFVTVYSHLLLVAAGLEA LLFVTVYSHLLLVAVGLEA 104 211
HLA-DQA1*05:01/DQB1*03:02 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 416 843
HLA-DPA1*03:01/DPB1*14:01 FVTVYSHLLLVAAGLEAPFL FVTVYSHLLLVAVGLEAPFL 472 956
HLA-DPA1*04:01/DPB1*03:01 LLLFVTVYSHLLLVAAGLEA LLLFVTVYSHLLLVAVGLEA 434 879
HLA-DRB1*01:01 FVTVYSHLLLVAAGLEAPF FVTVYSHLLLVAVGLEAPF 80 162
HLA-DRB1*01:01 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 85 172
HLA-DPA1*04:01/DPB1*03:01 SHLLLVAAGLEAPFL SHLLLVAVGLEAPFL 318 642
HLA-DRB1*15:01 LVAAGLEAPFLYLYA LVAVGLEAPFLYLYA 858 425
HLA-DPA1*04:01/DPB1*03:01 YSHLLLVAAGLEAPFL YSHLLLVAVGLEAPFL 273 551
HLA-DQA1*01:03/DQB1*06:01 VTVYSHLLLVAAGLEAPFLY VTVYSHLLLVAVGLEAPFLY 386 779
HLA-DQA1*01:02/DQB1*06:01 YSHLLLVAAGLEAPFLYLYA YSHLLLVAVGLEAPFLYLYA 419 845
HLA-DRB1*10:01 TVYSHLLLVAAGLEAPFLY TVYSHLLLVAVGLEAPFLY 83 167
HLA-DQA1*01:03/DQB1*06:02 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 469 942
HLA-DQA1*05:01/DQB1*02:01 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 361 725
HLA-DQA1*05:01/DQB1*02:02 VTVYSHLLLVAAGLEAPFL VTVYSHLLLVAVGLEAPFL 361 725
HLA-DQA1*02:01/DQB1*03:03 VYSHLLLVAAGLEAPF VYSHLLLVAVGLEAPF 272 545
HLA-DPA1*04:01/DPB1*06:01 TVYSHLLLVAAGLEAPFLYL TVYSHLLLVAVGLEAPFLYL 308 617
HLA-DRB1*10:01 TVYSHLLLVAAGLEAPF TVYSHLLLVAVGLEAPF 35 70
HLA-DRB1*10:01 VTVYSHLLLVAAGLEAP VTVYSHLLLVAVGLEAP 36 72
HLA-DRB1*10:01 VYSHLLLVAAGLEAPFL VYSHLLLVAVGLEAPFL 42 84
HLA-DQA1*01:02/DQB1*06:02 TVYSHLLLVAAGLEA TVYSHLLLVAVGLEA 279 558

NS9c protein

NS9c

L52F

Reference  VKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           ||||||||||||||||||||||||| |||||||||||||||||||||
Mutated    VKPLLVPHHVVATVQEIQLQAAVGEFLLLEWLAMAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*01:01 IQLQAAVGELLLLEWL IQLQAAVGEFLLLEWL 100 327
HLA-DRB1*01:01 EIQLQAAVGELLLLEW EIQLQAAVGEFLLLEW 53 157
HLA-DRB1*01:01 IQLQAAVGELLLLEWLA IQLQAAVGEFLLLEWLA 96 283
HLA-DRB1*01:01 EIQLQAAVGELLLLEWL EIQLQAAVGEFLLLEWL 51 142
HLA-DRB1*01:01 IQLQAAVGELLLLEW IQLQAAVGEFLLLEW 25 69
