Summary

This strain contains 18 protein-level mutations:

  • 9 mutations in Spike protein: D80A, D215G, LLA 241-243 deletion, A260X, K417N, E484K, N501Y, D614G, A701V
  • 1 mutation in N protein: T205I
  • 1 mutation in E protein: P71L
  • 2 mutations in NS3 protein: Q57H, S171L
  • 1 mutation in NS9c protein: L52F
  • 1 mutation in NSP2 protein: T85I
  • 1 mutation in NSP3 protein: K837N
  • 1 mutation in NSP6 protein: SGF 106-108 deletion
  • 1 mutation in NSP12 protein: P323L

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

D80A

Reference  FLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWI
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    FLPFFSNVTWFHAIHVSGTNGTKRFANPVLPFNDGVYFASTEKSNIIRGWI

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*01:03/DPB1*03:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 2708 368
HLA-DPA1*01:03/DPB1*03:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 2844 391
HLA-DPA1*01:03/DPB1*03:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 3104 433
HLA-DPA1*01:03/DPB1*03:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 2814 397
HLA-DPA1*01:03/DPB1*14:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 2540 359
HLA-DPA1*01:03/DPB1*14:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 2678 381
HLA-DPA1*01:03/DPB1*03:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 2585 371
HLA-DPA1*01:03/DPB1*14:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 2605 382
HLA-DPA1*01:03/DPB1*03:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 2518 371
HLA-DPA1*04:01/DPB1*03:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 1907 283
HLA-DPA1*01:03/DPB1*14:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 2427 362
HLA-DPA1*01:03/DPB1*03:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 2532 381
HLA-DPA1*01:03/DPB1*14:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 2376 361
HLA-DPA1*01:03/DPB1*03:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 2611 402
HLA-DPA1*04:01/DPB1*03:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 1862 288
HLA-DPA1*04:01/DPB1*03:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 1677 260
HLA-DPA1*01:03/DPB1*14:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 2358 367
HLA-DPA1*04:01/DPB1*03:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1352 211
HLA-DPA1*04:01/DPB1*03:01 VSGTNGTKRFDNPVLPF VSGTNGTKRFANPVLPF 2387 373
HLA-DPA1*04:01/DPB1*03:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1149 180
HLA-DPA1*01:03/DPB1*14:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 2451 387
HLA-DPA1*04:01/DPB1*03:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1181 188
HLA-DPA1*01:03/DPB1*14:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 2425 387
HLA-DPA1*04:01/DPB1*03:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 1822 299
HLA-DPA1*04:01/DPB1*14:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 1701 283
HLA-DPA1*04:01/DPB1*03:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1176 196
HLA-DPA1*01:03/DPB1*03:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 2606 440
HLA-DPA1*04:01/DPB1*14:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1239 210
HLA-DPA1*04:01/DPB1*03:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1091 185
HLA-DPA1*04:01/DPB1*03:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1356 231
HLA-DPA1*04:01/DPB1*03:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 1562 267
HLA-DPA1*04:01/DPB1*03:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 1694 291
HLA-DPA1*04:01/DPB1*03:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 1784 307
HLA-DPA1*04:01/DPB1*14:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 1601 276
HLA-DPA1*04:01/DPB1*14:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1095 189
HLA-DPA1*04:01/DPB1*14:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1099 190
HLA-DPA1*04:01/DPB1*14:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 1817 315
HLA-DPA1*01:03/DPB1*14:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 2403 417
HLA-DPA1*04:01/DPB1*03:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1257 219
HLA-DPA1*04:01/DPB1*03:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1405 246
HLA-DPA1*04:01/DPB1*14:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1022 179
HLA-DPA1*04:01/DPB1*03:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1056 186
HLA-DPA1*04:01/DPB1*14:01 VSGTNGTKRFDNPVLPF VSGTNGTKRFANPVLPF 2202 391
HLA-DPA1*04:01/DPB1*03:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1524 271
HLA-DPA1*01:03/DPB1*14:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 2767 493
HLA-DPA1*04:01/DPB1*03:01 IHVSGTNGTKRFDNPVLPF IHVSGTNGTKRFANPVLPF 2546 455
HLA-DPA1*04:01/DPB1*03:01 SGTNGTKRFDNPVLPF SGTNGTKRFANPVLPF 1772 318
HLA-DPA1*04:01/DPB1*03:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 1488 269
HLA-DPA1*01:03/DPB1*14:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 2643 479
HLA-DPA1*04:01/DPB1*14:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 992 180
HLA-DPA1*04:01/DPB1*03:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1613 293
HLA-DRB1*01:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 1774 324
HLA-DPA1*04:01/DPB1*03:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1050 192
HLA-DPA1*04:01/DPB1*14:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1206 221
HLA-DPA1*04:01/DPB1*03:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 1439 265
HLA-DPA1*04:01/DPB1*14:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1000 185
HLA-DPA1*01:03/DPB1*06:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 2646 490
HLA-DPA1*04:01/DPB1*03:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 1659 308
HLA-DPA1*04:01/DPB1*14:01 SGTNGTKRFDNPVLPF SGTNGTKRFANPVLPF 1699 316
HLA-DPA1*04:01/DPB1*14:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1052 197
HLA-DPA1*04:01/DPB1*03:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1520 285
HLA-DPA1*04:01/DPB1*03:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1089 205
HLA-DPA1*04:01/DPB1*06:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1209 228
HLA-DPA1*04:01/DPB1*14:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 986 186
HLA-DPA1*04:01/DPB1*14:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 1689 319
HLA-DPA1*04:01/DPB1*09:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1738 331
HLA-DPA1*01:03/DPB1*14:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 2367 453
HLA-DPA1*04:01/DPB1*14:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 1430 275
HLA-DPA1*04:01/DPB1*03:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 1464 282
HLA-DPA1*01:03/DPB1*14:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 2491 480
HLA-DPA1*04:01/DPB1*14:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 1651 319
HLA-DPA1*04:01/DPB1*14:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 1556 302
HLA-DRB1*01:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1340 261
HLA-DPA1*04:01/DPB1*06:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 1704 332
HLA-DPA1*04:01/DPB1*14:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1170 229
HLA-DPA1*04:01/DPB1*14:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1225 241
HLA-DPA1*04:01/DPB1*03:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1174 231
HLA-DPA1*04:01/DPB1*03:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1181 233
HLA-DPA1*04:01/DPB1*03:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 1743 344
HLA-DPA1*04:01/DPB1*14:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1538 304
HLA-DPA1*04:01/DPB1*09:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1714 340
HLA-DPA1*04:01/DPB1*14:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 1593 316
HLA-DRB1*13:02 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1836 365
HLA-DPA1*04:01/DPB1*14:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 1709 341
HLA-DPA1*04:01/DPB1*03:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1358 271
HLA-DPA1*04:01/DPB1*14:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 1382 276
HLA-DPA1*04:01/DPB1*10:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 2178 436
HLA-DPA1*04:01/DPB1*03:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1176 236
HLA-DPA1*04:01/DPB1*03:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 1744 351
HLA-DPA1*04:01/DPB1*06:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 1564 315
HLA-DPA1*04:01/DPB1*14:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1355 273
HLA-DPA1*04:01/DPB1*14:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 1397 282
HLA-DPA1*04:01/DPB1*14:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 1338 271
HLA-DPA1*04:01/DPB1*14:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1114 228
HLA-DPA1*04:01/DPB1*14:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1314 269
HLA-DPA1*04:01/DPB1*14:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1084 222
HLA-DPA1*04:01/DPB1*14:01 IHVSGTNGTKRFDNPVLPF IHVSGTNGTKRFANPVLPF 2151 441
HLA-DPA1*04:01/DPB1*06:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 1489 306
HLA-DPA1*04:01/DPB1*09:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1604 330
HLA-DPA1*04:01/DPB1*14:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 1692 349
HLA-DRB1*10:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 1995 412
HLA-DRB1*10:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 2229 461
HLA-DPA1*04:01/DPB1*06:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 986 204
HLA-DPA1*04:01/DPB1*06:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1157 240
HLA-DRB1*10:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1079 224
HLA-DPA1*04:01/DPB1*06:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1193 250
HLA-DPA1*04:01/DPB1*03:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 1107 232
HLA-DPA1*04:01/DPB1*06:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1029 216
HLA-DPA1*04:01/DPB1*06:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 1418 298
HLA-DPA1*01:03/DPB1*14:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 2353 495
HLA-DPA1*01:03/DPB1*06:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 2366 498
HLA-DPA1*04:01/DPB1*06:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 964 203
HLA-DPA1*04:01/DPB1*09:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 2341 493
HLA-DRB1*13:02 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1215 256
HLA-DPA1*04:01/DPB1*06:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 1451 306
HLA-DPA1*04:01/DPB1*14:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 1046 221
HLA-DPA1*04:01/DPB1*14:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1091 231
HLA-DPA1*04:01/DPB1*03:01 TKRFDNPVLPFNDGVYFAS TKRFANPVLPFNDGVYFAS 1967 419
HLA-DPA1*04:01/DPB1*09:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1511 322
HLA-DPA1*04:01/DPB1*06:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 942 201
HLA-DPA1*04:01/DPB1*09:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 2134 456
HLA-DPA1*04:01/DPB1*06:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 1539 329
HLA-DRB1*13:02 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1126 241
HLA-DPA1*04:01/DPB1*06:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1220 262
HLA-DPA1*04:01/DPB1*06:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1124 242
HLA-DPA1*04:01/DPB1*17:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1778 383
HLA-DRB1*13:02 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1949 420
HLA-DRB1*13:02 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 1288 278
HLA-DPA1*04:01/DPB1*06:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1147 248
HLA-DPA1*04:01/DPB1*06:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 1531 332
HLA-DRB1*13:02 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 2087 453
HLA-DRB1*13:02 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1938 422
HLA-DPA1*04:01/DPB1*06:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1155 252
HLA-DPA1*04:01/DPB1*10:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 2121 463
HLA-DPA1*04:01/DPB1*10:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 2066 452
HLA-DPA1*04:01/DPB1*09:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 2043 448
HLA-DRB1*13:02 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1901 419
HLA-DPA1*04:01/DPB1*09:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1531 338
HLA-DPA1*04:01/DPB1*09:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1730 382
HLA-DRB1*10:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1071 238
HLA-DPA1*04:01/DPB1*06:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 1406 313
HLA-DPA1*04:01/DPB1*06:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 879 196
HLA-DPA1*04:01/DPB1*06:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 1444 323
HLA-DPA1*04:01/DPB1*06:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1296 290
HLA-DPA1*04:01/DPB1*09:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1510 338
HLA-DPA1*04:01/DPB1*14:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1173 263
HLA-DPA1*04:01/DPB1*17:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1434 322
HLA-DPA1*04:01/DPB1*09:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1473 331
HLA-DPA1*04:01/DPB1*17:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1509 340
HLA-DPA1*04:01/DPB1*09:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1544 348
HLA-DPA1*04:01/DPB1*06:01 VSGTNGTKRFDNPVLPF VSGTNGTKRFANPVLPF 2179 492
HLA-DPA1*04:01/DPB1*17:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1748 396
HLA-DPA1*04:01/DPB1*17:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1517 344
HLA-DPA1*04:01/DPB1*17:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1686 383
HLA-DPA1*04:01/DPB1*06:01 SGTNGTKRFDNPVLPF SGTNGTKRFANPVLPF 1689 385
HLA-DPA1*04:01/DPB1*09:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1573 359
HLA-DPA1*04:01/DPB1*17:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 2127 486
HLA-DPA1*04:01/DPB1*06:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 1523 349
HLA-DPA1*04:01/DPB1*14:01 TKRFDNPVLPFNDGVYFAS TKRFANPVLPFNDGVYFAS 1850 424
HLA-DPA1*04:01/DPB1*09:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 1992 457
HLA-DPA1*04:01/DPB1*09:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1912 439
HLA-DPA1*04:01/DPB1*17:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1593 366
HLA-DRB1*01:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1448 335
HLA-DPA1*04:01/DPB1*06:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 860 199
HLA-DRB1*10:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 2050 477
HLA-DRB1*10:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1097 256
HLA-DPA1*04:01/DPB1*09:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 1970 461
HLA-DPA1*04:01/DPB1*06:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1289 302
HLA-DPA1*04:01/DPB1*06:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1227 289
HLA-DPA1*04:01/DPB1*17:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 2071 488
HLA-DPA1*04:01/DPB1*17:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1630 385
HLA-DPA1*04:01/DPB1*13:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1804 427
HLA-DPA1*04:01/DPB1*14:01 KRFDNPVLPFNDGVY KRFANPVLPFNDGVY 2077 492
HLA-DRB1*10:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 937 222
HLA-DPA1*04:01/DPB1*10:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1935 461
HLA-DPA1*04:01/DPB1*06:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1313 313
HLA-DPA1*04:01/DPB1*09:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1367 326
HLA-DRB1*01:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1527 365
HLA-DPA1*03:01/DPB1*14:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 2037 487
HLA-DRB1*01:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1619 388
HLA-DPA1*04:01/DPB1*17:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1481 355
HLA-DPA1*04:01/DPB1*17:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1680 404
HLA-DPA1*04:01/DPB1*06:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 876 211
HLA-DRB1*10:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 2001 482
HLA-DPA1*04:01/DPB1*10:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1778 429
HLA-DPA1*04:01/DPB1*17:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 2021 488
HLA-DPA1*04:01/DPB1*09:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1399 338
HLA-DPA1*04:01/DPB1*03:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 1167 283
HLA-DRB1*10:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 1657 402
HLA-DPA1*04:01/DPB1*17:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1292 314
HLA-DPA1*03:01/DPB1*14:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1875 457
HLA-DPA1*04:01/DPB1*06:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 1512 369
HLA-DPA1*03:01/DPB1*06:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1533 375
HLA-DPA1*04:01/DPB1*06:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 1309 321
HLA-DPA1*04:01/DPB1*10:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1810 445
HLA-DRB1*13:02 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1355 334
HLA-DPA1*03:01/DPB1*06:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1685 416
HLA-DPA1*04:01/DPB1*09:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 1987 491
HLA-DRB1*10:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1423 352
HLA-DPA1*04:01/DPB1*09:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 1993 496
HLA-DRB1*10:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1364 340
HLA-DPA1*04:01/DPB1*17:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1762 441
HLA-DPA1*04:01/DPB1*09:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1309 328
HLA-DPA1*03:01/DPB1*02:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1308 328
HLA-DPA1*04:01/DPB1*13:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1565 393
HLA-DPA1*04:01/DPB1*14:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 1088 275
HLA-DPA1*03:01/DPB1*06:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1878 477
HLA-DPA1*04:01/DPB1*09:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1719 437
HLA-DPA1*04:01/DPB1*10:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1922 489
HLA-DPA1*04:01/DPB1*17:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1957 498
HLA-DPA1*03:01/DPB1*02:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1252 320
HLA-DRB1*13:02 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1604 410
HLA-DPA1*04:01/DPB1*10:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1717 439
