Summary

This strain contains 20 protein-level mutations:

  • 8 mutations in Spike protein: Q52R, A67V, HV 69-70 deletion, Y144 deletion, E484K, D614G, Q677H, F888L
  • 4 mutations in N protein: S2 deletion, D3Y, A12G, T205I
  • 1 mutation in M protein: I82T
  • 1 mutation in E protein: L21F
  • 1 mutation in NS6 protein: F2 deletion
  • 1 mutation in NS9b protein: H9D
  • 1 mutation in NS9c protein: L52F
  • 1 mutation in NSP3 protein: T1189I
  • 1 mutation in NSP6 protein: SGF 106-108 deletion
  • 1 mutation in NSP12 protein: P323F

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

Q52R

Reference  AYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    AYTNSFTRGVYYPDKVFRSSVLHSTRDLFLPFFSNVTWFHVI‑‑SGTNGTK

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*15:03 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 62 399
HLA-DRB1*11:04 RSSVLHSTQDLFLPF RSSVLHSTRDLFLPF 2026 326
HLA-DRB1*15:03 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 501 88
HLA-DRB1*15:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 31 166
HLA-DRB1*11:02 RSSVLHSTQDLFLPF RSSVLHSTRDLFLPF 681 128
HLA-DRB1*13:01 RSSVLHSTQDLFLPF RSSVLHSTRDLFLPF 681 128
HLA-DRB1*03:01 FRSSVLHSTQDLFLP FRSSVLHSTRDLFLP 847 164
HLA-DRB1*01:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 262 1346
HLA-DRB1*03:01 VFRSSVLHSTQDLFL VFRSSVLHSTRDLFL 901 183
HLA-DRB1*11:02 RSSVLHSTQDLFLPFFS RSSVLHSTRDLFLPFFS 1716 349
HLA-DRB1*13:01 RSSVLHSTQDLFLPFFS RSSVLHSTRDLFLPFFS 1716 349
HLA-DRB1*15:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 222 46
HLA-DRB1*11:02 SSVLHSTQDLFLPFF SSVLHSTRDLFLPFF 968 202
HLA-DRB1*13:01 SSVLHSTQDLFLPFF SSVLHSTRDLFLPFF 968 202
HLA-DRB1*11:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 297 1410
HLA-DRB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 297 1410
HLA-DRB1*11:02 RSSVLHSTQDLFLPFF RSSVLHSTRDLFLPFF 1773 378
HLA-DRB1*13:01 RSSVLHSTQDLFLPFF RSSVLHSTRDLFLPFF 1773 378
HLA-DRB1*03:01 RSSVLHSTQDLFLPF RSSVLHSTRDLFLPF 570 127
HLA-DRB1*03:01 VFRSSVLHSTQDLFLP VFRSSVLHSTRDLFLP 1973 447
HLA-DRB1*01:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 243 56
HLA-DRB1*03:01 VFRSSVLHSTQDLFLPF VFRSSVLHSTRDLFLPF 1132 261
HLA-DRB1*15:03 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 88 377
HLA-DRB1*11:02 FRSSVLHSTQDLFLPFF FRSSVLHSTRDLFLPFF 1211 284
HLA-DRB1*13:01 FRSSVLHSTQDLFLPFF FRSSVLHSTRDLFLPFF 1211 284
HLA-DRB1*03:01 FRSSVLHSTQDLFLPF FRSSVLHSTRDLFLPF 1335 314
HLA-DRB1*11:04 FRSSVLHSTQDLFLP FRSSVLHSTRDLFLP 1388 327
HLA-DRB1*03:01 FRSSVLHSTQDLFLPFF FRSSVLHSTRDLFLPFF 1117 265
HLA-DRB1*16:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 194 47
HLA-DRB1*03:01 KVFRSSVLHSTQDLFLP KVFRSSVLHSTRDLFLP 1471 359
HLA-DRB1*07:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 298 73
HLA-DRB1*11:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 360 1468
HLA-DRB1*13:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 360 1468
HLA-DRB1*03:01 KVFRSSVLHSTQDLFL KVFRSSVLHSTRDLFL 1914 470