HLA-DRB1*07:01 EIQLQAAVGELLLLEW EIQLQAAVGEFLLLEW 207 566
HLA-DRB1*07:01 QEIQLQAAVGELLLLE QEIQLQAAVGEFLLLE 179 489
HLA-DRB1*13:02 IQLQAAVGELLLLEW IQLQAAVGEFLLLEW 435 1187
HLA-DRB1*01:01 QLQAAVGELLLLEWLA QLQAAVGEFLLLEWLA 198 539
HLA-DRB1*01:01 EIQLQAAVGELLLLEWLAM EIQLQAAVGEFLLLEWLAM 154 419
HLA-DRB1*01:01 QEIQLQAAVGELLLLEWLA QEIQLQAAVGEFLLLEWLA 126 335
HLA-DRB1*13:02 EIQLQAAVGELLLLE EIQLQAAVGEFLLLE 211 560
HLA-DRB1*07:01 IQLQAAVGELLLLEW IQLQAAVGEFLLLEW 131 347
HLA-DRB1*01:01 EIQLQAAVGELLLLEWLA EIQLQAAVGEFLLLEWLA 372 974
HLA-DRB1*01:01 QEIQLQAAVGELLLLE QEIQLQAAVGEFLLLE 49 128
HLA-DRB1*07:01 IQLQAAVGELLLLEWL IQLQAAVGEFLLLEWL 384 1000
HLA-DRB1*07:01 QEIQLQAAVGELLLL QEIQLQAAVGEFLLL 84 217
HLA-DRB1*07:01 VQEIQLQAAVGELLLL VQEIQLQAAVGEFLLL 216 556
HLA-DRB1*07:01 EIQLQAAVGELLLLEWL EIQLQAAVGEFLLLEWL 199 510
HLA-DRB1*07:01 QEIQLQAAVGELLLLEW QEIQLQAAVGEFLLLEW 173 442
HLA-DRB1*07:01 TVQEIQLQAAVGELLL TVQEIQLQAAVGEFLL 192 488
HLA-DRB1*01:01 QEIQLQAAVGELLLLEW QEIQLQAAVGEFLLLEW 45 114
HLA-DRB1*07:01 EIQLQAAVGELLLLE EIQLQAAVGEFLLLE 75 189
HLA-DPA1*01:03/DPB1*02:01 QAAVGELLLLEWLAM QAAVGEFLLLEWLAM 444 177
HLA-DRB1*07:01 VQEIQLQAAVGELLLLE VQEIQLQAAVGEFLLLE 156 391
HLA-DRB1*01:02 IQLQAAVGELLLLEWL IQLQAAVGEFLLLEWL 360 898
HLA-DRB1*01:01 QLQAAVGELLLLEWL QLQAAVGEFLLLEWL 47 117
HLA-DRB1*07:01 ATVQEIQLQAAVGELLLLE ATVQEIQLQAAVGEFLLLE 368 916
HLA-DRB1*07:01 QEIQLQAAVGELLLLEWLA QEIQLQAAVGEFLLLEWLA 467 1153
HLA-DRB1*07:01 IQLQAAVGELLLLEWLA IQLQAAVGEFLLLEWLA 359 886
HLA-DRB1*07:01 TVQEIQLQAAVGELLLLEW TVQEIQLQAAVGEFLLLEW 389 950
HLA-DRB1*01:01 VQEIQLQAAVGELLLLEWL VQEIQLQAAVGEFLLLEWL 110 268
HLA-DRB1*07:01 VQEIQLQAAVGELLLLEWL VQEIQLQAAVGEFLLLEWL 419 1019
HLA-DRB1*01:01 QEIQLQAAVGELLLLEWL QEIQLQAAVGEFLLLEWL 314 761
HLA-DRB1*13:02 EIQLQAAVGELLLLEW EIQLQAAVGEFLLLEW 498 1200
HLA-DRB1*01:02 IQLQAAVGELLLLEW IQLQAAVGEFLLLEW 94 226
HLA-DRB1*07:01 VVATVQEIQLQAAVGELLL VVATVQEIQLQAAVGEFLL 433 1041
HLA-DRB1*01:01 EIQLQAAVGELLLLEWLAMA EIQLQAAVGEFLLLEWLAMA 125 299