HLA-DPA1*04:01/DPB1*10:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1794 460
HLA-DPA1*04:01/DPB1*06:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 1351 347
HLA-DRB1*10:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1467 377
HLA-DRB1*10:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1109 285
HLA-DPA1*04:01/DPB1*13:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1763 454
HLA-DPA1*04:01/DPB1*09:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1905 492
HLA-DPA1*04:01/DPB1*17:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1228 320
HLA-DPA1*03:01/DPB1*06:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1772 464
HLA-DPA1*03:01/DPB1*06:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1604 424
HLA-DPA1*04:01/DPB1*17:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1803 479
HLA-DPA1*04:01/DPB1*13:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1512 403
HLA-DPA1*03:01/DPB1*02:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1298 347
HLA-DPA1*03:01/DPB1*02:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 1711 458
HLA-DPA1*04:01/DPB1*09:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1287 345
HLA-DPA1*03:01/DPB1*02:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1447 388
HLA-DPA1*04:01/DPB1*10:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1609 434
HLA-DRB1*10:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 1501 405
HLA-DPA1*04:01/DPB1*11:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 1693 457
HLA-DPA1*04:01/DPB1*13:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1385 375
HLA-DPA1*04:01/DPB1*13:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1346 366
HLA-DPA1*04:01/DPB1*06:01 KRFDNPVLPFNDGVY KRFANPVLPFNDGVY 1690 460
HLA-DPA1*04:01/DPB1*11:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 1697 462
HLA-DPA1*03:01/DPB1*14:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1826 499
HLA-DPA1*04:01/DPB1*13:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1703 472
HLA-DRB1*10:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 981 274
HLA-DPA1*04:01/DPB1*17:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1222 343
HLA-DPA1*04:01/DPB1*06:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 830 234
HLA-DPA1*04:01/DPB1*13:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1581 447
HLA-DPA1*04:01/DPB1*10:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1526 432
HLA-DPA1*03:01/DPB1*06:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1412 401
HLA-DPA1*04:01/DPB1*11:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 964 274
HLA-DRB1*10:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1715 488
HLA-DPA1*04:01/DPB1*11:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 1647 469
HLA-DPA1*04:01/DPB1*11:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1000 285
HLA-DPA1*03:01/DPB1*02:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 1655 472
HLA-DPA1*04:01/DPB1*11:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1338 382
HLA-DPA1*03:01/DPB1*02:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1236 353
HLA-DPA1*01:03/DPB1*05:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1675 480
HLA-DPA1*04:01/DPB1*26:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1706 490
HLA-DRB1*10:01 KRFDNPVLPFNDGVY KRFANPVLPFNDGVY 1028 296
HLA-DPA1*04:01/DPB1*05:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 1353 390
HLA-DPA1*04:01/DPB1*11:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 1630 470
HLA-DPA1*04:01/DPB1*05:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 797 230
HLA-DPA1*04:01/DPB1*05:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 1321 382
HLA-DPA1*04:01/DPB1*05:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 1333 386
HLA-DPA1*04:01/DPB1*05:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 1274 369
HLA-DRB1*10:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 918 267
HLA-DPA1*03:01/DPB1*02:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1454 423
HLA-DPA1*04:01/DPB1*13:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1561 455
HLA-DPA1*04:01/DPB1*11:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1372 401
HLA-DPA1*04:01/DPB1*05:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 1261 369
HLA-DPA1*04:01/DPB1*13:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1401 410
HLA-DPA1*04:01/DPB1*02:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1698 497
HLA-DRB1*10:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 1678 493
HLA-DPA1*03:01/DPB1*06:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1363 401
HLA-DPA1*04:01/DPB1*06:01 TKRFDNPVLPFNDGVYFAS TKRFANPVLPFNDGVYFAS 1335 393
HLA-DPA1*04:01/DPB1*05:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1262 372
HLA-DPA1*04:01/DPB1*05:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 782 231
HLA-DPA1*04:01/DPB1*10:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1502 446
HLA-DPA1*04:01/DPB1*26:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1588 472
HLA-DPA1*03:01/DPB1*02:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1039 309
HLA-DPA1*04:01/DPB1*05:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 763 227
HLA-DRB1*01:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1677 499
HLA-DRB1*10:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 1491 445
HLA-DRB1*15:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 817 244
HLA-DPA1*04:01/DPB1*05:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 827 247
HLA-DPA1*04:01/DPB1*11:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 1625 488
HLA-DPA1*03:01/DPB1*06:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1353 407
HLA-DRB1*13:02 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1266 381
HLA-DPA1*04:01/DPB1*05:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 1378 415
HLA-DPA1*04:01/DPB1*06:01 KRFDNPVLPFNDGVYF KRFANPVLPFNDGVYF 1591 480
HLA-DPA1*04:01/DPB1*11:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 1536 464
HLA-DPA1*04:01/DPB1*11:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 1640 497
HLA-DPA1*04:01/DPB1*09:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1638 497
HLA-DPA1*04:01/DPB1*11:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1315 400
HLA-DPA1*04:01/DPB1*11:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 1637 498
HLA-DPA1*03:01/DPB1*02:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1489 453
HLA-DPA1*04:01/DPB1*11:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 1520 463
HLA-DPA1*04:01/DPB1*02:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1500 457
HLA-DPA1*04:01/DPB1*11:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 1535 471
HLA-DPA1*04:01/DPB1*13:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1289 396
HLA-DPA1*04:01/DPB1*02:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1521 469
HLA-DPA1*04:01/DPB1*11:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1011 312
HLA-DPA1*04:01/DPB1*13:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1607 498
HLA-DPA1*03:01/DPB1*02:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1609 499
HLA-DPA1*04:01/DPB1*05:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 1192 370
HLA-DPA1*03:01/DPB1*02:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1306 407
HLA-DPA1*04:01/DPB1*05:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 734 229
HLA-DPA1*04:01/DPB1*26:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1501 469
HLA-DRB1*15:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1391 435
HLA-DPA1*03:01/DPB1*02:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 1589 497
HLA-DPA1*04:01/DPB1*11:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1421 445
HLA-DPA1*04:01/DPB1*05:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 1209 379
HLA-DPA1*03:01/DPB1*05:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1061 333
HLA-DPA1*03:01/DPB1*06:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 1266 398
HLA-DRB1*10:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 865 272
HLA-DRB1*15:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1410 444
HLA-DPA1*04:01/DPB1*11:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 930 293
HLA-DPA1*04:01/DPB1*05:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1098 346
HLA-DRB1*15:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 750 237
HLA-DPA1*03:01/DPB1*05:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 962 304
HLA-DPA1*04:01/DPB1*17:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 1214 384
HLA-DRB1*15:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1081 342
HLA-DRB1*15:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1456 462
HLA-DPA1*04:01/DPB1*11:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1446 459
HLA-DPA1*04:01/DPB1*11:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1363 433
HLA-DPA1*04:01/DPB1*05:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 713 227
HLA-DPA1*04:01/DPB1*26:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1510 482
HLA-DPA1*04:01/DPB1*01:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 594 190
HLA-DPA1*03:01/DPB1*02:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1400 448
HLA-DPA1*04:01/DPB1*11:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1480 474
HLA-DPA1*04:01/DPB1*11:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1351 433
HLA-DPA1*03:01/DPB1*02:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 893 287
HLA-DPA1*04:01/DPB1*05:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 1188 382
HLA-DPA1*04:01/DPB1*09:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 1201 387
HLA-DPA1*03:01/DPB1*05:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1114 359
HLA-DPA1*04:01/DPB1*06:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 827 267
HLA-DPA1*03:01/DPB1*01:01 IHVSGTNGTKRFDNPVLPF IHVSGTNGTKRFANPVLPF 949 307
HLA-DPA1*04:01/DPB1*05:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1186 384
HLA-DPA1*04:01/DPB1*05:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 1179 382
HLA-DPA1*03:01/DPB1*02:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1517 493
HLA-DPA1*04:01/DPB1*05:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 1245 405
HLA-DPA1*04:01/DPB1*11:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1303 424
HLA-DPA1*04:01/DPB1*05:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 716 233
HLA-DPA1*04:01/DPB1*05:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1050 342
HLA-DPA1*04:01/DPB1*11:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 886 290
HLA-DRB1*15:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1270 416
HLA-DRB1*01:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1440 472
HLA-DPA1*04:01/DPB1*85:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1207 396
HLA-DRB1*15:03 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1425 469
HLA-DPA1*04:01/DPB1*26:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1434 472
HLA-DPA1*04:01/DPB1*05:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 1221 402
HLA-DPA1*04:01/DPB1*10:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 1497 493
HLA-DPA1*03:01/DPB1*05:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1166 384
HLA-DPA1*04:01/DPB1*13:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1173 387
HLA-DPA1*04:01/DPB1*11:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 1423 470
HLA-DPA1*04:01/DPB1*02:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1378 456
HLA-DPA1*04:01/DPB1*05:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1076 357
HLA-DPA1*04:01/DPB1*85:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1199 400
HLA-DPA1*03:01/DPB1*01:01 VSGTNGTKRFDNPVLPF VSGTNGTKRFANPVLPF 1014 339
HLA-DPA1*03:01/DPB1*01:01 SGTNGTKRFDNPVLPF SGTNGTKRFANPVLPF 845 283
HLA-DPA1*04:01/DPB1*02:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1430 479
HLA-DPA1*01:03/DPB1*01:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 1191 399
HLA-DPA1*03:01/DPB1*01:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 703 236
HLA-DPA1*01:03/DPB1*01:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 812 273
HLA-DPA1*04:01/DPB1*11:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 865 291
HLA-DPA1*04:01/DPB1*11:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1413 478
HLA-DPA1*03:01/DPB1*02:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1343 455
HLA-DPA1*04:01/DPB1*26:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1393 473
HLA-DPA1*04:01/DPB1*01:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 557 190
HLA-DPA1*04:01/DPB1*05:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 1083 370
HLA-DPA1*04:01/DPB1*02:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1385 475
HLA-DPA1*03:01/DPB1*05:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1032 354
HLA-DPA1*04:01/DPB1*85:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1148 395
HLA-DPA1*03:01/DPB1*01:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 790 272
HLA-DPA1*04:01/DPB1*05:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1141 393
HLA-DPA1*04:01/DPB1*11:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1228 423
HLA-DPA1*04:01/DPB1*02:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1181 407
HLA-DPA1*03:01/DPB1*02:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 825 285
HLA-DPA1*04:01/DPB1*13:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1111 384
HLA-DPA1*04:01/DPB1*14:01 KRFDNPVLPFNDGVYFASTE KRFANPVLPFNDGVYFASTE 1412 489
HLA-DPA1*04:01/DPB1*11:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 1417 491
HLA-DPA1*04:01/DPB1*26:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1398 485
HLA-DPA1*04:01/DPB1*85:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1395 484
HLA-DPA1*04:01/DPB1*05:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1057 367
HLA-DPA1*04:01/DPB1*85:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1200 418
HLA-DPA1*01:03/DPB1*01:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 826 289
HLA-DPA1*03:01/DPB1*02:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 1327 466
HLA-DPA1*03:01/DPB1*01:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 737 259
HLA-DPA1*04:01/DPB1*11:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 852 300
HLA-DPA1*03:01/DPB1*05:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 996 351
HLA-DPA1*01:03/DPB1*01:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 1236 436
HLA-DPA1*03:01/DPB1*05:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1111 393
HLA-DRB1*13:02 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 695 246
HLA-DPA1*04:01/DPB1*05:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 1121 397
HLA-DPA1*01:03/DPB1*01:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1109 394
HLA-DPA1*04:01/DPB1*85:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1101 392
HLA-DPA1*04:01/DPB1*01:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 536 191
HLA-DPA1*03:01/DPB1*06:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 1130 403
HLA-DPA1*04:01/DPB1*01:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 384 137
HLA-DPA1*02:02/DPB1*01:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 1230 439
HLA-DQA1*01:02/DQB1*05:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1170 418
HLA-DPA1*03:01/DPB1*05:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 985 352
HLA-DPA1*04:01/DPB1*13:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1096 392
HLA-DPA1*04:01/DPB1*01:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 559 200
HLA-DPA1*03:01/DPB1*01:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 687 246
HLA-DPA1*03:01/DPB1*04:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1330 477
HLA-DPA1*04:01/DPB1*05:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 635 228
HLA-DPA1*03:01/DPB1*01:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 581 209
HLA-DRB1*15:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1262 454
HLA-DPA1*02:02/DPB1*01:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 1095 395
HLA-DPA1*04:01/DPB1*09:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 1271 459
HLA-DPA1*03:01/DPB1*01:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 478 173
HLA-DQA1*01:02/DQB1*05:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 555 201
HLA-DPA1*04:01/DPB1*85:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 1330 482
HLA-DQA1*01:02/DQB1*05:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 896 325
HLA-DPA1*03:01/DPB1*01:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 469 171
HLA-DPA1*04:01/DPB1*85:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1091 398
HLA-DPA1*02:02/DPB1*01:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 1321 482
HLA-DPA1*01:03/DPB1*01:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 1159 423
HLA-DPA1*03:01/DPB1*01:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 641 234
HLA-DPA1*03:01/DPB1*01:01 VSGTNGTKRFDNPVLPFN VSGTNGTKRFANPVLPFN 1248 456
HLA-DPA1*01:03/DPB1*01:01 SGTNGTKRFDNPVLPFN SGTNGTKRFANPVLPFN 1193 437
HLA-DPA1*04:01/DPB1*01:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 529 194
HLA-DPA1*04:01/DPB1*05:01 TKRFDNPVLPFNDGVYFAS TKRFANPVLPFNDGVYFAS 1093 401
HLA-DPA1*04:01/DPB1*11:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 853 313
HLA-DPA1*02:02/DPB1*01:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 1108 407
HLA-DPA1*03:01/DPB1*01:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 620 228
HLA-DQA1*01:02/DQB1*05:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 503 185
HLA-DPA1*02:02/DPB1*01:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 1341 494
HLA-DPA1*04:01/DPB1*01:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 518 191
HLA-DPA1*04:01/DPB1*02:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1089 402
HLA-DPA1*02:02/DPB1*01:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 1190 442
HLA-DRB1*13:02 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 961 357
HLA-DQA1*01:02/DQB1*05:01 VSGTNGTKRFDNPVLPF VSGTNGTKRFANPVLPF 936 348
HLA-DPA1*04:01/DPB1*01:01 VSGTNGTKRFDNPVLPF VSGTNGTKRFANPVLPF 768 286
HLA-DPA1*04:01/DPB1*01:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 580 216
HLA-DPA1*04:01/DPB1*85:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1097 409
HLA-DPA1*01:03/DPB1*01:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 917 342
HLA-DPA1*04:01/DPB1*01:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 568 212
HLA-DPA1*02:02/DPB1*01:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1010 377
HLA-DRB1*10:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1338 500