HLA-DRB1*08:04 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 430 1747
HLA-DRB1*03:01 RSSVLHSTQDLFLPFFS RSSVLHSTRDLFLPFFS 1150 285
HLA-DRB1*11:02 SVLHSTQDLFLPFFS SVLHSTRDLFLPFFS 1290 321
HLA-DRB1*13:01 SVLHSTQDLFLPFFS SVLHSTRDLFLPFFS 1290 321
HLA-DRB1*03:01 RSSVLHSTQDLFLPFF RSSVLHSTRDLFLPFF 1295 323
HLA-DRB1*01:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 337 1339
HLA-DRB1*01:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 54 214
HLA-DRB1*03:01 DKVFRSSVLHSTQDLFL DKVFRSSVLHSTRDLFL 1583 408
HLA-DRB1*11:04 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 445 1726
HLA-DRB1*11:02 FRSSVLHSTQDLFLP FRSSVLHSTRDLFLP 534 140
HLA-DRB1*13:01 FRSSVLHSTQDLFLP FRSSVLHSTRDLFLP 534 140
HLA-DRB1*11:02 FRSSVLHSTQDLFLPF FRSSVLHSTRDLFLPF 1273 335
HLA-DRB1*13:01 FRSSVLHSTQDLFLPF FRSSVLHSTRDLFLPF 1273 335
HLA-DRB1*03:01 SSVLHSTQDLFLPFF SSVLHSTRDLFLPFF 765 206
HLA-DRB1*03:01 KVFRSSVLHSTQDLF KVFRSSVLHSTRDLF 1271 346
HLA-DRB1*07:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 63 231
HLA-DRB1*03:01 VFRSSVLHSTQDLFLPFFS VFRSSVLHSTRDLFLPFFS 1568 428
HLA-DRB1*03:01 KVFRSSVLHSTQDLFLPFF KVFRSSVLHSTRDLFLPFF 1424 399
HLA-DRB1*03:01 DKVFRSSVLHSTQDLFLPF DKVFRSSVLHSTRDLFLPF 1434 404
HLA-DRB1*01:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1439 408
HLA-DRB1*14:01 RSSVLHSTQDLFLPF RSSVLHSTRDLFLPF 493 140
HLA-DRB1*03:01 FRSSVLHSTQDLFLPFFSN FRSSVLHSTRDLFLPFFSN 1604 456
HLA-DRB1*07:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 66 232
HLA-DRB1*13:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 272 954
HLA-DRB1*01:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 60 209
HLA-DRB1*03:01 VFRSSVLHSTQDLFLPFFSN VFRSSVLHSTRDLFLPFFSN 1594 459
HLA-DRB1*03:01 DKVFRSSVLHSTQDLFLPFF DKVFRSSVLHSTRDLFLPFF 1459 422
HLA-DRB1*11:02 FRSSVLHSTQDLFLPFFSN FRSSVLHSTRDLFLPFFSN 1690 489
HLA-DRB1*13:01 FRSSVLHSTQDLFLPFFSN FRSSVLHSTRDLFLPFFSN 1690 489
HLA-DRB1*11:02 FRSSVLHSTQDLFLPFFSNV FRSSVLHSTRDLFLPFFSNV 1161 337
HLA-DRB1*13:01 FRSSVLHSTQDLFLPFFSNV FRSSVLHSTRDLFLPFFSNV 1161 337
HLA-DRB1*03:01 KVFRSSVLHSTQDLFLPFFS KVFRSSVLHSTRDLFLPFFS 1481 434
HLA-DRB1*03:01 FRSSVLHSTQDLFLPFFSNV FRSSVLHSTRDLFLPFFSNV 1692 498
HLA-DRB1*15:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 43 145
HLA-DRB1*03:01 PDKVFRSSVLHSTQDLFLPF PDKVFRSSVLHSTRDLFLPF 1428 424
HLA-DPA1*01:03/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 270 81
HLA-DRB1*13:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 249 829
HLA-DPA1*01:03/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 183 55
HLA-DRB1*15:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 58 192
HLA-DPA1*02:01/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 928 283
HLA-DRB1*11:02 RSSVLHSTQDLFLPFFSNVT RSSVLHSTRDLFLPFFSNVT 1179 362
HLA-DRB1*13:01 RSSVLHSTQDLFLPFFSNVT RSSVLHSTRDLFLPFFSNVT 1179 362
HLA-DRB1*11:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 374 1216