HLA-DRB1*01:01 QEIQLQAAVGELLLL QEIQLQAAVGEFLLL 18 43
HLA-DRB1*07:01 EIQLQAAVGELLLLEWLAMA EIQLQAAVGEFLLLEWLAMA 476 1133
HLA-DRB1*07:01 VQEIQLQAAVGELLLLEWLA VQEIQLQAAVGEFLLLEWLA 354 842
HLA-DRB1*07:01 TVQEIQLQAAVGELLLLEWL TVQEIQLQAAVGEFLLLEWL 329 782
HLA-DPA1*04:01/DPB1*02:01 QAAVGELLLLEWLAM QAAVGEFLLLEWLAM 361 152
HLA-DRB1*01:01 VQEIQLQAAVGELLLLE VQEIQLQAAVGEFLLLE 43 102
HLA-DRB1*01:01 VQEIQLQAAVGELLLL VQEIQLQAAVGEFLLL 63 149
HLA-DRB1*07:01 VATVQEIQLQAAVGELLLLE VATVQEIQLQAAVGEFLLLE 299 707
HLA-DRB1*07:01 VQEIQLQAAVGELLL VQEIQLQAAVGEFLL 75 177
HLA-DRB1*07:01 ATVQEIQLQAAVGELLLLEW ATVQEIQLQAAVGEFLLLEW 310 730
HLA-DRB1*07:01 TVQEIQLQAAVGELLLL TVQEIQLQAAVGEFLLL 192 451
HLA-DRB1*07:01 ATVQEIQLQAAVGELLL ATVQEIQLQAAVGEFLL 183 429
HLA-DRB1*07:01 QEIQLQAAVGELLLLEWLAM QEIQLQAAVGEFLLLEWLAM 398 932
HLA-DRB1*01:02 EIQLQAAVGELLLLEW EIQLQAAVGEFLLLEW 185 432
HLA-DRB1*01:01 QEIQLQAAVGELLLLEWLAM QEIQLQAAVGEFLLLEWLAM 95 221
HLA-DRB1*01:01 TVQEIQLQAAVGELLLLEW TVQEIQLQAAVGEFLLLEW 107 247
HLA-DRB1*07:01 HVVATVQEIQLQAAVGELLL HVVATVQEIQLQAAVGEFLL 342 789
HLA-DRB1*01:02 IQLQAAVGELLLLEWLA IQLQAAVGEFLLLEWLA 359 808
HLA-DRB1*01:01 EIQLQAAVGELLLLE EIQLQAAVGEFLLLE 16 36
HLA-DRB1*01:01 VQEIQLQAAVGELLLLEW VQEIQLQAAVGEFLLLEW 282 634
HLA-DRB1*01:02 EIQLQAAVGELLLLEWL EIQLQAAVGEFLLLEWL 184 413
HLA-DRB1*01:01 VQEIQLQAAVGELLLLEWLA VQEIQLQAAVGEFLLLEWLA 79 177
HLA-DRB1*01:02 QLQAAVGELLLLEWL QLQAAVGEFLLLEWL 178 397
HLA-DRB1*01:01 ATVQEIQLQAAVGELLLLE ATVQEIQLQAAVGEFLLLE 108 240
HLA-DRB1*07:01 VATVQEIQLQAAVGELLLL VATVQEIQLQAAVGEFLLL 488 1080
HLA-DRB1*07:01 QLQAAVGELLLLEWL QLQAAVGEFLLLEWL 229 506
HLA-DRB1*01:01 TVQEIQLQAAVGELLLLE TVQEIQLQAAVGEFLLLE 282 610
HLA-DRB1*13:02 QEIQLQAAVGELLLL QEIQLQAAVGEFLLL 210 453
HLA-DRB1*01:01 TVQEIQLQAAVGELLLL TVQEIQLQAAVGEFLLL 56 120
HLA-DRB1*01:01 TVQEIQLQAAVGELLLLEWL TVQEIQLQAAVGEFLLLEWL 73 156
HLA-DRB1*01:01 TVQEIQLQAAVGELLL TVQEIQLQAAVGEFLL 76 162
HLA-DPA1*01:03/DPB1*04:01 IQLQAAVGELLLLEW IQLQAAVGEFLLLEW 395 186
HLA-DRB1*07:01 ATVQEIQLQAAVGELL ATVQEIQLQAAVGEFL 254 537