HLA-DPA1*03:01/DPB1*04:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1257 470
HLA-DQA1*01:02/DQB1*05:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 775 290
HLA-DPA1*04:01/DPB1*05:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1105 414
HLA-DPA1*04:01/DPB1*01:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 555 208
HLA-DPA1*03:01/DPB1*01:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 752 282
HLA-DRB1*10:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 772 290
HLA-DPA1*04:01/DPB1*01:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 447 168
HLA-DPA1*04:01/DPB1*01:01 HVSGTNGTKRFDNPVLPFND HVSGTNGTKRFANPVLPFND 367 138
HLA-DQA1*01:02/DQB1*05:01 HVSGTNGTKRFDNPVLPFN HVSGTNGTKRFANPVLPFN 779 293
HLA-DPA1*03:01/DPB1*02:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 1132 426
HLA-DPA1*04:01/DPB1*17:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 1230 463
HLA-DPA1*01:03/DPB1*01:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 873 329
HLA-DPA1*01:03/DPB1*01:01 SGTNGTKRFDNPVLPF SGTNGTKRFANPVLPF 1284 484
HLA-DPA1*04:01/DPB1*01:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 434 164
HLA-DPA1*04:01/DPB1*01:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 510 193
HLA-DPA1*03:01/DPB1*01:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 781 296
HLA-DPA1*04:01/DPB1*01:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 550 209
HLA-DPA1*04:01/DPB1*05:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 957 364
HLA-DPA1*04:01/DPB1*01:01 VSGTNGTKRFDNPVLPFN VSGTNGTKRFANPVLPFN 908 346
HLA-DPA1*03:01/DPB1*01:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 543 207
HLA-DPA1*04:01/DPB1*01:01 SGTNGTKRFDNPVLPFND SGTNGTKRFANPVLPFND 886 338
HLA-DPA1*02:02/DPB1*01:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 1017 388
HLA-DPA1*04:01/DPB1*11:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 868 333
HLA-DPA1*01:03/DPB1*01:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 779 299
HLA-DRB1*15:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1194 460
HLA-DPA1*04:01/DPB1*01:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 581 224
HLA-DPA1*03:01/DPB1*01:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 729 282
HLA-DPA1*01:03/DPB1*01:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 1127 436
HLA-DQA1*01:02/DQB1*05:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 535 207
HLA-DPA1*03:01/DPB1*01:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 491 190
HLA-DPA1*04:01/DPB1*01:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 516 200
HLA-DPA1*01:03/DPB1*01:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 1248 484
HLA-DPA1*03:01/DPB1*01:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 843 327
HLA-DQA1*01:02/DQB1*05:01 TNGTKRFDNPVLPFN TNGTKRFANPVLPFN 724 281
HLA-DQA1*01:02/DQB1*05:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 574 223
HLA-DQA1*01:02/DQB1*05:01 VSGTNGTKRFDNPVLPFND VSGTNGTKRFANPVLPFND 771 300
HLA-DPA1*04:01/DPB1*02:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 1010 394
HLA-DPA1*03:01/DPB1*01:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 703 275
HLA-DPA1*04:01/DPB1*01:01 SGTNGTKRFDNPVLPFNDGV SGTNGTKRFANPVLPFNDGV 355 139
HLA-DPA1*03:01/DPB1*05:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 893 350
HLA-DPA1*04:01/DPB1*01:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 492 193
HLA-DPA1*01:03/DPB1*01:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 737 291
HLA-DPA1*04:01/DPB1*01:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 344 136
HLA-DQA1*01:02/DQB1*05:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 875 346
HLA-DPA1*04:01/DPB1*85:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 1101 436
HLA-DPA1*03:01/DPB1*01:01 SGTNGTKRFDNPVLPFND SGTNGTKRFANPVLPFND 1161 460
HLA-DPA1*03:01/DPB1*02:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 1065 423
HLA-DPA1*04:01/DPB1*13:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 1014 404
HLA-DPA1*01:03/DPB1*01:01 GTNGTKRFDNPVLPFND GTNGTKRFANPVLPFND 1153 460
HLA-DQA1*01:02/DQB1*05:01 SGTNGTKRFDNPVLPF SGTNGTKRFANPVLPF 797 319
HLA-DPA1*01:03/DPB1*01:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 724 290
HLA-DPA1*04:01/DPB1*01:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 491 197
HLA-DPA1*04:01/DPB1*01:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 436 175
HLA-DPA1*02:02/DPB1*01:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 966 388
HLA-DPA1*03:01/DPB1*01:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 453 182
HLA-DPA1*04:01/DPB1*01:01 GTNGTKRFDNPVLPF GTNGTKRFANPVLPF 592 238
HLA-DPA1*01:03/DPB1*01:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 740 298
HLA-DPA1*04:01/DPB1*01:01 KRFDNPVLPFNDGVY KRFANPVLPFNDGVY 643 259
HLA-DPA1*03:01/DPB1*01:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 680 274
HLA-DPA1*04:01/DPB1*01:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 438 177
HLA-DQA1*01:02/DQB1*05:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 730 295
HLA-DPA1*01:03/DPB1*01:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 1064 430
HLA-DPA1*04:01/DPB1*01:01 VSGTNGTKRFDNPVLPFNDG VSGTNGTKRFANPVLPFNDG 381 154
HLA-DPA1*04:01/DPB1*85:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 1216 492
HLA-DRB1*15:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 1042 422
HLA-DPA1*03:01/DPB1*01:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 600 243
HLA-DPA1*03:01/DPB1*01:01 TNGTKRFDNPVLPFNDGV TNGTKRFANPVLPFNDGV 1207 489
HLA-DQA1*01:02/DQB1*05:01 GTNGTKRFDNPVLPFNDGV GTNGTKRFANPVLPFNDGV 760 308
HLA-DPA1*04:01/DPB1*01:01 KRFDNPVLPFNDGVYFA KRFANPVLPFNDGVYFA 734 298
HLA-DPA1*04:01/DPB1*01:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 337 137
HLA-DPA1*01:03/DPB1*01:01 GTNGTKRFDNPVLPFN GTNGTKRFANPVLPFN 934 380
HLA-DPA1*03:01/DPB1*01:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 596 243
HLA-DPA1*04:01/DPB1*01:01 KRFDNPVLPFNDGVYF KRFANPVLPFNDGVYF 635 259
HLA-DQA1*01:02/DQB1*05:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 755 308
HLA-DPA1*03:01/DPB1*01:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 761 311
HLA-DQA1*01:02/DQB1*05:01 SGTNGTKRFDNPVLPFNDG SGTNGTKRFANPVLPFNDG 814 333
HLA-DQA1*01:02/DQB1*05:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 840 344
HLA-DPA1*04:01/DPB1*01:01 TNGTKRFDNPVLPFNDGV TNGTKRFANPVLPFNDGV 854 351
HLA-DQA1*01:02/DQB1*05:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 939 387
HLA-DPA1*04:01/DPB1*01:01 GTNGTKRFDNPVLPFNDG GTNGTKRFANPVLPFNDG 904 373
HLA-DQA1*01:03/DQB1*05:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1180 487
HLA-DPA1*04:01/DPB1*06:01 KRFDNPVLPFNDGVYFASTE KRFANPVLPFNDGVYFASTE 1027 424
HLA-DPA1*03:01/DPB1*01:01 TNGTKRFDNPVLPFNDGVY TNGTKRFANPVLPFNDGVY 639 264
HLA-DPA1*03:01/DPB1*02:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 609 252
HLA-DPA1*01:03/DPB1*01:01 TKRFDNPVLPFNDGV TKRFANPVLPFNDGV 1036 430
HLA-DQA1*01:02/DQB1*05:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 882 367
HLA-DPA1*03:01/DPB1*01:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 685 288
HLA-DPA1*01:03/DPB1*01:01 NGTKRFDNPVLPFND NGTKRFANPVLPFND 938 395
HLA-DPA1*03:01/DPB1*01:01 TNGTKRFDNPVLPFNDGVYF TNGTKRFANPVLPFNDGVYF 425 179
HLA-DPA1*03:01/DPB1*01:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 641 270
HLA-DPA1*01:03/DPB1*01:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 1017 429
HLA-DPA1*03:01/DPB1*01:01 NGTKRFDNPVLPFNDGVY NGTKRFANPVLPFNDGVY 1108 468
HLA-DPA1*04:01/DPB1*01:01 SGTNGTKRFDNPVLPF SGTNGTKRFANPVLPF 594 251
HLA-DPA1*04:01/DPB1*01:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 331 140
HLA-DPA1*04:01/DPB1*01:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 450 191
HLA-DPA1*04:01/DPB1*01:01 IHVSGTNGTKRFDNPVLPF IHVSGTNGTKRFANPVLPF 683 290
HLA-DRB1*13:02 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 819 348
HLA-DQA1*01:02/DQB1*05:01 IHVSGTNGTKRFDNPVLPF IHVSGTNGTKRFANPVLPF 753 320
HLA-DPA1*04:01/DPB1*05:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 560 238
HLA-DQA1*01:02/DQB1*05:01 TNGTKRFDNPVLPFNDG TNGTKRFANPVLPFNDG 917 390
HLA-DPA1*03:01/DPB1*01:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 709 302
HLA-DPA1*04:01/DPB1*01:01 NGTKRFDNPVLPFNDGVY NGTKRFANPVLPFNDGVY 839 358
HLA-DPA1*04:01/DPB1*13:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 956 408
HLA-DPA1*02:02/DPB1*01:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 890 380
HLA-DPA1*01:03/DPB1*01:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 1032 441
HLA-DPA1*01:03/DPB1*01:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 1130 484
HLA-DPA1*03:01/DPB1*01:01 KRFDNPVLPFNDGVY KRFANPVLPFNDGVY 807 347
HLA-DPA1*04:01/DPB1*01:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 490 211
HLA-DRB1*10:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 721 311
HLA-DPA1*04:01/DPB1*01:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 468 202
HLA-DPA1*03:01/DPB1*04:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 975 422
HLA-DPA1*01:03/DPB1*01:01 NGTKRFDNPVLPFNDGV NGTKRFANPVLPFNDGV 1106 480
HLA-DPA1*03:01/DPB1*01:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 629 273
HLA-DPA1*03:01/DPB1*01:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 417 181
HLA-DPA1*03:01/DPB1*05:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 769 334
HLA-DQA1*01:02/DQB1*05:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 472 206
HLA-DPA1*03:01/DPB1*01:01 NGTKRFDNPVLPFNDGVYF NGTKRFANPVLPFNDGVYF 594 260
HLA-DPA1*03:01/DPB1*01:01 TKRFDNPVLPFNDGVYF TKRFANPVLPFNDGVYF 695 305
HLA-DQA1*01:02/DQB1*06:01 IHVSGTNGTKRFDNPVLPFN IHVSGTNGTKRFANPVLPFN 1065 471
HLA-DQA1*01:02/DQB1*05:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 709 314
HLA-DPA1*04:01/DPB1*01:01 TKRFDNPVLPFNDGVYFA TKRFANPVLPFNDGVYFA 885 393
HLA-DPA1*01:03/DPB1*01:01 GTKRFDNPVLPFNDGVY GTKRFANPVLPFNDGVY 1086 483
HLA-DPA1*04:01/DPB1*01:01 GTKRFDNPVLPFNDGVYF GTKRFANPVLPFNDGVYF 831 370
HLA-DPA1*01:03/DPB1*01:01 TNGTKRFDNPVLPFND TNGTKRFANPVLPFND 906 404
HLA-DRB1*13:02 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 766 342
HLA-DQA1*01:02/DQB1*05:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 792 355
HLA-DPA1*01:03/DPB1*01:01 TKRFDNPVLPFNDGVY TKRFANPVLPFNDGVY 966 434
HLA-DPA1*03:01/DPB1*01:01 GTKRFDNPVLPFNDGVYFA GTKRFANPVLPFNDGVYFA 583 263
HLA-DQA1*01:03/DQB1*05:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 1023 462
HLA-DPA1*03:01/DPB1*01:01 GTKRFDNPVLPFNDGVYF GTKRFANPVLPFNDGVYF 1059 479
HLA-DPA1*03:01/DPB1*02:01 TKRFDNPVLPFNDGVYFAS TKRFANPVLPFNDGVYFAS 803 367
HLA-DPA1*04:01/DPB1*01:01 TKRFDNPVLPFNDGVYFAS TKRFANPVLPFNDGVYFAS 415 190
HLA-DPA1*01:03/DPB1*01:01 GTKRFDNPVLPFNDG GTKRFANPVLPFNDG 1061 488
HLA-DPA1*03:01/DPB1*01:01 KRFDNPVLPFNDGVYFA KRFANPVLPFNDGVYFA 826 383
HLA-DPA1*04:01/DPB1*01:01 AIHVSGTNGTKRFDNPVLPF AIHVSGTNGTKRFANPVLPF 489 228
HLA-DPA1*01:03/DPB1*01:01 TKRFDNPVLPFNDGVYFAS TKRFANPVLPFNDGVYFAS 868 405
HLA-DPA1*01:03/DPB1*01:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 617 289
HLA-DPA1*01:03/DPB1*01:01 GTKRFDNPVLPFNDGV GTKRFANPVLPFNDGV 937 441
HLA-DRB1*15:01 NGTKRFDNPVLPFNDGVYFA NGTKRFANPVLPFNDGVYFA 978 465
HLA-DPA1*03:01/DPB1*01:01 KRFDNPVLPFNDGVYF KRFANPVLPFNDGVYF 762 363
HLA-DPA1*01:03/DPB1*01:01 NGTKRFDNPVLPFNDG NGTKRFANPVLPFNDG 981 469
HLA-DPA1*02:02/DPB1*01:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 749 361
HLA-DQA1*01:02/DQB1*05:01 GTNGTKRFDNPVLPFNDGVY GTNGTKRFANPVLPFNDGVY 243 118
HLA-DPA1*03:01/DPB1*02:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 457 223
HLA-DPA1*03:01/DPB1*01:01 GTKRFDNPVLPFNDGVYFAS GTKRFANPVLPFNDGVYFAS 358 176
HLA-DPA1*01:03/DPB1*01:01 TKRFDNPVLPFNDGVYFAST TKRFANPVLPFNDGVYFAST 557 275
HLA-DPA1*03:01/DPB1*01:01 TKRFDNPVLPFNDGVYFAS TKRFANPVLPFNDGVYFAS 510 255

D215G

Reference  REFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    REFVFKNIDGYFKIYSKHTPINLVRGLPQGFSALEPLVDLPIGINITRFQT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*03:01 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 58 3699
HLA-DRB1*03:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 46 2751
HLA-DRB1*03:01 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 56 3204
HLA-DRB1*03:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 50 2839
HLA-DRB1*03:01 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 63 3528
HLA-DRB1*03:01 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 56 3100
HLA-DRB1*03:01 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 58 3206
HLA-DRB1*03:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 45 2455
HLA-DRB1*03:01 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 59 3210
HLA-DRB1*03:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 47 2552
HLA-DRB1*03:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 44 2362
HLA-DRB1*03:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 32 1695
HLA-DRB1*03:01 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 53 2800
HLA-DRB1*03:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 45 2369
HLA-DRB1*03:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 45 2343
HLA-DRB1*03:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 52 2673
HLA-DRB1*03:01 NLVRDLPQGFSALEPL NLVRGLPQGFSALEPL 117 5977
HLA-DRB1*03:01 PINLVRDLPQGFSALEPL PINLVRGLPQGFSALEPL 106 5335
HLA-DRB1*03:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 46 2299
HLA-DRB1*03:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 53 2635
HLA-DRB1*03:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 41 1987
HLA-DRB1*03:01 TPINLVRDLPQGFSALEP TPINLVRGLPQGFSALEP 97 4685
HLA-DRB1*03:01 INLVRDLPQGFSALEPLVD INLVRGLPQGFSALEPLVD 97 4657
HLA-DRB1*03:01 INLVRDLPQGFSALEPLV INLVRGLPQGFSALEPLV 139 6666
HLA-DRB1*03:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 57 2684
HLA-DRB1*03:01 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 55 2535
HLA-DRB1*03:01 HTPINLVRDLPQGFSALE HTPINLVRGLPQGFSALE 93 4269
HLA-DRB1*03:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 69 3057
HLA-DRB1*03:01 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 93 4112
HLA-DRB1*03:01 NLVRDLPQGFSALEPLV NLVRGLPQGFSALEPLV 120 5276
HLA-DRB1*03:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 41 1784
HLA-DRB1*03:01 INLVRDLPQGFSALEPLVDL INLVRGLPQGFSALEPLVDL 96 4076
HLA-DRB1*03:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 27 1134
HLA-DRB1*03:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 53 2120
HLA-DRB1*03:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 76 3023
HLA-DRB1*03:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 32 1215
HLA-DRB1*03:01 SKHTPINLVRDLPQGFSA SKHTPINLVRGLPQGFSA 137 4970
HLA-DRB1*03:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 73 2462
HLA-DRB1*03:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 39 1312
HLA-DRB1*03:01 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 103 3346
HLA-DRB1*03:01 NLVRDLPQGFSALEPLVDL NLVRGLPQGFSALEPLVDL 214 6604
HLA-DRB1*03:01 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 86 2625
HLA-DRB1*03:01 NLVRDLPQGFSALEPLVD NLVRGLPQGFSALEPLVD 320 9745
HLA-DRB1*03:01 NLVRDLPQGFSALEPLVDLP NLVRGLPQGFSALEPLVDLP 209 5781
HLA-DRB1*03:01 YSKHTPINLVRDLPQGFS YSKHTPINLVRGLPQGFS 205 5468
HLA-DRB1*03:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 166 3799
HLA-DRB1*03:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 78 1693
HLA-DRB1*01:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 641 34
HLA-DRB1*03:01 LVRDLPQGFSALEPL LVRGLPQGFSALEPL 329 6065
HLA-DRB1*03:01 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 171 2960
HLA-DQA1*02:01/DQB1*03:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 2632 162
HLA-DQA1*02:01/DQB1*03:19 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 2632 162
HLA-DRB1*01:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 447 28
HLA-DQA1*02:01/DQB1*03:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 2633 175
HLA-DQA1*02:01/DQB1*03:19 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 2633 175
HLA-DQA1*02:01/DQB1*03:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 2590 178
HLA-DQA1*02:01/DQB1*03:19 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 2590 178
HLA-DRB1*03:01 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 258 3750
HLA-DQA1*05:01/DQB1*03:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 3826 272
HLA-DQA1*05:01/DQB1*03:19 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 3826 272
HLA-DQA1*05:01/DQB1*03:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 3381 241
HLA-DQA1*05:01/DQB1*03:19 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 3381 241
HLA-DRB1*01:01 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 876 64
HLA-DQA1*02:01/DQB1*03:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 2497 183
HLA-DQA1*02:01/DQB1*03:19 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 2497 183
HLA-DQA1*05:01/DQB1*03:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 3507 261
HLA-DQA1*05:01/DQB1*03:19 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 3507 261
HLA-DRB1*01:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1058 80
HLA-DRB1*01:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 912 69
HLA-DQA1*02:01/DQB1*03:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 2651 201
HLA-DQA1*02:01/DQB1*03:19 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 2651 201
HLA-DRB1*03:01 IYSKHTPINLVRDLPQGF IYSKHTPINLVRGLPQGF 478 6191
HLA-DQA1*05:01/DQB1*03:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 3925 307
HLA-DQA1*05:01/DQB1*03:19 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 3925 307
HLA-DQA1*05:01/DQB1*03:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 3579 280
HLA-DQA1*05:01/DQB1*03:19 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 3579 280
HLA-DQA1*02:01/DQB1*03:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 2376 188
HLA-DQA1*02:01/DQB1*03:19 INLVRDLPQGFSALE INLVRGLPQGFSALE 2376 188
HLA-DRB1*01:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 1249 102
HLA-DQA1*02:01/DQB1*03:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 3144 264
HLA-DQA1*02:01/DQB1*03:19 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 3144 264
HLA-DRB1*03:01 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 232 2750
HLA-DQA1*02:01/DQB1*03:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 2645 224
HLA-DQA1*02:01/DQB1*03:19 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 2645 224
HLA-DQA1*05:01/DQB1*03:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 3322 284
HLA-DQA1*05:01/DQB1*03:19 INLVRDLPQGFSALE INLVRGLPQGFSALE 3322 284
HLA-DRB1*01:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 359 31
HLA-DRB1*01:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 1523 138