HLA-DQA1*05:01/DQB1*04:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 256 827
HLA-DRB1*14:01 FRSSVLHSTQDLFLP FRSSVLHSTRDLFLP 553 173
HLA-DRB1*11:02 VFRSSVLHSTQDLFLPF VFRSSVLHSTRDLFLPF 754 238
HLA-DRB1*13:01 VFRSSVLHSTQDLFLPF VFRSSVLHSTRDLFLPF 754 238
HLA-DQA1*02:01/DQB1*04:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 373 1171
HLA-DRB1*11:04 VFRSSVLHSTQDLFLPF VFRSSVLHSTRDLFLPF 1287 414
HLA-DRB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 356 1102
HLA-DQA1*01:03/DQB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 75 231
HLA-DRB1*14:01 VFRSSVLHSTQDLFL VFRSSVLHSTRDLFL 449 149
HLA-DRB1*15:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 234 78
HLA-DRB1*14:01 SSVLHSTQDLFLPFF SSVLHSTRDLFLPFF 550 185
HLA-DPA1*04:01/DPB1*03:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 406 1193
HLA-DQA1*01:03/DQB1*05:03 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 248 723
HLA-DRB1*14:01 FRSSVLHSTQDLFLPF FRSSVLHSTRDLFLPF 973 334
HLA-DRB1*14:01 RSSVLHSTQDLFLPFF RSSVLHSTRDLFLPFF 969 333
HLA-DPA1*02:02/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 639 221
HLA-DRB1*11:04 VFRSSVLHSTQDLFLPFFSN VFRSSVLHSTRDLFLPFFSN 1286 446
HLA-DRB1*11:02 VFRSSVLHSTQDLFLPFFSN VFRSSVLHSTRDLFLPFFSN 774 270
HLA-DRB1*13:01 VFRSSVLHSTQDLFLPFFSN VFRSSVLHSTRDLFLPFFSN 774 270
HLA-DRB1*08:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 430 1228
HLA-DRB1*08:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 384 1095
HLA-DRB1*11:02 VFRSSVLHSTQDLFLPFFS VFRSSVLHSTRDLFLPFFS 1121 396
HLA-DRB1*13:01 VFRSSVLHSTQDLFLPFFS VFRSSVLHSTRDLFLPFFS 1121 396
HLA-DRB1*11:02 VFRSSVLHSTQDLFL VFRSSVLHSTRDLFL 331 117
HLA-DRB1*13:01 VFRSSVLHSTQDLFL VFRSSVLHSTRDLFL 331 117
HLA-DRB1*14:01 RSSVLHSTQDLFLPFFS RSSVLHSTRDLFLPFFS 871 309
HLA-DPA1*04:01/DPB1*17:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 324 911
HLA-DPA1*04:01/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 140 50
HLA-DRB1*15:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 65 181
HLA-DRB1*14:01 RSSVLHSTQDLFLPFFSNV RSSVLHSTRDLFLPFFSNV 1108 400
HLA-DRB1*03:01 SVLHSTQDLFLPFFS SVLHSTRDLFLPFFS 986 360
HLA-DRB1*11:02 VFRSSVLHSTQDLFLP VFRSSVLHSTRDLFLP 991 362
HLA-DRB1*13:01 VFRSSVLHSTQDLFLP VFRSSVLHSTRDLFLP 991 362
HLA-DPA1*04:01/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 213 78
HLA-DRB1*14:01 FRSSVLHSTQDLFLPFFSN FRSSVLHSTRDLFLPFFSN 983 360
HLA-DRB1*14:01 VFRSSVLHSTQDLFLPF VFRSSVLHSTRDLFLPF 732 269
HLA-DRB1*14:01 FRSSVLHSTQDLFLPFF FRSSVLHSTRDLFLPFF 764 281
HLA-DRB1*16:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 59 160
HLA-DPA1*04:01/DPB1*09:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 335 908
HLA-DRB1*11:04 VFRSSVLHSTQDLFL VFRSSVLHSTRDLFL 634 234
HLA-DRB1*14:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1300 480
HLA-DRB1*14:01 FRSSVLHSTQDLFLPFFSNV FRSSVLHSTRDLFLPFFSNV 841 311
HLA-DPA1*04:01/DPB1*10:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 380 1027
HLA-DQA1*01:03/DQB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 84 227