HLA-DRB1*01:01 IQLQAAVGELLLLEWLAMA IQLQAAVGEFLLLEWLAMA 326 687
HLA-DPA1*01:03/DPB1*02:01 QAAVGELLLLEWLAMA QAAVGEFLLLEWLAMA 482 229
HLA-DRB1*01:02 EIQLQAAVGELLLLEWLAM EIQLQAAVGEFLLLEWLAM 494 1034
HLA-DRB1*13:02 QEIQLQAAVGELLLLE QEIQLQAAVGEFLLLE 396 824
HLA-DRB1*01:02 EIQLQAAVGELLLLE EIQLQAAVGEFLLLE 54 112
HLA-DRB1*07:01 VVATVQEIQLQAAVGELLLL VVATVQEIQLQAAVGEFLLL 409 847
HLA-DRB1*01:01 ATVQEIQLQAAVGELLLLEW ATVQEIQLQAAVGEFLLLEW 71 147
HLA-DPA1*01:03/DPB1*04:01 AVGELLLLEWLAMAV AVGEFLLLEWLAMAV 552 267
HLA-DPA1*01:03/DPB1*04:01 QLQAAVGELLLLEWLAM QLQAAVGEFLLLEWLAM 387 188
HLA-DPA1*01:03/DPB1*02:01 LQAAVGELLLLEWLAM LQAAVGEFLLLEWLAM 622 303
HLA-DRB1*07:01 HHVVATVQEIQLQAAVGELL HHVVATVQEIQLQAAVGEFL 363 745
HLA-DPA1*01:03/DPB1*04:01 VGELLLLEWLAMAVM VGEFLLLEWLAMAVM 712 347
HLA-DRB1*07:01 VATVQEIQLQAAVGELL VATVQEIQLQAAVGEFL 249 510
HLA-DPA1*01:03/DPB1*02:01 IQLQAAVGELLLLEW IQLQAAVGEFLLLEW 412 204
HLA-DPA1*01:03/DPB1*02:01 QLQAAVGELLLLEWL QLQAAVGEFLLLEWL 468 232
HLA-DPA1*01:03/DPB1*02:01 LQAAVGELLLLEWLAMA LQAAVGEFLLLEWLAMA 405 201
HLA-DRB1*07:01 TVQEIQLQAAVGELL TVQEIQLQAAVGEFL 96 193
HLA-DRB1*01:02 QEIQLQAAVGELLLLE QEIQLQAAVGEFLLLE 160 321
HLA-DPA1*01:03/DPB1*02:01 AAVGELLLLEWLAMA AAVGEFLLLEWLAMA 363 181

NSP2 protein

NSP2

T85I

Reference  WYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEK
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    WYTERSEKSYELQTPFEIKLAKKFDIFNGECPNFVFPLNSIIKTIQPRVEK

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*14:01 FEIKLAKKFDTFNGECPNF FEIKLAKKFDIFNGECPNF 613 123
HLA-DRB1*14:01 EIKLAKKFDTFNGECP EIKLAKKFDIFNGECP 1030 209
HLA-DRB1*14:01 EIKLAKKFDTFNGECPN EIKLAKKFDIFNGECPN 984 203
HLA-DRB1*14:01 FEIKLAKKFDTFNGECPN FEIKLAKKFDIFNGECPN 1320 275
HLA-DRB1*14:01 EIKLAKKFDTFNGEC EIKLAKKFDIFNGEC 403 84
HLA-DRB1*14:01 PFEIKLAKKFDTFNGECPNF PFEIKLAKKFDIFNGECPNF 358 75
HLA-DRB1*14:01 FEIKLAKKFDTFNGECPNFV FEIKLAKKFDIFNGECPNFV 501 105
HLA-DRB1*14:01 FEIKLAKKFDTFNGECP FEIKLAKKFDIFNGECP 396 85