HLA-DRB1*01:02 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 925 84
HLA-DRB1*01:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 969 90
HLA-DQA1*05:01/DQB1*03:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 4444 414
HLA-DQA1*05:01/DQB1*03:19 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 4444 414
HLA-DQA1*05:01/DQB1*03:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 3735 348
HLA-DQA1*05:01/DQB1*03:19 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 3735 348
HLA-DQA1*02:01/DQB1*03:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 3248 304
HLA-DQA1*02:01/DQB1*03:19 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 3248 304
HLA-DQA1*02:01/DQB1*03:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 2919 274
HLA-DQA1*02:01/DQB1*03:19 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 2919 274
HLA-DRB1*01:02 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 675 66
HLA-DQA1*02:01/DQB1*03:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 2687 264
HLA-DQA1*02:01/DQB1*03:19 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 2687 264
HLA-DQA1*05:01/DQB1*03:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 4130 414
HLA-DQA1*05:01/DQB1*03:19 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 4130 414
HLA-DRB1*07:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 1371 140
HLA-DQA1*05:01/DQB1*03:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 4183 428
HLA-DQA1*05:01/DQB1*03:19 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 4183 428
HLA-DRB1*01:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 604 62
HLA-DQA1*05:01/DQB1*03:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 4657 480
HLA-DQA1*05:01/DQB1*03:19 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 4657 480
HLA-DRB1*07:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 1212 125
HLA-DQA1*01:02/DQB1*05:02 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 364 3459
HLA-DRB1*01:02 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 1449 154
HLA-DRB1*11:04 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 676 73
HLA-DQA1*01:02/DQB1*05:02 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 359 3221
HLA-DRB1*11:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 1290 144
HLA-DRB1*11:04 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 391 44
HLA-DQA1*01:02/DQB1*05:02 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 456 4017
HLA-DRB1*11:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 1134 129
HLA-DRB1*01:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 649 76
HLA-DQA1*02:01/DQB1*03:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 2695 318
HLA-DQA1*02:01/DQB1*03:19 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 2695 318
HLA-DQA1*01:02/DQB1*05:02 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 375 3177
HLA-DRB1*11:01 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 2032 241
HLA-DQA1*02:01/DQB1*03:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 3185 378
HLA-DQA1*02:01/DQB1*03:19 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 3185 378
HLA-DQA1*05:01/DQB1*03:01 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 2798 334
HLA-DQA1*05:01/DQB1*03:19 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 2798 334
HLA-DRB1*11:04 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 331 40
HLA-DRB1*01:02 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 584 71
HLA-DQA1*01:02/DQB1*05:02 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 402 3286
HLA-DQA1*01:02/DQB1*06:04 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 208 1684
HLA-DRB1*11:02 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 867 108
HLA-DRB1*13:01 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 867 108
HLA-DQA1*01:02/DQB1*05:02 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 401 3213
HLA-DQA1*01:02/DQB1*05:02 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 463 3708
HLA-DQA1*01:02/DQB1*05:02 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 409 3271
HLA-DRB1*11:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 2060 259
HLA-DQA1*05:01/DQB1*03:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 3615 456
HLA-DQA1*05:01/DQB1*03:19 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 3615 456
HLA-DRB1*11:04 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 710 90
HLA-DRB1*07:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 1088 138
HLA-DQA1*02:01/DQB1*03:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 2960 376
HLA-DQA1*02:01/DQB1*03:19 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 2960 376
HLA-DRB1*01:02 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1422 181
HLA-DQA1*01:02/DQB1*06:04 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 219 1711
HLA-DRB1*01:02 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 1496 192
HLA-DRB1*01:02 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1221 157
HLA-DRB1*11:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 1212 156
HLA-DQA1*02:01/DQB1*03:01 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 1606 207
HLA-DQA1*02:01/DQB1*03:19 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 1606 207
HLA-DRB1*01:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 798 103
HLA-DRB1*01:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 673 87
HLA-DQA1*01:02/DQB1*06:04 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 248 1918
HLA-DQA1*01:02/DQB1*06:04 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 166 1282
HLA-DRB1*01:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 775 101
HLA-DRB1*11:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1871 244
HLA-DQA1*01:02/DQB1*06:04 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 225 1725
HLA-DRB1*11:04 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 329 43
HLA-DQA1*01:02/DQB1*06:04 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 227 1736
HLA-DQA1*01:02/DQB1*06:04 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 175 1338
HLA-DRB1*01:01 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 839 111
HLA-DRB1*01:02 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 2001 265
HLA-DRB1*16:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 1291 172
HLA-DQA1*01:02/DQB1*06:04 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 186 1396
HLA-DRB1*16:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 1114 149
HLA-DQA1*01:02/DQB1*05:02 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 411 3071
HLA-DRB1*11:04 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 634 85
HLA-DQA1*01:02/DQB1*06:04 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 214 1589
HLA-DQA1*01:02/DQB1*06:04 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 239 1761
HLA-DRB1*11:04 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 580 79
HLA-DRB1*01:01 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 744 102
HLA-DQA1*01:02/DQB1*06:04 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 338 2462
HLA-DQA1*01:02/DQB1*06:04 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 201 1463
HLA-DRB1*01:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 254 35
HLA-DQA1*01:02/DQB1*06:04 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 217 1574
HLA-DQA1*02:01/DQB1*03:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 2040 282
HLA-DQA1*02:01/DQB1*03:19 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 2040 282
HLA-DQA1*01:02/DQB1*05:02 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 428 3093
HLA-DRB1*11:04 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 831 115
HLA-DQA1*01:02/DQB1*06:04 SKHTPINLVRDLPQGFSA SKHTPINLVRGLPQGFSA 321 2312
HLA-DRB1*01:02 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 1245 173
HLA-DQA1*01:02/DQB1*06:04 HTPINLVRDLPQGFSALE HTPINLVRGLPQGFSALE 366 2627
HLA-DQA1*01:02/DQB1*06:04 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 216 1549
HLA-DQA1*01:02/DQB1*05:02 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 430 3083
HLA-DQA1*02:01/DQB1*03:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 2776 392
HLA-DQA1*02:01/DQB1*03:19 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 2776 392
HLA-DQA1*01:02/DQB1*06:04 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 277 1955
HLA-DQA1*01:02/DQB1*06:04 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 281 1956
HLA-DQA1*01:02/DQB1*06:04 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 201 1396
HLA-DRB1*11:04 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 685 99
HLA-DRB1*15:01 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 982 142
HLA-DQA1*01:02/DQB1*06:04 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 197 1358
HLA-DRB1*11:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1681 245
HLA-DRB1*01:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 712 104
HLA-DQA1*01:02/DQB1*06:04 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 197 1343
HLA-DRB1*01:02 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 973 143
HLA-DRB1*07:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1951 287
HLA-DQA1*01:02/DQB1*06:04 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 232 1561
HLA-DRB1*11:04 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 1083 161
HLA-DRB1*11:01 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 2213 329
HLA-DRB1*01:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 457 68
HLA-DRB1*11:04 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 879 131
HLA-DQA1*01:02/DQB1*05:02 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 434 2911
HLA-DRB1*01:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 433 65
HLA-DQA1*01:02/DQB1*06:04 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 182 1204
HLA-DQA1*01:02/DQB1*06:04 YSKHTPINLVRDLPQGFS YSKHTPINLVRGLPQGFS 293 1934
HLA-DRB1*11:04 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 584 89
HLA-DQA1*01:02/DQB1*06:04 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 181 1186
HLA-DRB1*16:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 1243 190
HLA-DRB1*11:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 2365 362
HLA-DRB1*11:04 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 959 147
HLA-DRB1*11:04 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 827 127
HLA-DQA1*01:02/DQB1*06:04 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 202 1308
HLA-DQA1*01:02/DQB1*06:04 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 323 2091
HLA-DRB1*07:01 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 1674 259
HLA-DQA1*01:02/DQB1*05:02 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 440 2837
HLA-DQA1*02:01/DQB1*03:01 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 2455 382
HLA-DQA1*02:01/DQB1*03:19 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 2455 382
HLA-DRB1*11:04 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 552 86
HLA-DRB1*15:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 532 83
HLA-DRB1*15:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 485 76
HLA-DQA1*01:02/DQB1*05:02 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 427 2717
HLA-DRB1*01:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 738 116
HLA-DRB1*01:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 731 115
HLA-DQA1*01:02/DQB1*06:04 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 167 1061
HLA-DRB1*11:04 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 557 88
HLA-DRB1*16:01 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 1942 307
HLA-DQA1*01:02/DQB1*06:04 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 206 1303
HLA-DRB1*07:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1474 234
HLA-DRB1*01:02 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 1617 259
HLA-DQA1*01:02/DQB1*06:04 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 171 1067
HLA-DRB1*11:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 2841 456
HLA-DRB1*11:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 2296 369
HLA-DRB1*16:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1786 288
HLA-DQA1*05:01/DQB1*03:01 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 2763 446
HLA-DQA1*05:01/DQB1*03:19 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 2763 446
HLA-DRB1*01:01 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 861 139
HLA-DQA1*01:02/DQB1*05:02 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 464 2870
HLA-DQA1*01:02/DQB1*06:04 IYSKHTPINLVRDLPQGF IYSKHTPINLVRGLPQGF 278 1710
HLA-DRB1*11:04 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 578 94
HLA-DRB1*07:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1885 307
HLA-DRB1*01:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 452 74
HLA-DRB1*11:04 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 829 136
HLA-DQA1*01:02/DQB1*05:02 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 429 2611
HLA-DQA1*02:01/DQB1*03:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 2038 335
HLA-DQA1*02:01/DQB1*03:19 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 2038 335
HLA-DRB1*07:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 2180 360
HLA-DQA1*01:02/DQB1*06:04 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 296 1785
HLA-DRB1*16:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1725 288
HLA-DRB1*01:02 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 1348 226
HLA-DRB1*10:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 483 81
HLA-DRB1*15:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1007 169
HLA-DQA1*01:02/DQB1*06:04 IYSKHTPINLVRDLPQ IYSKHTPINLVRGLPQ 173 1028
HLA-DQA1*01:02/DQB1*06:04 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 154 914
HLA-DQA1*02:01/DQB1*03:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 2202 373
HLA-DQA1*02:01/DQB1*03:19 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 2202 373
HLA-DRB1*11:04 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 572 97
HLA-DRB1*07:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 843 143
HLA-DRB1*01:02 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1075 183
HLA-DRB1*10:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 281 48
HLA-DRB1*11:04 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 632 108
HLA-DQA1*02:01/DQB1*03:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 2426 415
HLA-DQA1*02:01/DQB1*03:19 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 2426 415
HLA-DRB1*01:02 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 1367 234
HLA-DRB1*07:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1593 273
HLA-DRB1*11:04 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 1707 293
HLA-DRB1*10:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 320 55
HLA-DRB1*01:02 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 935 161
HLA-DRB1*01:01 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 2460 424
HLA-DRB1*10:01 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 533 92
HLA-DRB1*01:02 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 967 167
HLA-DRB1*10:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 440 76
HLA-DRB1*11:04 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 353 61
HLA-DRB1*01:02 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 1523 264
HLA-DRB1*07:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 1925 334
HLA-DRB1*01:02 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 489 85
HLA-DQA1*01:02/DQB1*06:04 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 152 873
HLA-DQA1*02:01/DQB1*03:01 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 1608 280
HLA-DQA1*02:01/DQB1*03:19 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 1608 280
HLA-DQA1*01:02/DQB1*06:04 TPINLVRDLPQGFSALEP TPINLVRGLPQGFSALEP 403 2311
HLA-DRB1*15:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 940 164
HLA-DRB1*01:02 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 1083 189
HLA-DRB1*11:04 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 884 155
HLA-DRB1*11:04 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 917 161
HLA-DRB1*11:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1911 337
HLA-DRB1*11:04 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 988 175
HLA-DRB1*11:02 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 350 62
HLA-DRB1*13:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 350 62
HLA-DRB1*16:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1697 302
HLA-DRB1*11:04 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 1207 215
HLA-DRB1*11:04 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 825 147
HLA-DQA1*05:01/DQB1*03:03 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 2368 422
HLA-DRB1*01:02 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 1414 252
HLA-DRB1*01:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 359 64
HLA-DRB1*10:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 672 120
HLA-DRB1*15:01 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 1112 199
HLA-DRB1*11:04 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 842 151
HLA-DRB1*10:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 562 101
HLA-DQA1*01:02/DQB1*06:04 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 251 1391
HLA-DRB1*08:04 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 730 132
HLA-DQA1*02:01/DQB1*06:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 2692 489
HLA-DRB1*01:01 HTPINLVRDLPQGFSALE HTPINLVRGLPQGFSALE 2491 456
HLA-DRB1*16:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 1872 343
HLA-DRB1*01:02 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 867 159
HLA-DQA1*01:02/DQB1*06:04 FKIYSKHTPINLVRDLPQG FKIYSKHTPINLVRGLPQG 214 1162
HLA-DRB1*10:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 525 97
HLA-DRB1*01:02 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 985 182
HLA-DRB1*11:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 2169 401
HLA-DQA1*01:02/DQB1*06:04 YFKIYSKHTPINLVRDLPQ YFKIYSKHTPINLVRGLPQ 196 1058
HLA-DRB1*15:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 523 97
HLA-DRB1*16:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 2332 433
HLA-DRB1*11:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 1199 223
HLA-DRB1*15:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 868 162
HLA-DQA1*05:01/DQB1*03:03 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 2288 428
HLA-DRB1*01:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 294 55
HLA-DRB1*11:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 2074 388
HLA-DRB1*07:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 2162 405
HLA-DRB1*11:04 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 902 169
HLA-DQA1*01:02/DQB1*06:04 KIYSKHTPINLVRDLPQ KIYSKHTPINLVRGLPQ 213 1135
HLA-DRB1*10:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 282 53
HLA-DRB1*08:04 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 404 76
HLA-DQA1*02:01/DQB1*03:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 1754 331
HLA-DQA1*02:01/DQB1*03:19 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 1754 331
HLA-DQA1*01:02/DQB1*05:02 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 420 2221
HLA-DRB1*10:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 375 71
HLA-DRB1*16:01 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 1912 363
HLA-DRB1*08:04 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 460 88
HLA-DQA1*01:02/DQB1*06:04 GYFKIYSKHTPINLVRDLPQ GYFKIYSKHTPINLVRGLPQ 178 930
HLA-DRB1*11:04 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 1060 203
HLA-DRB1*16:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 1319 254
HLA-DRB1*08:04 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 675 130
HLA-DRB1*16:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 1395 269
HLA-DRB1*11:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 2213 427
HLA-DQA1*01:02/DQB1*06:04 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 198 1026
HLA-DRB1*11:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 2144 414
HLA-DRB1*11:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 1280 248
HLA-DRB1*15:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 1139 221
HLA-DRB1*10:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 432 84
HLA-DQA1*01:02/DQB1*06:04 YFKIYSKHTPINLVRDLPQG YFKIYSKHTPINLVRGLPQG 190 976
HLA-DRB1*16:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 1868 366
HLA-DRB1*08:04 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 750 147
HLA-DQA1*01:02/DQB1*06:04 KIYSKHTPINLVRDLPQG KIYSKHTPINLVRGLPQG 348 1775
HLA-DRB1*08:04 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 698 137
HLA-DRB1*15:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 1343 265
HLA-DRB1*11:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 1350 267
HLA-DRB1*11:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 1208 240
HLA-DRB1*16:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 2073 412
HLA-DRB1*07:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 1455 290
HLA-DRB1*07:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 1771 353
HLA-DRB1*15:03 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 1675 335
HLA-DQA1*02:01/DQB1*03:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 1656 332
HLA-DQA1*02:01/DQB1*03:19 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 1656 332
HLA-DRB1*15:03 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 935 188
HLA-DRB1*08:04 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 885 178
HLA-DQA1*01:02/DQB1*06:04 FKIYSKHTPINLVRDLPQ FKIYSKHTPINLVRGLPQ 309 1533
HLA-DRB1*16:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 1488 300
HLA-DRB1*07:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 1015 205
HLA-DQA1*02:01/DQB1*03:03 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 2448 496
HLA-DRB1*08:02 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 1273 258
HLA-DQA1*02:01/DQB1*03:01 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 1958 397
HLA-DQA1*02:01/DQB1*03:19 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 1958 397
HLA-DRB1*01:01 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 779 158
HLA-DQA1*05:01/DQB1*03:03 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 2271 461
HLA-DRB1*16:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 1192 242
HLA-DQA1*01:02/DQB1*06:04 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 364 1789
HLA-DRB1*01:02 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 2435 496
HLA-DRB1*01:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 461 94
HLA-DRB1*11:02 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 255 52
HLA-DRB1*13:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 255 52
HLA-DQA1*02:01/DQB1*03:01 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 1490 304
HLA-DQA1*02:01/DQB1*03:19 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 1490 304
HLA-DRB1*10:01 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 465 95
HLA-DRB1*15:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 1093 224
HLA-DRB1*16:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 1472 302
HLA-DRB1*01:02 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 1247 256
HLA-DRB1*01:01 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 820 169
HLA-DRB1*15:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1014 209
HLA-DRB1*11:01 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 2315 478
HLA-DRB1*07:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 1675 346
HLA-DRB1*01:02 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 1554 322
HLA-DRB1*11:04 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 800 166
HLA-DRB1*08:04 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 2067 429
HLA-DRB1*16:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 2086 434
HLA-DQA1*05:01/DQB1*04:02 INLVRDLPQGFSALE INLVRGLPQGFSALE 1670 348
HLA-DRB1*08:04 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 1173 245
HLA-DRB1*08:04 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 411 86
HLA-DRB1*11:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 1461 306
HLA-DRB1*08:04 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 806 169
HLA-DRB1*07:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 925 194
HLA-DRB1*11:02 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 739 155
HLA-DRB1*13:01 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 739 155
HLA-DRB1*11:04 INLVRDLPQGFSALE INLVRGLPQGFSALE 562 118
HLA-DRB1*01:02 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 861 181
HLA-DRB1*01:01 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 908 192
HLA-DRB1*01:02 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 1233 261
HLA-DRB1*08:02 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 863 183
HLA-DQA1*01:02/DQB1*05:02 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 449 2115
HLA-DRB1*08:02 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 777 165
HLA-DRB1*16:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 2056 437
HLA-DRB1*07:01 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 1735 372
HLA-DRB1*16:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 2148 461
HLA-DRB1*11:04 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 1094 236
HLA-DQA1*05:01/DQB1*04:02 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 1212 262
HLA-DRB1*07:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 959 208
HLA-DRB1*07:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 1521 331
HLA-DRB1*07:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 993 217
HLA-DRB1*15:03 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 771 169
HLA-DQA1*01:02/DQB1*06:04 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 262 1192
HLA-DRB1*10:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 450 99
HLA-DRB1*15:03 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 877 193
HLA-DRB1*11:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 1708 376
HLA-DRB1*15:01 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 1052 232
HLA-DRB1*11:01 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 1881 415
HLA-DRB1*08:04 INLVRDLPQGFSALE INLVRGLPQGFSALE 956 211
HLA-DRB1*11:02 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 691 153
HLA-DRB1*13:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 691 153
HLA-DQA1*05:01/DQB1*04:02 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 1178 262
HLA-DQA1*05:01/DQB1*03:03 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 2062 459
HLA-DRB1*15:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 1100 245
HLA-DRB1*11:01 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 2059 459
HLA-DQA1*05:01/DQB1*03:03 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 2210 494
HLA-DRB1*11:02 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 854 191
HLA-DRB1*13:01 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 854 191
HLA-DRB1*11:01 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 1101 247
HLA-DRB1*10:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 529 119
HLA-DRB1*01:02 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 1328 300
HLA-DRB1*15:03 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1508 343
HLA-DRB1*16:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 2117 482
HLA-DRB1*15:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 1030 235
HLA-DRB1*01:02 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 1028 235
HLA-DRB1*08:02 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1223 280
HLA-DRB1*11:04 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 1270 292
HLA-DRB1*11:02 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 239 55
HLA-DRB1*13:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 239 55
HLA-DRB1*01:01 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 523 121
HLA-DRB1*15:03 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1430 331
HLA-DRB1*11:04 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 1764 409
HLA-DRB1*07:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 1600 371
HLA-DRB1*01:02 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 1287 299
HLA-DRB1*15:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 634 148
HLA-DRB1*08:04 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 998 233
HLA-DRB1*08:02 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1136 267
HLA-DRB1*08:04 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 1057 249
HLA-DRB1*08:04 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 496 117
HLA-DQA1*02:01/DQB1*03:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 1375 325
HLA-DQA1*02:01/DQB1*03:19 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 1375 325
HLA-DRB1*15:03 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 1722 408
HLA-DRB1*11:04 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 1033 245
HLA-DRB1*15:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 1054 250
HLA-DRB1*11:04 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 1212 288
HLA-DRB1*08:04 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 807 192
HLA-DRB1*01:02 INLVRDLPQGFSALE INLVRGLPQGFSALE 579 138
HLA-DRB1*11:04 HTPINLVRDLPQGFSALE HTPINLVRGLPQGFSALE 1899 453
HLA-DRB1*11:04 SKHTPINLVRDLPQGFSA SKHTPINLVRGLPQGFSA 1890 452
HLA-DRB1*15:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 1090 261
HLA-DRB1*12:02 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 1290 309
HLA-DRB1*08:02 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1128 271
HLA-DRB1*08:04 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 857 206
HLA-DQA1*02:01/DQB1*03:01 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 1400 337
HLA-DQA1*02:01/DQB1*03:19 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 1400 337
HLA-DRB1*11:04 YSKHTPINLVRDLPQGFS YSKHTPINLVRGLPQGFS 2038 491
HLA-DRB1*16:01 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 973 235
HLA-DRB1*11:04 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 1490 361
HLA-DRB1*15:03 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1299 315
HLA-DRB1*01:01 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 1010 245
HLA-DRB1*08:04 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 835 203
HLA-DQA1*05:01/DQB1*04:02 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 1069 260
HLA-DQA1*01:02/DQB1*06:09 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 167 686
HLA-DRB1*08:04 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 767 187
HLA-DRB1*10:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 566 138
HLA-DRB1*07:01 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 1767 431
HLA-DRB1*11:02 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 567 139
HLA-DRB1*13:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 567 139
HLA-DRB1*15:01 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 1134 278
HLA-DRB1*08:04 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 880 216
HLA-DRB1*10:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 460 113
HLA-DQA1*01:02/DQB1*06:09 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 177 720
HLA-DRB1*10:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 459 113
HLA-DRB1*08:02 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 810 200
HLA-DRB1*10:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 271 67
HLA-DRB1*08:04 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 891 221
HLA-DRB1*10:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 438 109
HLA-DRB1*08:02 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 1330 331
HLA-DRB1*08:04 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 1174 293
HLA-DRB1*08:04 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 516 129
HLA-DRB1*13:02 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 147 587
HLA-DRB1*08:02 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 1486 373
HLA-DRB1*16:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 1665 418
HLA-DRB1*15:01 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 1977 497
HLA-DRB1*08:04 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 1495 376
HLA-DQA1*01:03/DQB1*06:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 1364 344
HLA-DRB1*08:04 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 527 133
HLA-DRB1*08:02 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 1256 317
HLA-DRB1*07:01 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 1876 474
HLA-DRB1*12:02 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 953 241
HLA-DRB1*08:04 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 949 240
HLA-DRB1*08:04 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 1190 301
HLA-DRB1*10:01 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 478 121
HLA-DRB1*15:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 521 132
HLA-DRB1*10:01 SKHTPINLVRDLPQGFSA SKHTPINLVRGLPQGFSA 1304 333
HLA-DRB1*15:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 497 127
HLA-DQA1*01:02/DQB1*05:03 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 181 708
HLA-DRB1*16:01 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 1917 491
HLA-DRB1*15:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 1334 342
HLA-DQA1*02:01/DQB1*03:01 NLVRDLPQGFSALEPL NLVRGLPQGFSALEPL 1177 303
HLA-DQA1*02:01/DQB1*03:19 NLVRDLPQGFSALEPL NLVRGLPQGFSALEPL 1177 303
HLA-DQA1*01:02/DQB1*05:03 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 275 1068
HLA-DRB1*08:04 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 543 140
HLA-DRB1*15:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 543 140
HLA-DRB1*08:04 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 921 238
HLA-DQA1*01:02/DQB1*05:02 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 465 1796
HLA-DQA1*01:02/DQB1*05:02 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 439 1691
HLA-DRB1*07:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 983 256
HLA-DRB1*11:04 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 487 127
HLA-DQA1*01:02/DQB1*06:09 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 203 776
HLA-DRB1*16:01 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 1650 432
HLA-DRB1*10:01 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 1122 294
HLA-DQA1*01:02/DQB1*06:09 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 211 805
HLA-DRB1*08:02 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 1194 313
HLA-DRB1*15:01 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 930 244
HLA-DRB1*15:03 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 1874 492
HLA-DRB1*11:04 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 1481 389
HLA-DRB1*11:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 1741 458
HLA-DQA1*05:01/DQB1*04:02 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1560 411
HLA-DQA1*01:02/DQB1*06:04 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 219 830
HLA-DRB1*08:04 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 597 158
HLA-DRB1*08:02 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1321 352
HLA-DRB1*08:04 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 1182 315
HLA-DRB1*15:03 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1521 406
HLA-DRB1*08:04 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 1774 474
HLA-DRB1*10:01 HTPINLVRDLPQGFSALE HTPINLVRGLPQGFSALE 1185 317
HLA-DRB1*08:04 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 513 138
HLA-DQA1*01:02/DQB1*06:09 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 200 743
HLA-DRB1*01:02 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 1730 466
HLA-DQA1*05:01/DQB1*04:02 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 1097 296
HLA-DRB1*13:02 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 183 678
HLA-DRB1*11:02 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 1022 276
HLA-DRB1*13:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 1022 276
HLA-DRB1*15:03 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 1615 437
HLA-DRB1*15:03 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 964 261
HLA-DRB1*15:03 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 1721 466
HLA-DRB1*15:03 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 1649 447
HLA-DRB1*15:03 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 1708 463
HLA-DQA1*02:01/DQB1*03:01 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 1818 493
HLA-DQA1*02:01/DQB1*03:19 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 1818 493
HLA-DQA1*05:01/DQB1*04:02 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1720 467
HLA-DQA1*05:01/DQB1*04:02 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1672 455
HLA-DRB1*07:01 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 1707 465
HLA-DRB1*01:01 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 245 67
HLA-DRB1*15:03 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 936 256
HLA-DQA1*01:03/DQB1*06:04 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 341 1246
HLA-DQA1*01:02/DQB1*06:09 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 196 716
HLA-DRB1*15:03 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 1574 431
HLA-DRB1*10:01 YSKHTPINLVRDLPQGFS YSKHTPINLVRGLPQGFS 1267 347
HLA-DRB1*01:01 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 411 113
HLA-DRB1*11:04 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 1034 285