HLA-DRB1*14:01 FEIKLAKKFDTFNGEC FEIKLAKKFDIFNGEC 437 95
HLA-DRB1*14:01 PFEIKLAKKFDTFNGECPN PFEIKLAKKFDIFNGECPN 453 99
HLA-DRB1*14:01 TPFEIKLAKKFDTFNGECPN TPFEIKLAKKFDIFNGECPN 311 68
HLA-DRB1*14:01 EIKLAKKFDTFNGECPNFV EIKLAKKFDIFNGECPNFV 1421 317
HLA-DRB1*14:01 TPFEIKLAKKFDTFNGECP TPFEIKLAKKFDIFNGECP 397 90
HLA-DRB1*14:01 LQTPFEIKLAKKFDTFNGEC LQTPFEIKLAKKFDIFNGEC 269 61
HLA-DRB1*14:01 QTPFEIKLAKKFDTFNGECP QTPFEIKLAKKFDIFNGECP 281 64
HLA-DRB1*14:01 QTPFEIKLAKKFDTFNGEC QTPFEIKLAKKFDIFNGEC 371 86
HLA-DRB1*14:01 LQTPFEIKLAKKFDTFNGE LQTPFEIKLAKKFDIFNGE 354 83
HLA-DRB1*14:01 PFEIKLAKKFDTFNGECP PFEIKLAKKFDIFNGECP 1044 245
HLA-DRB1*14:01 ELQTPFEIKLAKKFDTFNGE ELQTPFEIKLAKKFDIFNGE 255 60
HLA-DRB1*14:01 EIKLAKKFDTFNGECPNFVF EIKLAKKFDIFNGECPNFVF 1108 261
HLA-DRB1*14:01 ELQTPFEIKLAKKFDTFNG ELQTPFEIKLAKKFDIFNG 343 82
HLA-DRB1*14:01 PFEIKLAKKFDTFNGEC PFEIKLAKKFDIFNGEC 346 83
HLA-DRB1*14:04 FEIKLAKKFDTFNGEC FEIKLAKKFDIFNGEC 658 159
HLA-DRB1*14:01 YELQTPFEIKLAKKFDTFN YELQTPFEIKLAKKFDIFN 289 70
HLA-DRB1*14:01 SYELQTPFEIKLAKKFDTF SYELQTPFEIKLAKKFDIF 312 76
HLA-DRB1*14:01 YELQTPFEIKLAKKFDTFNG YELQTPFEIKLAKKFDIFNG 242 59
HLA-DRB1*14:01 SYELQTPFEIKLAKKFDTFN SYELQTPFEIKLAKKFDIFN 221 54
HLA-DRB1*14:01 TPFEIKLAKKFDTFNGEC TPFEIKLAKKFDIFNGEC 930 229
HLA-DRB1*14:04 EIKLAKKFDTFNGEC EIKLAKKFDIFNGEC 666 164
HLA-DRB1*14:01 ELQTPFEIKLAKKFDTFN ELQTPFEIKLAKKFDIFN 726 180
HLA-DRB1*14:01 YELQTPFEIKLAKKFDTF YELQTPFEIKLAKKFDIF 726 181
HLA-DRB1*14:01 QTPFEIKLAKKFDTFNGE QTPFEIKLAKKFDIFNGE 866 219
HLA-DRB1*14:01 FEIKLAKKFDTFNGE FEIKLAKKFDIFNGE 170 43
HLA-DRB1*14:01 TPFEIKLAKKFDTFNGE TPFEIKLAKKFDIFNGE 316 80
HLA-DRB1*14:04 FEIKLAKKFDTFNGE FEIKLAKKFDIFNGE 316 80
HLA-DRB1*07:01 EIKLAKKFDTFNGEC EIKLAKKFDIFNGEC 1289 327
HLA-DRB1*14:01 ELQTPFEIKLAKKFDTF ELQTPFEIKLAKKFDIF 240 61
HLA-DRB1*14:01 LQTPFEIKLAKKFDTFN LQTPFEIKLAKKFDIFN 247 63
HLA-DRB1*14:04 FEIKLAKKFDTFNGECP FEIKLAKKFDIFNGECP 645 165
HLA-DRB1*14:04 EIKLAKKFDTFNGECP EIKLAKKFDIFNGECP 1325 339
HLA-DRB1*14:01 LQTPFEIKLAKKFDTFNG LQTPFEIKLAKKFDIFNG 834 215