HLA-DRB1*15:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 573 158
HLA-DQA1*02:01/DQB1*03:01 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 1391 384
HLA-DQA1*02:01/DQB1*03:19 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 1391 384
HLA-DRB1*15:03 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 905 250
HLA-DQA1*01:02/DQB1*05:03 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 160 579
HLA-DRB1*08:04 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 796 220
HLA-DQA1*01:02/DQB1*06:09 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 293 1060
HLA-DRB1*08:04 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 1196 331
HLA-DRB1*10:01 TPINLVRDLPQGFSALEP TPINLVRGLPQGFSALEP 1332 369
HLA-DQA1*01:02/DQB1*06:09 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 169 608
HLA-DRB1*01:02 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 1505 419
HLA-DQA1*01:02/DQB1*06:09 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 210 753
HLA-DQA1*01:02/DQB1*05:03 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 171 613
HLA-DQA1*01:02/DQB1*06:09 SKHTPINLVRDLPQGFSA SKHTPINLVRGLPQGFSA 274 982
HLA-DRB1*10:01 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 730 204
HLA-DRB1*08:02 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 1313 367
HLA-DQA1*01:02/DQB1*06:09 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 149 532
HLA-DQA1*01:02/DQB1*06:09 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 162 577
HLA-DRB1*15:01 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 458 129
HLA-DQA1*01:03/DQB1*06:04 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 290 1027
HLA-DRB1*01:02 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 1505 425
HLA-DRB1*13:02 NLVRDLPQGFSALEPL NLVRGLPQGFSALEPL 342 1209
HLA-DRB1*15:03 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 968 274
HLA-DQA1*01:02/DQB1*06:09 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 177 625
HLA-DQA1*01:02/DQB1*06:09 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 181 638
HLA-DRB1*01:02 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 695 198
HLA-DRB1*08:02 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 1326 378
HLA-DRB1*11:02 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 449 128
HLA-DRB1*13:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 449 128
HLA-DRB1*10:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 280 80
HLA-DRB1*15:03 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 861 246
HLA-DQA1*01:02/DQB1*06:09 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 186 649
HLA-DRB1*13:02 INLVRDLPQGFSALE INLVRGLPQGFSALE 79 275
HLA-DQA1*01:02/DQB1*05:03 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 149 518
HLA-DQA1*01:02/DQB1*06:09 HTPINLVRDLPQGFSALE HTPINLVRGLPQGFSALE 317 1100
HLA-DRB1*10:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 409 118
HLA-DQA1*01:03/DQB1*06:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 1089 315
HLA-DRB1*08:02 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 1378 399
HLA-DQA1*01:02/DQB1*06:09 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 235 811
HLA-DRB1*08:02 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 1349 392
HLA-DRB1*10:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 289 84
HLA-DQA1*01:03/DQB1*06:01 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 1534 446
HLA-DRB1*11:02 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 718 210
HLA-DRB1*13:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 718 210
HLA-DRB1*08:02 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 981 287
HLA-DRB1*10:01 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 533 156
HLA-DRB1*01:01 NLVRDLPQGFSALEPL NLVRGLPQGFSALEPL 1273 374
HLA-DQA1*01:02/DQB1*05:03 YSKHTPINLVRDLPQGFS YSKHTPINLVRGLPQGFS 268 910
HLA-DQA1*01:03/DQB1*06:04 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 285 967
HLA-DQA1*01:02/DQB1*05:03 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 228 772
HLA-DQA1*01:02/DQB1*06:09 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 161 545
HLA-DQA1*02:01/DQB1*03:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 1051 311
HLA-DQA1*02:01/DQB1*03:19 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 1051 311
HLA-DRB1*15:01 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 1136 337
HLA-DRB1*15:03 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 1000 297
HLA-DQA1*01:03/DQB1*06:04 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 331 1114
HLA-DRB1*01:02 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 1064 317
HLA-DQA1*01:02/DQB1*05:03 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 188 630
HLA-DQA1*01:03/DQB1*06:04 YSKHTPINLVRDLPQGFS YSKHTPINLVRGLPQGFS 469 1568
HLA-DQA1*01:02/DQB1*06:09 YSKHTPINLVRDLPQGFS YSKHTPINLVRGLPQGFS 240 802
HLA-DRB1*15:03 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 1615 485
HLA-DRB1*15:03 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 1545 464
HLA-DRB1*10:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 303 91
HLA-DRB1*08:02 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 1478 445
HLA-DRB1*15:01 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 1291 389
HLA-DQA1*01:02/DQB1*06:09 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 173 574
HLA-DQA1*05:01/DQB1*04:02 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 1292 391
HLA-DQA1*01:03/DQB1*06:04 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 359 1186
HLA-DRB1*13:02 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 218 720
HLA-DQA1*01:03/DQB1*06:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 1057 321
HLA-DRB1*15:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 1415 431
HLA-DQA1*01:03/DQB1*06:04 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 307 1007
HLA-DRB1*12:02 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1564 477
HLA-DQA1*01:02/DQB1*06:09 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 152 498
HLA-DQA1*05:01/DQB1*04:02 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 1340 409
HLA-DQA1*01:03/DQB1*06:04 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 274 897
HLA-DRB1*01:02 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 1449 443
HLA-DRB1*10:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 251 77
HLA-DRB1*08:02 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 883 271
HLA-DRB1*07:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 570 175
HLA-DQA1*05:01/DQB1*04:02 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 1556 478
HLA-DQA1*01:02/DQB1*05:03 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 187 607
HLA-DRB1*08:02 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 824 254
HLA-DRB1*12:02 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 787 243
HLA-DQA1*05:01/DQB1*04:02 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 1551 479
HLA-DRB1*10:01 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 686 212
HLA-DQA1*01:03/DQB1*06:04 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 291 941
HLA-DQA1*01:02/DQB1*06:09 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 172 556
HLA-DQA1*01:03/DQB1*06:04 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 294 949
HLA-DQA1*01:02/DQB1*06:09 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 167 539
HLA-DQA1*01:03/DQB1*06:04 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 376 1212
HLA-DRB1*08:02 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 1485 461
HLA-DQA1*01:02/DQB1*05:03 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 195 628
HLA-DQA1*01:03/DQB1*06:04 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 323 1039
HLA-DRB1*10:01 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 781 243
HLA-DRB1*15:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 1047 326
HLA-DQA1*01:02/DQB1*05:03 SKHTPINLVRDLPQGFSA SKHTPINLVRGLPQGFSA 284 912
HLA-DQA1*01:02/DQB1*05:03 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 152 488
HLA-DQA1*01:03/DQB1*06:04 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 331 1062
HLA-DQA1*01:02/DQB1*06:09 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 207 664
HLA-DQA1*01:02/DQB1*05:03 IYSKHTPINLVRDLPQGF IYSKHTPINLVRGLPQGF 288 923
HLA-DRB1*01:02 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 1038 324
HLA-DQA1*01:03/DQB1*06:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 1291 403
HLA-DQA1*01:02/DQB1*06:09 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 203 650
HLA-DRB1*10:01 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 757 237
HLA-DQA1*01:02/DQB1*06:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 1517 476
HLA-DRB1*01:01 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 363 114
HLA-DQA1*01:02/DQB1*06:09 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 262 834
HLA-DRB1*13:02 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 124 394
HLA-DQA1*01:03/DQB1*06:04 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 338 1073
HLA-DRB1*01:01 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 330 104
HLA-DQA1*01:03/DQB1*06:04 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 296 938
HLA-DQA1*01:02/DQB1*06:09 IYSKHTPINLVRDLPQGF IYSKHTPINLVRGLPQGF 230 728
HLA-DQA1*01:02/DQB1*05:03 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 164 519
HLA-DQA1*01:02/DQB1*05:03 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 165 522
HLA-DRB1*08:02 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 775 245
HLA-DQA1*05:01/DQB1*04:02 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 1331 421
HLA-DQA1*01:03/DQB1*06:04 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 288 907
HLA-DRB1*13:02 INLVRDLPQGFSALEPLVDL INLVRGLPQGFSALEPLVDL 204 642
HLA-DRB1*11:01 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 749 238
HLA-DQA1*01:03/DQB1*06:04 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 289 909
HLA-DQA1*01:02/DQB1*06:09 YSKHTPINLVRDLPQG YSKHTPINLVRGLPQG 180 566
HLA-DRB1*13:02 INLVRDLPQGFSALEPLVD INLVRGLPQGFSALEPLVD 312 979
HLA-DRB1*08:02 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 955 305
HLA-DRB1*11:02 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 499 161
HLA-DRB1*13:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 499 161
HLA-DRB1*01:01 NLVRDLPQGFSALEPLV NLVRGLPQGFSALEPLV 1106 357
HLA-DQA1*01:02/DQB1*06:09 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 141 436
HLA-DQA1*01:03/DQB1*06:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 998 323
HLA-DQA1*01:03/DQB1*06:04 IYSKHTPINLVRDLPQGF IYSKHTPINLVRGLPQGF 465 1436
HLA-DQA1*01:03/DQB1*06:04 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 351 1083
HLA-DRB1*08:02 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 1218 395
HLA-DQA1*01:03/DQB1*06:04 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 243 749
HLA-DQA1*01:03/DQB1*06:04 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 305 940
HLA-DQA1*01:02/DQB1*05:03 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 171 527
HLA-DQA1*01:02/DQB1*05:02 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 486 1497
HLA-DRB1*16:01 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 652 212
HLA-DQA1*01:03/DQB1*06:04 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 339 1042
HLA-DRB1*10:01 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 341 111
HLA-DQA1*01:02/DQB1*05:03 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 181 556
HLA-DQA1*01:02/DQB1*05:03 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 182 558
HLA-DRB1*11:02 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 954 312
HLA-DRB1*13:01 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 954 312
HLA-DRB1*08:02 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 1384 454
HLA-DRB1*11:02 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 218 72
HLA-DRB1*13:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 218 72
HLA-DQA1*01:02/DQB1*06:09 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 156 472
HLA-DQA1*01:03/DQB1*06:04 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 399 1207
HLA-DQA1*01:02/DQB1*05:03 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 319 964
HLA-DRB1*11:02 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 605 201
HLA-DRB1*13:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 605 201
HLA-DQA1*01:03/DQB1*06:04 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 404 1212
HLA-DRB1*10:01 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 387 129
HLA-DRB1*08:04 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 399 133
HLA-DRB1*15:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 681 227
HLA-DQA1*01:02/DQB1*05:03 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 192 575
HLA-DQA1*01:03/DQB1*06:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 1113 373
HLA-DQA1*01:03/DQB1*06:04 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 290 864
HLA-DQA1*01:02/DQB1*06:09 TPINLVRDLPQGFSALEP TPINLVRGLPQGFSALEP 343 1021
HLA-DQA1*01:03/DQB1*06:04 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 276 819
HLA-DRB1*13:02 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 119 353
HLA-DQA1*01:02/DQB1*06:09 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 128 378
HLA-DRB1*13:02 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 206 608
HLA-DQA1*02:01/DQB1*03:01 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 882 299
HLA-DQA1*02:01/DQB1*03:19 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 882 299
HLA-DRB1*15:03 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 699 237
HLA-DQA1*01:02/DQB1*06:09 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 130 383
HLA-DQA1*01:03/DQB1*06:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 1076 366
HLA-DQA1*01:03/DQB1*06:04 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 227 665
HLA-DRB1*12:02 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 1069 365
HLA-DRB1*12:02 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1238 423
HLA-DRB1*08:02 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 708 242
HLA-DQA1*02:01/DQB1*03:01 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 1134 388
HLA-DQA1*02:01/DQB1*03:19 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 1134 388
HLA-DRB1*12:02 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 1062 364
HLA-DQA1*01:02/DQB1*06:09 GYFKIYSKHTPINLVRDLPQ GYFKIYSKHTPINLVRGLPQ 147 428
HLA-DRB1*12:02 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1028 354
HLA-DRB1*15:01 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 354 122
HLA-DQA1*05:01/DQB1*04:02 SKHTPINLVRDLPQG SKHTPINLVRGLPQG 1134 391
HLA-DRB1*12:02 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 1097 379
HLA-DRB1*07:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 1035 358
HLA-DRB1*07:01 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 769 266
HLA-DQA1*01:02/DQB1*06:09 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 146 421
HLA-DQA1*01:02/DQB1*05:03 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 285 821
HLA-DRB1*13:02 PINLVRDLPQGFSALEPL PINLVRGLPQGFSALEPL 473 1361
HLA-DRB1*13:02 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 104 299
HLA-DQA1*01:03/DQB1*06:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 975 340
HLA-DQA1*05:01/DQB1*04:02 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 1313 458
HLA-DRB1*13:02 NLVRDLPQGFSALEPLVDLP NLVRGLPQGFSALEPLVDLP 405 1157
HLA-DQA1*01:02/DQB1*06:09 YFKIYSKHTPINLVRDLPQG YFKIYSKHTPINLVRGLPQG 155 441
HLA-DQA1*01:03/DQB1*06:04 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 413 1173
HLA-DQA1*01:02/DQB1*06:01 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 1119 394
HLA-DQA1*01:02/DQB1*06:09 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 281 798
HLA-DQA1*01:02/DQB1*06:09 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 206 585
HLA-DQA1*01:03/DQB1*06:04 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 429 1218
HLA-DQA1*01:03/DQB1*06:04 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 284 806
HLA-DRB1*01:02 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 1067 376
HLA-DQA1*02:01/DQB1*03:01 INLVRDLPQGFSALEPLVD INLVRGLPQGFSALEPLVD 1169 412
HLA-DQA1*02:01/DQB1*03:19 INLVRDLPQGFSALEPLVD INLVRGLPQGFSALEPLVD 1169 412
HLA-DQA1*01:02/DQB1*05:03 HTPINLVRDLPQGFSALE HTPINLVRGLPQGFSALE 304 861
HLA-DQA1*01:03/DQB1*06:01 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 1316 465
HLA-DQA1*01:03/DQB1*06:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 1006 356
HLA-DQA1*01:02/DQB1*05:03 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 166 469
HLA-DQA1*01:02/DQB1*06:09 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 257 726
HLA-DRB1*11:02 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 669 237
HLA-DRB1*13:01 YSKHTPINLVRDLPQGFSA YSKHTPINLVRGLPQGFSA 669 237
HLA-DQA1*01:02/DQB1*05:03 KIYSKHTPINLVRDLPQG KIYSKHTPINLVRGLPQG 434 1224
HLA-DRB1*12:02 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 1134 403
HLA-DQA1*01:03/DQB1*06:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 1246 443
HLA-DRB1*13:02 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 165 464
HLA-DRB1*07:01 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 913 325
HLA-DRB1*08:02 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 1200 428
HLA-DQA1*01:02/DQB1*05:03 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 149 417
HLA-DQA1*01:02/DQB1*06:09 IYSKHTPINLVRDLPQ IYSKHTPINLVRGLPQ 163 455
HLA-DQA1*01:02/DQB1*05:03 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 181 505
HLA-DRB1*11:02 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 365 131
HLA-DRB1*13:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 365 131
HLA-DQA1*01:02/DQB1*06:04 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 331 921
HLA-DRB1*15:01 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 751 270
HLA-DQA1*01:03/DQB1*06:04 IYSKHTPINLVRDLPQ IYSKHTPINLVRGLPQ 290 806
HLA-DQA1*01:03/DQB1*06:04 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 274 760
HLA-DQA1*01:02/DQB1*05:03 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 139 384
HLA-DRB1*08:04 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 776 281
HLA-DRB1*11:02 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 563 204
HLA-DRB1*13:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 563 204
HLA-DQA1*01:03/DQB1*06:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 962 349
HLA-DQA1*01:02/DQB1*05:03 FKIYSKHTPINLVRDLPQG FKIYSKHTPINLVRGLPQG 254 700
HLA-DQA1*01:02/DQB1*05:03 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 291 801
HLA-DRB1*11:02 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 578 210
HLA-DRB1*13:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 578 210
HLA-DRB1*10:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 338 123
HLA-DQA1*01:02/DQB1*06:09 KIYSKHTPINLVRDLPQ KIYSKHTPINLVRGLPQ 182 500
HLA-DRB1*10:01 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 214 78
HLA-DRB1*01:01 INLVRDLPQGFSALEPLVD INLVRGLPQGFSALEPLVD 738 269
HLA-DQA1*01:03/DQB1*06:04 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 206 565
HLA-DQA1*01:02/DQB1*05:03 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 139 381
HLA-DRB1*12:02 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 1129 412
HLA-DRB1*11:02 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 348 127
HLA-DRB1*13:01 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 348 127
HLA-DQA1*01:02/DQB1*06:01 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 1211 442
HLA-DRB1*15:03 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 1147 419
HLA-DRB1*13:02 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 177 484
HLA-DQA1*05:01/DQB1*04:02 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 1302 477
HLA-DRB1*11:02 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 608 223
HLA-DRB1*13:01 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 608 223
HLA-DRB1*11:01 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 1286 472
HLA-DQA1*01:03/DQB1*06:01 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1148 422
HLA-DQA1*01:03/DQB1*06:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1011 373
HLA-DRB1*11:02 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 374 138
HLA-DRB1*13:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 374 138
HLA-DQA1*01:02/DQB1*06:09 YFKIYSKHTPINLVRDLPQ YFKIYSKHTPINLVRGLPQ 166 449
HLA-DQA1*01:03/DQB1*06:04 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 340 918
HLA-DQA1*01:02/DQB1*05:03 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 139 375
HLA-DQA1*01:02/DQB1*05:03 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 148 399
HLA-DQA1*01:02/DQB1*06:09 KIYSKHTPINLVRDLPQG KIYSKHTPINLVRGLPQG 286 767
HLA-DRB1*13:02 TPINLVRDLPQGFSALEP TPINLVRGLPQGFSALEP 417 1118
HLA-DQA1*01:02/DQB1*05:03 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 148 395
HLA-DQA1*01:02/DQB1*06:09 FKIYSKHTPINLVRDLPQG FKIYSKHTPINLVRGLPQG 180 478
HLA-DQA1*01:02/DQB1*06:09 FKIYSKHTPINLVRDLPQ FKIYSKHTPINLVRGLPQ 255 677
HLA-DRB1*10:01 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 607 229
HLA-DRB1*11:02 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 397 150
HLA-DRB1*13:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 397 150
HLA-DRB1*01:01 LVRDLPQGFSALEPL LVRGLPQGFSALEPL 741 280
HLA-DQA1*05:01/DQB1*04:02 INLVRDLPQGFSALEP INLVRGLPQGFSALEP 1206 456
HLA-DRB1*10:01 IYSKHTPINLVRDLPQGF IYSKHTPINLVRGLPQGF 950 361
HLA-DRB1*11:02 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 605 230
HLA-DRB1*13:01 PINLVRDLPQGFSALEP PINLVRGLPQGFSALEP 605 230
HLA-DRB1*14:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 941 358
HLA-DQA1*02:01/DQB1*03:01 NLVRDLPQGFSALEPLV NLVRGLPQGFSALEPLV 1068 407
HLA-DQA1*02:01/DQB1*03:19 NLVRDLPQGFSALEPLV NLVRGLPQGFSALEPLV 1068 407
HLA-DQA1*01:02/DQB1*05:03 IYSKHTPINLVRDLPQ IYSKHTPINLVRGLPQ 265 694
HLA-DRB1*12:02 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 649 248
HLA-DRB1*13:02 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 95 248
HLA-DQA1*05:01/DQB1*04:02 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 1025 394
HLA-DQA1*01:02/DQB1*05:03 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 197 509
HLA-DRB1*11:02 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 664 258
HLA-DRB1*13:01 IYSKHTPINLVRDLPQGFS IYSKHTPINLVRGLPQGFS 664 258
HLA-DQA1*01:03/DQB1*06:01 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 1255 488
HLA-DQA1*01:02/DQB1*06:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 1036 403
HLA-DRB1*13:02 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 109 279
HLA-DRB1*12:02 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 1153 452
HLA-DQA1*01:03/DQB1*06:04 FKIYSKHTPINLVRDLPQG FKIYSKHTPINLVRGLPQG 319 813
HLA-DQA1*01:03/DQB1*06:04 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 206 525
HLA-DRB1*13:02 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 64 163
HLA-DRB1*12:02 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 1114 438
HLA-DQA1*01:03/DQB1*06:04 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 306 778
HLA-DRB1*15:01 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 900 354
HLA-DRB1*16:01 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 1146 451
HLA-DRB1*13:02 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 90 228
HLA-DRB1*13:02 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 164 415
HLA-DQA1*01:02/DQB1*06:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 1019 403
HLA-DQA1*01:02/DQB1*05:03 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 227 566
HLA-DRB1*11:02 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 349 140
HLA-DRB1*13:01 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 349 140
HLA-DRB1*10:01 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 336 135
HLA-DRB1*13:02 HTPINLVRDLPQGFSALE HTPINLVRGLPQGFSALE 384 950
HLA-DQA1*01:02/DQB1*06:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 1029 418
HLA-DQA1*01:03/DQB1*06:04 YFKIYSKHTPINLVRDLPQG YFKIYSKHTPINLVRGLPQG 236 580
HLA-DRB1*11:02 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 506 206
HLA-DRB1*13:01 TPINLVRDLPQGFSAL TPINLVRGLPQGFSAL 506 206
HLA-DRB1*13:02 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 88 216
HLA-DQA1*01:02/DQB1*05:03 PINLVRDLPQGFSAL PINLVRGLPQGFSAL 242 594
HLA-DQA1*01:02/DQB1*05:03 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 148 363
HLA-DQA1*01:02/DQB1*05:03 PINLVRDLPQGFSALE PINLVRGLPQGFSALE 225 551
HLA-DRB1*13:02 KHTPINLVRDLPQGFSALE KHTPINLVRGLPQGFSALE 158 386
HLA-DQA1*01:02/DQB1*05:03 YFKIYSKHTPINLVRDLPQG YFKIYSKHTPINLVRGLPQG 195 475
HLA-DQA1*01:02/DQB1*05:03 TPINLVRDLPQGFSALEP TPINLVRGLPQGFSALEP 319 775
HLA-DQA1*01:02/DQB1*06:01 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 974 403
HLA-DRB1*13:02 TPINLVRDLPQGFSALE TPINLVRGLPQGFSALE 149 359
HLA-DRB1*11:02 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 685 286
HLA-DRB1*13:01 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 685 286
HLA-DQA1*01:02/DQB1*06:09 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 166 397
HLA-DQA1*05:01/DQB1*04:02 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 835 350
HLA-DQA1*01:02/DQB1*05:03 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 196 467
HLA-DQA1*01:03/DQB1*06:01 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 780 328
HLA-DQA1*02:01/DQB1*03:01 INLVRDLPQGFSALEPLVDL INLVRGLPQGFSALEPLVDL 796 335
HLA-DQA1*02:01/DQB1*03:19 INLVRDLPQGFSALEPLVDL INLVRGLPQGFSALEPLVDL 796 335
HLA-DQA1*01:02/DQB1*06:09 TPINLVRDLPQGFSALEPL TPINLVRGLPQGFSALEPL 211 500
HLA-DRB1*13:02 KHTPINLVRDLPQGFSAL KHTPINLVRGLPQGFSAL 374 883
HLA-DQA1*05:01/DQB1*04:02 HTPINLVRDLPQGFSALEP HTPINLVRGLPQGFSALEP 1147 486
HLA-DRB1*13:02 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 157 370
HLA-DQA1*01:03/DQB1*06:04 KIYSKHTPINLVRDLPQ KIYSKHTPINLVRGLPQ 314 739
HLA-DQA1*05:01/DQB1*04:02 YSKHTPINLVRDLPQGF YSKHTPINLVRGLPQGF 1167 496
HLA-DRB1*08:02 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 496 211
HLA-DRB1*14:01 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 747 318
HLA-DRB1*11:04 KIYSKHTPINLVRDLPQ KIYSKHTPINLVRGLPQ 981 418
HLA-DQA1*01:03/DQB1*06:04 GYFKIYSKHTPINLVRDLPQ GYFKIYSKHTPINLVRGLPQ 232 541
HLA-DQA1*01:02/DQB1*06:01 KHTPINLVRDLPQGFSA KHTPINLVRGLPQGFSA 1033 443
HLA-DQA1*01:02/DQB1*06:01 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 1074 464
HLA-DQA1*02:01/DQB1*03:01 LVRDLPQGFSALEPL LVRGLPQGFSALEPL 1092 472
HLA-DQA1*02:01/DQB1*03:19 LVRDLPQGFSALEPL LVRGLPQGFSALEPL 1092 472
HLA-DQA1*05:01/DQB1*04:02 KHTPINLVRDLPQGFSALEP KHTPINLVRGLPQGFSALEP 839 364
HLA-DQA1*01:02/DQB1*06:04 PINLVRDLPQGFSALEPLVD PINLVRGLPQGFSALEPLVD 265 609
HLA-DRB1*13:02 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 88 202
HLA-DQA1*01:02/DQB1*05:03 KIYSKHTPINLVRDLPQ KIYSKHTPINLVRGLPQ 346 794
HLA-DRB1*14:04 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 793 349
HLA-DQA1*01:03/DQB1*06:04 YFKIYSKHTPINLVRDLPQ YFKIYSKHTPINLVRGLPQ 310 703
HLA-DRB1*01:02 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 509 225
HLA-DRB1*11:04 FKIYSKHTPINLVRDLPQG FKIYSKHTPINLVRGLPQG 827 366
HLA-DQA1*01:03/DQB1*06:02 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 1031 457
HLA-DQA1*01:02/DQB1*06:01 KHTPINLVRDLPQGFS KHTPINLVRGLPQGFS 965 428
HLA-DRB1*11:02 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 462 205
HLA-DRB1*13:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 462 205
HLA-DQA1*01:03/DQB1*06:04 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 493 1107
HLA-DQA1*01:02/DQB1*05:03 YFKIYSKHTPINLVRDLPQ YFKIYSKHTPINLVRGLPQ 304 682
HLA-DQA1*01:02/DQB1*06:01 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 1036 463
HLA-DQA1*05:01/DQB1*04:02 NLVRDLPQGFSALEP NLVRGLPQGFSALEP 987 442
HLA-DQA1*01:02/DQB1*05:03 FKIYSKHTPINLVRDLPQ FKIYSKHTPINLVRGLPQ 475 1055
HLA-DQA1*01:03/DQB1*06:01 SKHTPINLVRDLPQGFSAL SKHTPINLVRGLPQGFSAL 960 433
HLA-DRB1*10:01 NLVRDLPQGFSALEPLV NLVRGLPQGFSALEPLV 940 427
HLA-DRB1*08:04 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 299 136
HLA-DRB1*12:02 INLVRDLPQGFSALE INLVRGLPQGFSALE 829 378
HLA-DRB1*08:02 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 899 410
HLA-DQA1*05:01/DQB1*04:02 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 766 350
HLA-DRB1*11:02 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 585 270
HLA-DRB1*13:01 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 585 270
HLA-DRB1*13:02 HTPINLVRDLPQGFSAL HTPINLVRGLPQGFSAL 142 307
HLA-DQA1*01:03/DQB1*06:02 YSKHTPINLVRDLPQGFSAL YSKHTPINLVRGLPQGFSAL 780 361
HLA-DQA1*01:03/DQB1*06:01 SKHTPINLVRDLPQGFSALE SKHTPINLVRGLPQGFSALE 653 303
HLA-DRB1*01:01 IYSKHTPINLVRDLPQG IYSKHTPINLVRGLPQG 286 133
HLA-DQA1*01:02/DQB1*05:03 GYFKIYSKHTPINLVRDLPQ GYFKIYSKHTPINLVRGLPQ 241 517
HLA-DQA1*05:01/DQB1*04:02 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 1049 489
HLA-DRB1*11:02 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 303 142
HLA-DRB1*13:01 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 303 142
HLA-DRB1*10:01 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 145 68
HLA-DRB1*08:04 KIYSKHTPINLVRDLPQ KIYSKHTPINLVRGLPQ 784 368
HLA-DQA1*01:03/DQB1*06:01 SKHTPINLVRDLPQGFS SKHTPINLVRGLPQGFS 705 331
HLA-DQA1*01:03/DQB1*06:01 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 744 350
HLA-DRB1*13:02 HTPINLVRDLPQGFSA HTPINLVRGLPQGFSA 161 342
HLA-DRB1*10:01 LVRDLPQGFSALEPL LVRGLPQGFSALEPL 817 386
HLA-DRB1*04:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 388 819
HLA-DQA1*01:03/DQB1*06:01 SKHTPINLVRDLPQGF SKHTPINLVRGLPQGF 774 368
HLA-DRB1*15:02 KHTPINLVRDLPQGF KHTPINLVRGLPQGF 1024 487
HLA-DRB1*14:04 HTPINLVRDLPQGFS HTPINLVRGLPQGFS 643 306
HLA-DQA1*01:02/DQB1*06:09 PINLVRDLPQGFSALEPL PINLVRGLPQGFSALEPL 356 747
HLA-DRB1*10:01 KIYSKHTPINLVRDLPQGF KIYSKHTPINLVRGLPQGF 227 109
HLA-DRB1*15:01 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 268 129
HLA-DQA1*02:01/DQB1*03:01 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 941 453
HLA-DQA1*02:01/DQB1*03:19 FKIYSKHTPINLVRDLPQGF FKIYSKHTPINLVRGLPQGF 941 453
HLA-DRB1*11:02 INLVRDLPQGFSALE INLVRGLPQGFSALE 311 151
HLA-DRB1*13:01 INLVRDLPQGFSALE INLVRGLPQGFSALE 311 151
HLA-DRB1*07:01 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 283 138
HLA-DRB1*13:02 IYSKHTPINLVRDLPQGFSA IYSKHTPINLVRGLPQGFSA 111 226
HLA-DQA1*01:03/DQB1*06:01 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 717 353
HLA-DQA1*01:02/DQB1*05:03 TPINLVRDLPQGFSALEPLV TPINLVRGLPQGFSALEPLV 170 345
HLA-DRB1*14:01 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 655 323
HLA-DRB1*01:02 INLVRDLPQGFSALEPLVDL INLVRGLPQGFSALEPLVDL 978 483
HLA-DQA1*01:03/DQB1*06:02 YSKHTPINLVRDLPQ YSKHTPINLVRGLPQ 1005 497
HLA-DQA1*05:01/DQB1*04:02 HTPINLVRDLPQGFSALEPL HTPINLVRGLPQGFSALEPL 691 342
HLA-DRB1*11:04 YFKIYSKHTPINLVRDLPQG YFKIYSKHTPINLVRGLPQG 333 166
HLA-DRB1*11:02 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 843 421
HLA-DRB1*13:01 INLVRDLPQGFSALEPL INLVRGLPQGFSALEPL 843 421
HLA-DRB1*01:01 KIYSKHTPINLVRDLPQGFS KIYSKHTPINLVRGLPQGFS 120 60
HLA-DRB1*13:02 TPINLVRDLPQGFSA TPINLVRGLPQGFSA 87 174
HLA-DRB1*11:02 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 834 417
HLA-DRB1*13:01 PINLVRDLPQGFSALEPLV PINLVRGLPQGFSALEPLV 834 417

LLA 241-243 deletion

Reference  LPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVG
           |||||||||||||||||||||||||   |||||||||||||||||||||||||
Mutated    LPQGFSALEPLVDLPIGINITRFQT‑‑‑LHRSYLTPGDSSSGWTXGAAAYYVG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*02:01 LVDLPIGINITRFQTLL - 16 -
HLA-DPA1*03:01/DPB1*02:01 PLVDLPIGINITRFQTLLA - 18 -
HLA-DPA1*03:01/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 20 -
HLA-DPA1*03:01/DPB1*02:01 LVDLPIGINITRFQTLLAL - 21 -
HLA-DPA1*03:01/DPB1*02:01 EPLVDLPIGINITRFQTLL - 22 -
HLA-DPA1*03:01/DPB1*02:01 LEPLVDLPIGINITRFQTLL - 23 -
HLA-DPA1*03:01/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 24 -
HLA-DPA1*03:01/DPB1*04:01 LVDLPIGINITRFQTLL - 25 -
HLA-DPA1*03:01/DPB1*04:01 PLVDLPIGINITRFQTLLA - 27 -
HLA-DPA1*03:01/DPB1*02:01 LVDLPIGINITRFQTLLA - 28 -
HLA-DPA1*03:01/DPB1*04:01 LVDLPIGINITRFQTLLAL - 28 -
HLA-DPA1*03:01/DPB1*02:01 VDLPIGINITRFQTLLAL - 29 -
HLA-DPA1*01:03/DPB1*04:01 LVDLPIGINITRFQTLL - 31 -
HLA-DPA1*03:01/DPB1*04:01 EPLVDLPIGINITRFQTLL - 31 -
HLA-DPA1*03:01/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 32 -
HLA-DPA1*03:01/DPB1*02:01 PLVDLPIGINITRFQTLL - 35 -
HLA-DPA1*03:01/DPB1*04:01 LEPLVDLPIGINITRFQTLL - 36 -
HLA-DPA1*03:01/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 36 -
HLA-DPA1*03:01/DPB1*04:01 VDLPIGINITRFQTLLAL - 37 -
HLA-DPA1*01:03/DPB1*02:01 LVDLPIGINITRFQTLL - 39 -
HLA-DPA1*01:03/DPB1*04:01 PLVDLPIGINITRFQTLLA - 39 -
HLA-DPA1*04:01/DPB1*04:01 LVDLPIGINITRFQTLL - 39 -
HLA-DPA1*03:01/DPB1*04:01 LVDLPIGINITRFQTLLA - 40 -
HLA-DPA1*04:01/DPB1*02:01 LVDLPIGINITRFQTLL - 42 -
HLA-DPA1*04:01/DPB1*04:01 PLVDLPIGINITRFQTLLA - 43 -
HLA-DPA1*01:03/DPB1*02:01 PLVDLPIGINITRFQTLLA - 44 -
HLA-DPA1*04:01/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 44 -
HLA-DPA1*04:01/DPB1*02:01 PLVDLPIGINITRFQTLLA - 45 -
HLA-DPA1*01:03/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 47 -
HLA-DPA1*01:03/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 47 -
HLA-DPA1*01:03/DPB1*04:01 LVDLPIGINITRFQTLLAL - 47 -
HLA-DPA1*03:01/DPB1*04:01 PLVDLPIGINITRFQTLL - 47 -
HLA-DPA1*04:01/DPB1*04:01 LVDLPIGINITRFQTLLAL - 48 -
HLA-DPA1*04:01/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 49 -
HLA-DPA1*04:01/DPB1*02:01 LVDLPIGINITRFQTLLAL - 49 -
HLA-DPA1*03:01/DPB1*01:01 LVDLPIGINITRFQTLLAL - 50 -
HLA-DPA1*04:01/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 50 -
HLA-DPA1*01:03/DPB1*02:01 LVDLPIGINITRFQTLLAL - 51 -
HLA-DPA1*01:03/DPB1*04:01 EPLVDLPIGINITRFQTLL - 51 -
HLA-DPA1*03:01/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 54 -
HLA-DPA1*03:01/DPB1*04:02 LVDLPIGINITRFQTLL - 57 -
HLA-DPA1*03:01/DPB1*105:01 LVDLPIGINITRFQTLL - 57 -
HLA-DPA1*04:01/DPB1*02:01 LEPLVDLPIGINITRFQTLL - 57 -
HLA-DPA1*04:01/DPB1*04:01 EPLVDLPIGINITRFQTLL - 57 -
HLA-DPA1*01:03/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 58 -
HLA-DPA1*03:01/DPB1*01:01 PLVDLPIGINITRFQTLLA - 58 -
HLA-DPA1*04:01/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 58 -
HLA-DPA1*03:01/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 60 -
HLA-DPA1*04:01/DPB1*02:01 EPLVDLPIGINITRFQTLL - 60 -
HLA-DPA1*01:03/DPB1*02:01 EPLVDLPIGINITRFQTLL - 61 -
HLA-DPA1*01:03/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 62 -
HLA-DPA1*01:03/DPB1*04:01 LEPLVDLPIGINITRFQTLL - 63 -
HLA-DPA1*04:01/DPB1*04:01 LEPLVDLPIGINITRFQTLL - 63 -
HLA-DPA1*03:01/DPB1*01:01 LEPLVDLPIGINITRFQTLL - 64 -
HLA-DPA1*01:03/DPB1*02:01 LEPLVDLPIGINITRFQTLL - 65 -
HLA-DPA1*03:01/DPB1*01:01 LVDLPIGINITRFQTLL - 66 -
HLA-DPA1*03:01/DPB1*01:01 EPLVDLPIGINITRFQTLL - 68 -
HLA-DPA1*03:01/DPB1*04:02 PLVDLPIGINITRFQTLLA - 68 -
HLA-DPA1*03:01/DPB1*105:01 PLVDLPIGINITRFQTLLA - 68 -
HLA-DPA1*04:01/DPB1*04:01 LVDLPIGINITRFQTLLA - 68 -
HLA-DQA1*01:02/DQB1*05:01 EPLVDLPIGINITRFQTLLA - 68 -
HLA-DPA1*04:01/DPB1*02:01 LVDLPIGINITRFQTLLA - 69 -
HLA-DPA1*03:01/DPB1*01:01 VDLPIGINITRFQTLLAL - 71 -
HLA-DPA1*04:01/DPB1*04:01 VDLPIGINITRFQTLLAL - 71 -
HLA-DQA1*01:02/DQB1*05:01 PLVDLPIGINITRFQTLLAL - 71 -
HLA-DPA1*04:01/DPB1*02:01 VDLPIGINITRFQTLLAL - 72 -
HLA-DPA1*01:03/DPB1*04:01 LVDLPIGINITRFQTLLA - 73 -
HLA-DPA1*01:03/DPB1*04:01 VDLPIGINITRFQTLLAL - 74 -
HLA-DPA1*03:01/DPB1*04:02 EPLVDLPIGINITRFQTLLA - 74 -
HLA-DPA1*03:01/DPB1*105:01 EPLVDLPIGINITRFQTLLA - 74 -
HLA-DPA1*01:03/DPB1*02:01 LVDLPIGINITRFQTLLA - 79 -
HLA-DPA1*03:01/DPB1*04:02 LVDLPIGINITRFQTLLAL - 79 -
HLA-DPA1*03:01/DPB1*105:01 LVDLPIGINITRFQTLLAL - 79 -
HLA-DQA1*01:02/DQB1*05:01 PLVDLPIGINITRFQTLLA - 83 -
HLA-DQA1*01:02/DQB1*05:01 LVDLPIGINITRFQTLLAL - 83 -
HLA-DPA1*01:03/DPB1*02:01 VDLPIGINITRFQTLLAL - 85 -
HLA-DPA1*02:02/DPB1*01:01 LVDLPIGINITRFQTLL - 86 -
HLA-DPA1*03:01/DPB1*04:02 EPLVDLPIGINITRFQTLL - 86 -
HLA-DPA1*03:01/DPB1*105:01 EPLVDLPIGINITRFQTLL - 86 -
HLA-DPA1*02:01/DPB1*01:01 LVDLPIGINITRFQTLL - 89 -
HLA-DQA1*01:02/DQB1*05:01 LEPLVDLPIGINITRFQTLL - 89 -
HLA-DPA1*03:01/DPB1*01:01 LVDLPIGINITRFQTLLA - 90 -
HLA-DPA1*04:01/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 90 -
HLA-DPA1*03:01/DPB1*04:02 LEPLVDLPIGINITRFQTLL - 91 -
HLA-DPA1*03:01/DPB1*105:01 LEPLVDLPIGINITRFQTLL - 91 -
HLA-DPA1*04:01/DPB1*04:01 PLVDLPIGINITRFQTLL - 91 -
HLA-DPA1*03:01/DPB1*04:02 PLVDLPIGINITRFQTLLAL - 92 -
HLA-DPA1*03:01/DPB1*105:01 PLVDLPIGINITRFQTLLAL - 92 -
HLA-DPA1*04:01/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 94 -
HLA-DPA1*04:01/DPB1*02:01 PLVDLPIGINITRFQTLL - 94 -
HLA-DPA1*01:03/DPB1*04:01 PLVDLPIGINITRFQTLL - 95 -
HLA-DPA1*04:01/DPB1*01:01 LVDLPIGINITRFQTLLAL - 95 -
HLA-DPA1*02:02/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 97 -
HLA-DPA1*04:01/DPB1*01:01 PLVDLPIGINITRFQTLLA - 100 -
HLA-DPA1*04:01/DPB1*01:01 LEPLVDLPIGINITRFQTLL - 101 -
HLA-DPA1*02:02/DPB1*01:01 PLVDLPIGINITRFQTLLA - 102 -
HLA-DPA1*04:01/DPB1*01:01 LVDLPIGINITRFQTLL - 102 -
HLA-DPA1*03:01/DPB1*01:01 PLVDLPIGINITRFQTLL - 106 -
HLA-DPA1*01:03/DPB1*02:01 PLVDLPIGINITRFQTLL - 110 -
HLA-DPA1*02:02/DPB1*01:01 LEPLVDLPIGINITRFQTLL - 112 -
HLA-DPA1*02:02/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 113 -
HLA-DPA1*02:02/DPB1*01:01 EPLVDLPIGINITRFQTLL - 114 -
HLA-DRB1*15:01 PLVDLPIGINITRFQTLLAL - 115 -
HLA-DPA1*04:01/DPB1*01:01 EPLVDLPIGINITRFQTLL - 116 -
HLA-DPA1*02:02/DPB1*01:01 LVDLPIGINITRFQTLLAL - 117 -