HLA-DRB1*14:01 KSYELQTPFEIKLAKKFDTF KSYELQTPFEIKLAKKFDIF 244 63
HLA-DRB1*14:01 IKLAKKFDTFNGECP IKLAKKFDIFNGECP 1754 453
HLA-DRB1*14:01 QTPFEIKLAKKFDTFNG QTPFEIKLAKKFDIFNG 301 78
HLA-DRB1*14:01 LQTPFEIKLAKKFDTF LQTPFEIKLAKKFDIF 270 70
HLA-DRB1*14:01 PFEIKLAKKFDTFNGE PFEIKLAKKFDIFNGE 374 97
HLA-DRB1*14:04 PFEIKLAKKFDTFNGECPN PFEIKLAKKFDIFNGECPN 676 176
HLA-DRB1*14:04 FEIKLAKKFDTFNGECPNF FEIKLAKKFDIFNGECPNF 880 230
HLA-DRB1*14:01 YELQTPFEIKLAKKFDT YELQTPFEIKLAKKFDI 437 115
HLA-DRB1*14:01 ELQTPFEIKLAKKFDT ELQTPFEIKLAKKFDI 480 127
HLA-DRB1*14:04 FEIKLAKKFDTFNGECPN FEIKLAKKFDIFNGECPN 1653 441
HLA-DRB1*14:01 QTPFEIKLAKKFDTFN QTPFEIKLAKKFDIFN 281 75
HLA-DRB1*14:04 FEIKLAKKFDTFNGECPNFV FEIKLAKKFDIFNGECPNFV 696 186
HLA-DRB1*14:04 TPFEIKLAKKFDTFNGECP TPFEIKLAKKFDIFNGECP 593 159
HLA-DRB1*14:04 LQTPFEIKLAKKFDTF LQTPFEIKLAKKFDIF 413 111
HLA-DRB1*14:04 PFEIKLAKKFDTFNGECPNF PFEIKLAKKFDIFNGECPNF 531 143
HLA-DRB1*14:04 ELQTPFEIKLAKKFDTF ELQTPFEIKLAKKFDIF 404 110
HLA-DRB1*14:01 TPFEIKLAKKFDTFNG TPFEIKLAKKFDIFNG 345 94
HLA-DRB1*14:04 PFEIKLAKKFDTFNGEC PFEIKLAKKFDIFNGEC 546 149
HLA-DRB1*14:04 PFEIKLAKKFDTFNGE PFEIKLAKKFDIFNGE 538 147
HLA-DRB1*14:04 QTPFEIKLAKKFDTFN QTPFEIKLAKKFDIFN 419 115
HLA-DRB1*14:04 QTPFEIKLAKKFDTFNGEC QTPFEIKLAKKFDIFNGEC 546 150
HLA-DRB1*14:04 LQTPFEIKLAKKFDTFN LQTPFEIKLAKKFDIFN 406 112
HLA-DRB1*14:04 LQTPFEIKLAKKFDTFNGE LQTPFEIKLAKKFDIFNGE 524 145
HLA-DRB1*14:01 LQTPFEIKLAKKFDT LQTPFEIKLAKKFDI 195 54
HLA-DRB1*14:04 ELQTPFEIKLAKKFDTFNG ELQTPFEIKLAKKFDIFNG 512 142
HLA-DRB1*14:04 ELQTPFEIKLAKKFDT ELQTPFEIKLAKKFDI 659 183
HLA-DRB1*14:04 EIKLAKKFDTFNGECPN EIKLAKKFDIFNGECPN 1303 362
HLA-DRB1*14:04 LQTPFEIKLAKKFDT LQTPFEIKLAKKFDI 330 92
HLA-DRB1*14:04 YELQTPFEIKLAKKFDTFN YELQTPFEIKLAKKFDIFN 448 125
HLA-DRB1*14:04 PFEIKLAKKFDTFNG PFEIKLAKKFDIFNG 272 76
HLA-DRB1*14:04 TPFEIKLAKKFDTFNGECPN TPFEIKLAKKFDIFNGECPN 454 127
HLA-DRB1*14:04 TPFEIKLAKKFDTFN TPFEIKLAKKFDIFN 221 62
HLA-DRB1*14:04 QTPFEIKLAKKFDTF QTPFEIKLAKKFDIF 210 59