HLA-DPA1*01:03/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 120 -
HLA-DPA1*01:03/DPB1*01:01 LVDLPIGINITRFQTLL - 120 -
HLA-DQA1*01:02/DQB1*05:01 VDLPIGINITRFQTLLAL - 121 -
HLA-DPA1*03:01/DPB1*04:02 VDLPIGINITRFQTLLAL - 123 -
HLA-DPA1*03:01/DPB1*105:01 VDLPIGINITRFQTLLAL - 123 -
HLA-DPA1*03:01/DPB1*04:02 LVDLPIGINITRFQTLLA - 125 -
HLA-DPA1*03:01/DPB1*105:01 LVDLPIGINITRFQTLLA - 125 -
HLA-DPA1*01:03/DPB1*01:01 PLVDLPIGINITRFQTLLA - 126 -
HLA-DQA1*01:02/DQB1*05:01 LVDLPIGINITRFQTLLA - 126 -
HLA-DPA1*02:01/DPB1*01:01 PLVDLPIGINITRFQTLLA - 127 -
HLA-DPA1*01:03/DPB1*01:01 LEPLVDLPIGINITRFQTLL - 130 -
HLA-DPA1*01:03/DPB1*01:01 LVDLPIGINITRFQTLLAL - 131 -
HLA-DPA1*01:03/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 133 -
HLA-DPA1*02:02/DPB1*01:01 LVDLPIGINITRFQTLLA - 137 -
HLA-DQA1*01:02/DQB1*05:01 EPLVDLPIGINITRFQTLL - 139 -
HLA-DRB1*15:01 LVDLPIGINITRFQTLLAL - 139 -
HLA-DPA1*01:03/DPB1*01:01 EPLVDLPIGINITRFQTLL - 141 -
HLA-DPA1*04:01/DPB1*01:01 VDLPIGINITRFQTLLAL - 141 -
HLA-DPA1*02:01/DPB1*01:01 EPLVDLPIGINITRFQTLLA - 143 -
HLA-DQA1*01:03/DQB1*05:01 PLVDLPIGINITRFQTLLAL - 144 -
HLA-DRB1*15:01 EPLVDLPIGINITRFQTLLA - 145 -
HLA-DRB1*04:04 LVDLPIGINITRFQTLLAL - 146 -
HLA-DPA1*02:02/DPB1*01:01 VDLPIGINITRFQTLLAL - 147 -
HLA-DPA1*02:01/DPB1*01:01 EPLVDLPIGINITRFQTLL - 148 -
HLA-DPA1*02:02/DPB1*02:01 LVDLPIGINITRFQTLL - 148 -
HLA-DPA1*02:02/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 150 -
HLA-DPA1*02:02/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 151 -
HLA-DQA1*01:03/DQB1*05:01 EPLVDLPIGINITRFQTLLA - 151 -
HLA-DPA1*02:01/DPB1*01:01 LVDLPIGINITRFQTLLAL - 155 -
HLA-DPA1*04:01/DPB1*01:01 LVDLPIGINITRFQTLLA - 155 -
HLA-DPA1*02:01/DPB1*01:01 LVDLPIGINITRFQTLLA - 157 -
HLA-DRB1*04:04 PLVDLPIGINITRFQTLLAL - 159 -
HLA-DPA1*03:01/DPB1*05:01 PLVDLPIGINITRFQTLLAL - 160 -
HLA-DQA1*01:02/DQB1*05:01 LVDLPIGINITRFQTLL - 161 -
HLA-DPA1*02:02/DPB1*01:01 PLVDLPIGINITRFQTLL - 162 -
HLA-DPA1*03:01/DPB1*04:02 PLVDLPIGINITRFQTLL - 162 -
HLA-DPA1*03:01/DPB1*105:01 PLVDLPIGINITRFQTLL - 162 -
HLA-DPA1*02:02/DPB1*02:01 LVDLPIGINITRFQTLLAL - 164 -
HLA-DPA1*02:01/DPB1*01:01 LEPLVDLPIGINITRFQTLL - 165 -
HLA-DPA1*03:01/DPB1*05:01 EPLVDLPIGINITRFQTLLA - 170 -
HLA-DQA1*01:03/DQB1*05:01 LVDLPIGINITRFQTLLAL - 171 -
HLA-DPA1*02:02/DPB1*02:01 PLVDLPIGINITRFQTLLA - 172 -
HLA-DPA1*01:03/DPB1*01:01 VDLPIGINITRFQTLLAL - 178 -
HLA-DRB1*10:01 LEPLVDLPIGINITRFQTLL - 178 -
HLA-DPA1*02:01/DPB1*01:01 VDLPIGINITRFQTLLAL - 179 -
HLA-DPA1*02:02/DPB1*02:01 LEPLVDLPIGINITRFQTLL - 180 -
HLA-DPA1*03:01/DPB1*05:01 LEPLVDLPIGINITRFQTLL - 182 -
HLA-DPA1*02:01/DPB1*01:01 PLVDLPIGINITRFQTLLAL - 184 -
HLA-DRB1*10:01 EPLVDLPIGINITRFQTLLA - 186 -
HLA-DPA1*04:01/DPB1*01:01 PLVDLPIGINITRFQTLL - 187 -
HLA-DQA1*01:03/DQB1*05:01 PLVDLPIGINITRFQTLLA - 187 -
HLA-DRB1*13:02 EPLVDLPIGINITRFQTLLA - 187 -
HLA-DPA1*02:01/DPB1*01:01 PLVDLPIGINITRFQTLL - 188 -
HLA-DRB1*13:02 LEPLVDLPIGINITRFQTLL - 188 -
HLA-DPA1*02:02/DPB1*04:01 LVDLPIGINITRFQTLL - 195 -
HLA-DPA1*01:03/DPB1*01:01 LVDLPIGINITRFQTLLA - 197 -
HLA-DRB1*13:02 PLVDLPIGINITRFQTLLAL - 199 -
HLA-DRB1*15:01 PLVDLPIGINITRFQTLLA - 201 -
HLA-DRB1*10:01 PLVDLPIGINITRFQTLLAL - 202 -
HLA-DQA1*01:03/DQB1*05:01 LEPLVDLPIGINITRFQTLL - 203 -
HLA-DPA1*03:01/DPB1*05:01 LVDLPIGINITRFQTLLAL - 204 -
HLA-DPA1*02:01/DPB1*02:01 LVDLPIGINITRFQTLL - 213 -
HLA-DPA1*02:02/DPB1*02:01 EPLVDLPIGINITRFQTLL - 213 -
HLA-DRB1*04:04 EPLVDLPIGINITRFQTLLA - 219 -
HLA-DPA1*02:01/DPB1*04:01 LVDLPIGINITRFQTLL - 220 -
HLA-DRB1*04:04 PLVDLPIGINITRFQTLLA - 222 -
HLA-DRB1*13:02 LVDLPIGINITRFQTLL - 222 -
HLA-DPA1*02:02/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 228 -
HLA-DPA1*03:01/DPB1*05:01 LVDLPIGINITRFQTLL - 228 -
HLA-DRB1*01:01 EPLVDLPIGINITRFQTLLA - 232 -
HLA-DPA1*02:02/DPB1*04:01 LVDLPIGINITRFQTLLAL - 234 -
HLA-DRB1*04:04 VDLPIGINITRFQTLLAL - 235 -
HLA-DPA1*01:03/DPB1*01:01 PLVDLPIGINITRFQTLL - 236 -
HLA-DPA1*02:02/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 236 -
HLA-DPA1*03:01/DPB1*05:01 PLVDLPIGINITRFQTLLA - 237 -
HLA-DPA1*02:02/DPB1*02:01 VDLPIGINITRFQTLLAL - 239 -
HLA-DRB1*01:01 PLVDLPIGINITRFQTLLAL - 239 -
HLA-DQA1*01:02/DQB1*05:01 LLALHRSYLTPGDSSSGWT - 241 -
HLA-DQA1*01:02/DQB1*05:01 PLVDLPIGINITRFQTLL - 244 -
HLA-DPA1*02:02/DPB1*04:01 PLVDLPIGINITRFQTLLA - 250 -
HLA-DPA1*02:01/DPB1*02:01 EPLVDLPIGINITRFQTLLA - 253 -
HLA-DPA1*02:02/DPB1*02:01 LVDLPIGINITRFQTLLA - 257 -
HLA-DRB1*15:01 VDLPIGINITRFQTLLAL - 259 -
HLA-DRB1*01:01 LEPLVDLPIGINITRFQTLL - 260 -
HLA-DPA1*02:01/DPB1*02:01 PLVDLPIGINITRFQTLLAL - 261 -
HLA-DRB1*10:01 PLVDLPIGINITRFQTLLA - 263 -
HLA-DPA1*02:01/DPB1*02:01 LVDLPIGINITRFQTLLAL - 266 -
HLA-DPA1*02:01/DPB1*02:01 PLVDLPIGINITRFQTLLA - 268 -
HLA-DQA1*01:03/DQB1*05:01 VDLPIGINITRFQTLLAL - 268 -
HLA-DPA1*03:01/DPB1*11:01 PLVDLPIGINITRFQTLLAL - 270 -
HLA-DPA1*04:01/DPB1*05:01 PLVDLPIGINITRFQTLLAL - 273 -
HLA-DPA1*03:01/DPB1*05:01 EPLVDLPIGINITRFQTLL - 274 -
HLA-DPA1*03:01/DPB1*13:01 PLVDLPIGINITRFQTLLAL - 274 -
HLA-DPA1*03:01/DPB1*13:01 LVDLPIGINITRFQTLLAL - 274 -
HLA-DRB1*10:01 LVDLPIGINITRFQTLLAL - 275 -
HLA-DPA1*02:02/DPB1*04:01 LEPLVDLPIGINITRFQTLL - 276 -
HLA-DRB1*15:01 LLALHRSYLTPGDSSSGWT - 277 -
HLA-DRB1*13:02 PLVDLPIGINITRFQTLLA - 280 -
HLA-DPA1*03:01/DPB1*11:01 EPLVDLPIGINITRFQTLLA - 282 -
HLA-DRB1*13:02 EPLVDLPIGINITRFQTLL - 284 -
HLA-DRB1*13:02 LVDLPIGINITRFQTLLAL - 289 -
HLA-DPA1*04:01/DPB1*05:01 EPLVDLPIGINITRFQTLLA - 292 -
HLA-DQA1*01:03/DQB1*05:01 LVDLPIGINITRFQTLLA - 293 -
HLA-DPA1*03:01/DPB1*13:01 EPLVDLPIGINITRFQTLLA - 295 -
HLA-DPA1*03:01/DPB1*11:01 LVDLPIGINITRFQTLLAL - 296 -
HLA-DPA1*02:02/DPB1*04:01 EPLVDLPIGINITRFQTLL - 300 -
HLA-DPA1*02:01/DPB1*02:01 LEPLVDLPIGINITRFQTLL - 302 -
HLA-DPA1*02:02/DPB1*04:01 VDLPIGINITRFQTLLAL - 305 -
HLA-DPA1*04:01/DPB1*04:02 LVDLPIGINITRFQTLL - 309 -
HLA-DPA1*04:01/DPB1*105:01 LVDLPIGINITRFQTLL - 309 -
HLA-DPA1*04:01/DPB1*04:02 EPLVDLPIGINITRFQTLLA - 310 -
HLA-DPA1*04:01/DPB1*105:01 EPLVDLPIGINITRFQTLLA - 310 -
HLA-DQA1*01:03/DQB1*06:09 PLVDLPIGINITRFQTLLAL - 311 -
HLA-DRB1*11:02 LVDLPIGINITRFQTLL - 311 -
HLA-DRB1*13:01 LVDLPIGINITRFQTLL - 311 -
HLA-DQA1*01:02/DQB1*05:03 EPLVDLPIGINITRFQTLLA - 314 -
HLA-DPA1*04:01/DPB1*05:01 LEPLVDLPIGINITRFQTLL - 315 -
HLA-DQA1*01:02/DQB1*05:03 PLVDLPIGINITRFQTLLAL - 315 -
HLA-DRB1*11:02 PLVDLPIGINITRFQTLLAL - 315 -
HLA-DRB1*13:01 PLVDLPIGINITRFQTLLAL - 315 -
HLA-DPA1*04:01/DPB1*13:01 PLVDLPIGINITRFQTLLAL - 320 -
HLA-DQA1*01:03/DQB1*05:01 LVDLPIGINITRFQTLL - 321 -
HLA-DPA1*04:01/DPB1*13:01 EPLVDLPIGINITRFQTLLA - 323 -
HLA-DRB1*11:02 EPLVDLPIGINITRFQTLLA - 323 -
HLA-DRB1*13:01 EPLVDLPIGINITRFQTLLA - 323 -
HLA-DPA1*03:01/DPB1*05:01 VDLPIGINITRFQTLLAL - 324 -
HLA-DPA1*03:01/DPB1*11:01 LEPLVDLPIGINITRFQTLL - 324 -
HLA-DPA1*03:01/DPB1*13:01 LEPLVDLPIGINITRFQTLL - 324 -
HLA-DPA1*04:01/DPB1*04:02 PLVDLPIGINITRFQTLLAL - 325 -
HLA-DPA1*04:01/DPB1*105:01 PLVDLPIGINITRFQTLLAL - 325 -
HLA-DQA1*01:03/DQB1*06:09 EPLVDLPIGINITRFQTLLA - 325 -
HLA-DPA1*03:01/DPB1*13:01 PLVDLPIGINITRFQTLLA - 328 -
HLA-DPA1*02:01/DPB1*04:01 PLVDLPIGINITRFQTLLA - 334 -
HLA-DPA1*04:01/DPB1*04:02 LVDLPIGINITRFQTLLAL - 336 -
HLA-DPA1*04:01/DPB1*105:01 LVDLPIGINITRFQTLLAL - 336 -
HLA-DRB1*15:02 PLVDLPIGINITRFQTLLAL - 336 -
HLA-DPA1*02:01/DPB1*02:01 EPLVDLPIGINITRFQTLL - 337 -
HLA-DPA1*04:01/DPB1*04:02 PLVDLPIGINITRFQTLLA - 337 -
HLA-DPA1*04:01/DPB1*105:01 PLVDLPIGINITRFQTLLA - 337 -
HLA-DPA1*02:01/DPB1*04:01 LVDLPIGINITRFQTLLAL - 338 -
HLA-DPA1*02:02/DPB1*02:01 PLVDLPIGINITRFQTLL - 339 -
HLA-DRB1*10:01 EPLVDLPIGINITRFQTLL - 340 -
HLA-DPA1*03:01/DPB1*11:01 PLVDLPIGINITRFQTLLA - 341 -
HLA-DPA1*02:02/DPB1*04:01 LVDLPIGINITRFQTLLA - 343 -
HLA-DQA1*01:03/DQB1*05:01 EPLVDLPIGINITRFQTLL - 343 -
HLA-DPA1*02:01/DPB1*04:01 EPLVDLPIGINITRFQTLLA - 354 -
HLA-DQA1*01:02/DQB1*05:03 LVDLPIGINITRFQTLLAL - 355 -
HLA-DRB1*15:02 EPLVDLPIGINITRFQTLLA - 359 -
HLA-DPA1*04:01/DPB1*13:01 LVDLPIGINITRFQTLLAL - 361 -
HLA-DRB1*11:02 LEPLVDLPIGINITRFQTLL - 366 -
HLA-DRB1*13:01 LEPLVDLPIGINITRFQTLL - 366 -
HLA-DQA1*01:02/DQB1*05:03 PLVDLPIGINITRFQTLLA - 367 -
HLA-DPA1*04:01/DPB1*05:01 LVDLPIGINITRFQTLLAL - 368 -
HLA-DPA1*02:02/DPB1*05:01 EPLVDLPIGINITRFQTLLA - 370 -
HLA-DQA1*01:03/DQB1*06:09 LVDLPIGINITRFQTLLAL - 371 -
HLA-DRB1*11:04 PLVDLPIGINITRFQTLLAL - 374 -
HLA-DRB1*01:01 LVDLPIGINITRFQTLLAL - 376 -
HLA-DPA1*02:01/DPB1*04:01 PLVDLPIGINITRFQTLLAL - 378 -
HLA-DPA1*04:01/DPB1*04:02 LEPLVDLPIGINITRFQTLL - 378 -
HLA-DPA1*04:01/DPB1*105:01 LEPLVDLPIGINITRFQTLL - 378 -
HLA-DPA1*03:01/DPB1*06:01 EPLVDLPIGINITRFQTLLA - 381 -
HLA-DQA1*01:02/DQB1*05:01 LLALHRSYLTPGDSSSGW - 381 -
HLA-DQA1*01:02/DQB1*06:09 LVDLPIGINITRFQTLLAL - 381 -
HLA-DQA1*01:02/DQB1*06:09 PLVDLPIGINITRFQTLLAL - 382 -
HLA-DPA1*03:01/DPB1*06:01 PLVDLPIGINITRFQTLLAL - 383 -
HLA-DPA1*03:01/DPB1*13:01 EPLVDLPIGINITRFQTLL - 383 -
HLA-DPA1*02:01/DPB1*02:01 VDLPIGINITRFQTLLAL - 386 -
HLA-DPA1*04:01/DPB1*13:01 LEPLVDLPIGINITRFQTLL - 386 -
HLA-DRB1*15:03 PLVDLPIGINITRFQTLLAL - 390 -
HLA-DPA1*04:01/DPB1*13:01 PLVDLPIGINITRFQTLLA - 391 -
HLA-DQA1*01:03/DQB1*06:09 LEPLVDLPIGINITRFQTLL - 393 -
HLA-DPA1*03:01/DPB1*05:01 LVDLPIGINITRFQTLLA - 394 -
HLA-DPA1*04:01/DPB1*05:01 LVDLPIGINITRFQTLL - 396 -
HLA-DQA1*01:03/DQB1*06:09 PLVDLPIGINITRFQTLLA - 397 -
HLA-DPA1*03:01/DPB1*13:01 LVDLPIGINITRFQTLL - 398 -
HLA-DPA1*03:01/DPB1*11:01 EPLVDLPIGINITRFQTLL - 399 -
HLA-DPA1*04:01/DPB1*05:01 PLVDLPIGINITRFQTLLA - 399 -
HLA-DRB1*11:04 LVDLPIGINITRFQTLL - 399 -
HLA-DRB1*07:01 EPLVDLPIGINITRFQTLLA - 403 -
HLA-DQA1*01:02/DQB1*05:01 LALHRSYLTPGDSSSGW - 404 -
HLA-DRB1*01:01 PLVDLPIGINITRFQTLLA - 404 -
HLA-DPA1*02:02/DPB1*05:01 PLVDLPIGINITRFQTLLAL - 406 -
HLA-DPA1*03:01/DPB1*85:01 PLVDLPIGINITRFQTLLAL - 406 -
HLA-DPA1*03:01/DPB1*06:01 LVDLPIGINITRFQTLLAL - 407 -
HLA-DPA1*04:01/DPB1*11:01 PLVDLPIGINITRFQTLLAL - 407 -
HLA-DPA1*03:01/DPB1*06:01 LEPLVDLPIGINITRFQTLL - 408 -
HLA-DQA1*01:02/DQB1*06:09 EPLVDLPIGINITRFQTLLA - 410 -
HLA-DPA1*01:03/DPB1*04:02 LVDLPIGINITRFQTLL - 414 -
HLA-DPA1*01:03/DPB1*105:01 LVDLPIGINITRFQTLL - 414 -
HLA-DRB1*11:04 EPLVDLPIGINITRFQTLLA - 414 -
HLA-DPA1*02:01/DPB1*02:01 LVDLPIGINITRFQTLLA - 415 -
HLA-DPA1*02:02/DPB1*04:01 PLVDLPIGINITRFQTLL - 415 -
HLA-DPA1*03:01/DPB1*17:01 PLVDLPIGINITRFQTLLAL - 417 -
HLA-DPA1*02:01/DPB1*04:01 EPLVDLPIGINITRFQTLL - 419 -
HLA-DQA1*01:02/DQB1*06:09 PLVDLPIGINITRFQTLLA - 419 -
HLA-DQA1*01:03/DQB1*05:01 LLALHRSYLTPGDSSSGWT - 419 -
HLA-DPA1*02:02/DPB1*05:01 LEPLVDLPIGINITRFQTLL - 420 -
HLA-DRB1*10:01 LVDLPIGINITRFQTLL - 422 -
HLA-DPA1*04:01/DPB1*04:02 EPLVDLPIGINITRFQTLL - 429 -
HLA-DPA1*04:01/DPB1*105:01 EPLVDLPIGINITRFQTLL - 429 -
HLA-DRB1*04:04 LVDLPIGINITRFQTLLA - 429 -
HLA-DPA1*03:01/DPB1*09:01 PLVDLPIGINITRFQTLLAL - 430 -
HLA-DQA1*01:02/DQB1*05:03 VDLPIGINITRFQTLLAL - 431 -
HLA-DPA1*04:01/DPB1*13:01 LVDLPIGINITRFQTLL - 433 -
HLA-DPA1*02:02/DPB1*13:01 EPLVDLPIGINITRFQTLLA - 434 -
HLA-DPA1*02:02/DPB1*05:01 LVDLPIGINITRFQTLL - 437 -
HLA-DQA1*01:02/DQB1*06:09 LEPLVDLPIGINITRFQTLL - 438 -
HLA-DPA1*03:01/DPB1*85:01 LVDLPIGINITRFQTLLAL - 439 -
HLA-DPA1*02:01/DPB1*04:01 LEPLVDLPIGINITRFQTLL - 440 -
HLA-DPA1*04:01/DPB1*11:01 EPLVDLPIGINITRFQTLLA - 440 -
HLA-DQA1*01:02/DQB1*05:03 LEPLVDLPIGINITRFQTLL - 440 -
HLA-DQA1*01:02/DQB1*05:03 LVDLPIGINITRFQTLLA - 441 -
HLA-DRB1*11:02 LVDLPIGINITRFQTLLAL - 441 -
HLA-DRB1*13:01 LVDLPIGINITRFQTLLAL - 441 -
HLA-DPA1*02:02/DPB1*13:01 PLVDLPIGINITRFQTLLAL - 443 -
HLA-DRB1*01:01 LVDLPIGINITRFQTLL - 443 -
HLA-DPA1*03:01/DPB1*06:01 PLVDLPIGINITRFQTLLA - 445 -
HLA-DPA1*03:01/DPB1*13:01 VDLPIGINITRFQTLLAL - 445 -
HLA-DRB1*14:04 EPLVDLPIGINITRFQTLLA - 445 -
HLA-DPA1*04:01/DPB1*06:01 PLVDLPIGINITRFQTLLAL - 446 -
HLA-DRB1*15:02 LVDLPIGINITRFQTLLAL - 446 -
HLA-DRB1*01:01 LLALHRSYLTPGDSSSGWT - 447 -
HLA-DPA1*03:01/DPB1*11:01 LVDLPIGINITRFQTLL - 449 -
HLA-DPA1*03:01/DPB1*17:01 EPLVDLPIGINITRFQTLLA - 449 -
HLA-DPA1*03:01/DPB1*85:01 EPLVDLPIGINITRFQTLLA - 449 -
HLA-DQA1*01:03/DQB1*06:01 LALHRSYLTPGDSSSGW - 449 -
HLA-DRB1*08:04 PLVDLPIGINITRFQTLLAL - 452 -
HLA-DPA1*02:01/DPB1*04:01 VDLPIGINITRFQTLLAL - 455 -
HLA-DPA1*01:03/DPB1*04:02 EPLVDLPIGINITRFQTLLA - 456 -
HLA-DPA1*01:03/DPB1*105:01 EPLVDLPIGINITRFQTLLA - 456 -
HLA-DRB1*14:04 PLVDLPIGINITRFQTLLAL - 457 -
HLA-DRB1*07:01 PLVDLPIGINITRFQTLLAL - 459 -
HLA-DRB1*07:01 LVDLPIGINITRFQTLL - 459 -
HLA-DRB1*15:01 LVDLPIGINITRFQTLLA - 460 -
HLA-DRB1*11:04 LVDLPIGINITRFQTLLAL - 461 -
HLA-DRB1*11:02 PLVDLPIGINITRFQTLLA - 462 -
HLA-DRB1*13:01 PLVDLPIGINITRFQTLLA - 462 -
HLA-DPA1*02:02/DPB1*13:01 LVDLPIGINITRFQTLL - 464 -
HLA-DPA1*03:01/DPB1*17:01 LVDLPIGINITRFQTLLAL - 465 -
HLA-DPA1*04:01/DPB1*05:01 EPLVDLPIGINITRFQTLL - 468 -
HLA-DPA1*04:01/DPB1*11:01 LEPLVDLPIGINITRFQTLL - 470 -
HLA-DRB1*08:04 EPLVDLPIGINITRFQTLLA - 470 -
HLA-DPA1*03:01/DPB1*05:01 PLVDLPIGINITRFQTLL - 472 -
HLA-DPA1*03:01/DPB1*17:01 LEPLVDLPIGINITRFQTLL - 472 -
HLA-DRB1*15:03 EPLVDLPIGINITRFQTLLA - 477 -
HLA-DPA1*03:01/DPB1*06:01 LVDLPIGINITRFQTLL - 479 -
HLA-DPA1*02:01/DPB1*04:01 LVDLPIGINITRFQTLLA - 483 -
HLA-DPA1*04:01/DPB1*13:01 EPLVDLPIGINITRFQTLL - 484 -
HLA-DPA1*03:01/DPB1*09:01 EPLVDLPIGINITRFQTLLA - 485 -
HLA-DPA1*01:03/DPB1*05:01 PLVDLPIGINITRFQTLLAL - 486 -
HLA-DQA1*02:01/DQB1*03:01 ALHRSYLTPGDSSSGW - 487 -
HLA-DQA1*02:01/DQB1*03:19 ALHRSYLTPGDSSSGW - 487 -
HLA-DRB1*01:01 EPLVDLPIGINITRFQTLL - 494 -
HLA-DPA1*03:01/DPB1*85:01 LEPLVDLPIGINITRFQTLL - 495 -
HLA-DPA1*04:01/DPB1*06:01 EPLVDLPIGINITRFQTLLA - 497 -
HLA-DPA1*02:02/DPB1*11:01 EPLVDLPIGINITRFQTLLA - 498 -
HLA-DRB1*10:01 LLALHRSYLTPGDSSSGWT - 498 -
HLA-DPA1*04:01/DPB1*11:01 LVDLPIGINITRFQTLLAL - 499 -
HLA-DPA1*03:01/DPB1*09:01 LVDLPIGINITRFQTLLAL - 500 -
HLA-DRB1*15:01 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 44 5595
HLA-DRB1*15:01 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 79 7830
HLA-DRB1*15:01 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 72 6526
HLA-DRB1*15:01 TLLALHRSYLTPGDSSSGW TLHRSYLTPGDSSSGW 119 9302
HLA-DRB1*15:03 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 89 6154
HLA-DRB1*11:02 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 92 5734
HLA-DRB1*13:01 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 92 5734
HLA-DRB1*15:03 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 152 8258
HLA-DRB1*15:01 LLALHRSYLTPGDSSSGWTA LHRSYLTPGDSSSGWTX 185 9470
HLA-DRB1*15:01 FQTLLALHRSYLTPGDSSSG FQTLHRSYLTPGDSSSG 36 1728
HLA-DRB1*11:02 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 143 6629
HLA-DRB1*13:01 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 143 6629
HLA-DRB1*15:03 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 157 7136
HLA-DRB1*11:04 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 98 4362
HLA-DRB1*11:02 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 171 7506
HLA-DRB1*13:01 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 171 7506
HLA-DRB1*11:04 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 122 5169
HLA-DRB1*11:01 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 157 6258
HLA-DRB1*15:02 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 197 7473
HLA-DRB1*15:03 TLLALHRSYLTPGDSSSGW TLHRSYLTPGDSSSGW 253 9340
HLA-DRB1*11:02 TLLALHRSYLTPGDSSSGW TLHRSYLTPGDSSSGW 241 8731
HLA-DRB1*13:01 TLLALHRSYLTPGDSSSGW TLHRSYLTPGDSSSGW 241 8731
HLA-DRB1*15:01 FQTLLALHRSYLTPGDSSS FQTLHRSYLTPGDSSS 60 2072
HLA-DRB1*15:03 FQTLLALHRSYLTPGDSSSG FQTLHRSYLTPGDSSSG 72 2398
HLA-DRB1*11:01 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 226 7198
HLA-DRB1*07:01 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 166 5206
HLA-DRB1*13:02 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 258 7415
HLA-DRB1*15:02 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 331 9476
HLA-DPA1*01:03/DPB1*03:01 LPIGINITRFQTLLALHRSY LPIGINITRFQTLHRSY 74 2084
HLA-DRB1*15:03 LLALHRSYLTPGDSSSGWTA LHRSYLTPGDSSSGWTX 352 9853
HLA-DPA1*01:03/DPB1*03:01 DLPIGINITRFQTLLALHRS DLPIGINITRFQTLHRS 93 2576
HLA-DPA1*01:03/DPB1*03:01 NITRFQTLLALHRSYLTPGD NITRFQTLHRSYLTPGD 83 2205
HLA-DRB1*15:02 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 319 8182
HLA-DPA1*01:03/DPB1*06:01 NITRFQTLLALHRSYLTPGD NITRFQTLHRSYLTPGD 89 2257
HLA-DRB1*16:01 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 225 5676
HLA-DPA1*01:03/DPB1*17:01 NITRFQTLLALHRSYLTPGD NITRFQTLHRSYLTPGD 161 4050
HLA-DRB1*11:04 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 226 5629
HLA-DRB1*11:04 TLLALHRSYLTPGDSSSGW TLHRSYLTPGDSSSGW 273 6604
HLA-DPA1*01:03/DPB1*03:01 VDLPIGINITRFQTLLALHR VDLPIGINITRFQTLHR 135 3233
HLA-DPA1*01:03/DPB1*03:01 INITRFQTLLALHRSYLTPG INITRFQTLHRSYLTPG 75 1767
HLA-DRB1*15:01 RFQTLLALHRSYLTPGDSSS RFQTLHRSYLTPGDSSS 33 766
HLA-DRB1*11:01 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 348 7963
HLA-DRB1*07:01 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 287 6565
HLA-DRB1*07:01 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 262 5913
HLA-DRB1*11:02 LLALHRSYLTPGDSSSGWTA LHRSYLTPGDSSSGWTX 416 9346
HLA-DRB1*13:01 LLALHRSYLTPGDSSSGWTA LHRSYLTPGDSSSGWTX 416 9346
HLA-DRB1*15:03 FQTLLALHRSYLTPGDSSS FQTLHRSYLTPGDSSS 123 2705
HLA-DRB1*12:02 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 396 8699
HLA-DRB1*13:02 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 444 9676
HLA-DPA1*01:03/DPB1*03:01 GINITRFQTLLALHRSYLTP GINITRFQTLHRSYLTP 72 1553
HLA-DRB1*11:02 FQTLLALHRSYLTPGDSSSG FQTLHRSYLTPGDSSSG 78 1649
HLA-DRB1*13:01 FQTLLALHRSYLTPGDSSSG FQTLHRSYLTPGDSSSG 78 1649
HLA-DPA1*01:03/DPB1*03:01 PIGINITRFQTLLALHRSYL PIGINITRFQTLHRSYL 72 1508
HLA-DRB1*08:04 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 218 4542
HLA-DRB1*12:02 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 460 9561
HLA-DRB1*15:02 FQTLLALHRSYLTPGDSSSG FQTLHRSYLTPGDSSSG 163 3363
HLA-DRB1*01:01 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 97 2001
HLA-DPA1*01:03/DPB1*03:01 IGINITRFQTLLALHRSYLT IGINITRFQTLHRSYLT 71 1432
HLA-DPA1*01:03/DPB1*03:01 PIGINITRFQTLLALHRSY PIGINITRFQTLHRSY 115 2274
HLA-DPA1*03:01/DPB1*02:01 QTLLALHRSYLTPGDSSSGW QTLHRSYLTPGDSSSGW 270 5316
HLA-DPA1*01:03/DPB1*17:01 INITRFQTLLALHRSYLTPG INITRFQTLHRSYLTPG 146 2767
HLA-DRB1*16:01 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 359 6741
HLA-DRB1*11:01 TLLALHRSYLTPGDSSSGW TLHRSYLTPGDSSSGW 485 9075
HLA-DPA1*01:03/DPB1*10:01 NITRFQTLLALHRSYLTPGD NITRFQTLHRSYLTPGD 261 4872
HLA-DPA1*03:01/DPB1*17:01 NITRFQTLLALHRSYLTPGD NITRFQTLHRSYLTPGD 131 2435
HLA-DRB1*15:01 TRFQTLLALHRSYLTPGDSS TRFQTLHRSYLTPGDSS 31 573
HLA-DPA1*01:03/DPB1*06:01 INITRFQTLLALHRSYLTPG INITRFQTLHRSYLTPG 83 1532
HLA-DRB1*15:03 RFQTLLALHRSYLTPGDSSS RFQTLHRSYLTPGDSSS 62 1142
HLA-DPA1*01:03/DPB1*11:01 NITRFQTLLALHRSYLTPGD NITRFQTLHRSYLTPGD 109 2003
HLA-DPA1*03:01/DPB1*02:01 TLLALHRSYLTPGDSSSGWT TLHRSYLTPGDSSSGWT 398 7286
HLA-DRB1*13:02 QTLLALHRSYLTPGDSSSG QTLHRSYLTPGDSSSG 402