HLA-DRB1*14:04 PFEIKLAKKFDTFNGECP PFEIKLAKKFDIFNGECP 1340 378
HLA-DRB1*14:04 ELQTPFEIKLAKKFDTFN ELQTPFEIKLAKKFDIFN 966 273
HLA-DRB1*14:04 TPFEIKLAKKFDTFNGE TPFEIKLAKKFDIFNGE 491 139
HLA-DRB1*14:04 TPFEIKLAKKFDTFNG TPFEIKLAKKFDIFNG 490 139
HLA-DRB1*14:04 YELQTPFEIKLAKKFDTF YELQTPFEIKLAKKFDIF 963 274
HLA-DRB1*14:01 PFEIKLAKKFDTFNG PFEIKLAKKFDIFNG 161 46
HLA-DRB1*14:04 QTPFEIKLAKKFDTFNGECP QTPFEIKLAKKFDIFNGECP 412 118
HLA-DRB1*14:04 QTPFEIKLAKKFDTFNG QTPFEIKLAKKFDIFNG 464 133
HLA-DRB1*14:04 YELQTPFEIKLAKKFDT YELQTPFEIKLAKKFDI 660 190
HLA-DRB1*14:04 LQTPFEIKLAKKFDTFNGEC LQTPFEIKLAKKFDIFNGEC 394 114
HLA-DRB1*14:04 TPFEIKLAKKFDTFNGEC TPFEIKLAKKFDIFNGEC 1191 345
HLA-DRB1*14:01 KSYELQTPFEIKLAKKFDT KSYELQTPFEIKLAKKFDI 541 157
HLA-DRB1*14:04 SYELQTPFEIKLAKKFDTF SYELQTPFEIKLAKKFDIF 467 136
HLA-DRB1*14:04 ELQTPFEIKLAKKFDTFNGE ELQTPFEIKLAKKFDIFNGE 381 111
HLA-DRB1*14:01 EKSYELQTPFEIKLAKKFDT EKSYELQTPFEIKLAKKFDI 434 127
HLA-DRB1*14:01 SYELQTPFEIKLAKKFDT SYELQTPFEIKLAKKFDI 1312 385
HLA-DRB1*14:04 QTPFEIKLAKKFDTFNGE QTPFEIKLAKKFDIFNGE 1093 324
HLA-DRB1*14:01 QTPFEIKLAKKFDTF QTPFEIKLAKKFDIF 114 34
HLA-DRB1*14:01 TPFEIKLAKKFDTFN TPFEIKLAKKFDIFN 124 37
HLA-DRB1*14:04 LQTPFEIKLAKKFDTFNG LQTPFEIKLAKKFDIFNG 1053 315
HLA-DRB1*14:04 EIKLAKKFDTFNGECPNFV EIKLAKKFDIFNGECPNFV 1574 472
HLA-DRB1*14:04 EIKLAKKFDTFNGECPNFVF EIKLAKKFDIFNGECPNFVF 1302 393
HLA-DRB1*07:01 FEIKLAKKFDTFNGEC FEIKLAKKFDIFNGEC 1161 351
HLA-DRB1*14:04 YELQTPFEIKLAKKFDTFNG YELQTPFEIKLAKKFDIFNG 358 109
HLA-DRB1*14:04 SYELQTPFEIKLAKKFDTFN SYELQTPFEIKLAKKFDIFN 328 100
HLA-DRB1*07:01 FEIKLAKKFDTFNGECP FEIKLAKKFDIFNGECP 1088 337
HLA-DRB1*07:01 FEIKLAKKFDTFNGE FEIKLAKKFDIFNGE 498 156
HLA-DRB1*13:02 EIKLAKKFDTFNGEC EIKLAKKFDIFNGEC 925 291
HLA-DRB1*07:01 PFEIKLAKKFDTFNG PFEIKLAKKFDIFNG 374 121
HLA-DRB1*07:01 PFEIKLAKKFDTFNGE PFEIKLAKKFDIFNGE 885 292
HLA-DRB1*14:04 SYELQTPFEIKLAKKFDT SYELQTPFEIKLAKKFDI 1486 494
HLA-DRB1*07:01 PFEIKLAKKFDTFNGECPN PFEIKLAKKFDIFNGECPN 1179 392
HLA-DRB1*14:04 KSYELQTPFEIKLAKKFDTF KSYELQTPFEIKLAKKFDIF 333 112