HLA-DPA1*01:03/DPB1*04:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 980 365
HLA-DPA1*01:03/DPB1*105:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 980 365
HLA-DPA1*03:01/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 99 37
HLA-DPA1*04:01/DPB1*14:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 420 1118
HLA-DRB1*14:01 VFRSSVLHSTQDLFLPFFS VFRSSVLHSTRDLFLPFFS 850 322
HLA-DPA1*04:01/DPB1*85:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 322 842
HLA-DPA1*03:01/DPB1*17:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 280 730
HLA-DRB1*04:04 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 344 132
HLA-DPA1*02:01/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 508 195
HLA-DPA1*02:02/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 463 178
HLA-DRB1*14:01 RSSVLHSTQDLFLPFFSNVT RSSVLHSTRDLFLPFFSNVT 846 326
HLA-DRB1*14:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 495 1283
HLA-DPA1*03:01/DPB1*10:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 496 1285
HLA-DRB1*14:04 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 412 1067
HLA-DQA1*01:02/DQB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 46 119
HLA-DRB1*14:01 SSVLHSTQDLFLPFFS SSVLHSTRDLFLPFFS 1243 483
HLA-DRB1*14:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 471 1212
HLA-DRB1*14:01 DKVFRSSVLHSTQDLFLPF DKVFRSSVLHSTRDLFLPF 725 286
HLA-DPA1*03:01/DPB1*04:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 240 95
HLA-DPA1*03:01/DPB1*105:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 240 95
HLA-DPA1*03:01/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 58 23
HLA-DRB1*14:01 VFRSSVLHSTQDLFLP VFRSSVLHSTRDLFLP 1036 411
HLA-DPA1*03:01/DPB1*09:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 402 1012
HLA-DRB1*14:01 VFRSSVLHSTQDLFLPFFSN VFRSSVLHSTRDLFLPFFSN 694 276
HLA-DPA1*04:01/DPB1*17:01 LHSTQDLFLPFFSNV LHSTRDLFLPFFSNV 1173 467
HLA-DRB1*14:01 SSVLHSTQDLFLPFFSN SSVLHSTRDLFLPFFSN 1123 449
HLA-DPA1*01:03/DPB1*11:01 LHSTQDLFLPFFSNV LHSTRDLFLPFFSNV 885 356
HLA-DPA1*01:03/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 308 765
HLA-DPA1*04:01/DPB1*06:01 VLHSTQDLFLPFFSN VLHSTRDLFLPFFSN 1078 435
HLA-DRB1*14:04 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 442 1093
HLA-DPA1*04:01/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 213 525
HLA-DPA1*04:01/DPB1*06:01 LHSTQDLFLPFFSNV LHSTRDLFLPFFSNV 681 278
HLA-DPA1*01:03/DPB1*05:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 945 386
HLA-DPA1*02:02/DPB1*11:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1096 448
HLA-DPA1*04:01/DPB1*11:01 LHSTQDLFLPFFSNV LHSTRDLFLPFFSNV 739 303
HLA-DPA1*01:03/DPB1*11:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1044 430
HLA-DRB1*14:01 KVFRSSVLHSTQDLFLPFF KVFRSSVLHSTRDLFLPFF 687 283
HLA-DRB1*11:02 DKVFRSSVLHSTQDLFL DKVFRSSVLHSTRDLFL 582 241
HLA-DRB1*13:01 DKVFRSSVLHSTQDLFL DKVFRSSVLHSTRDLFL 582 241
HLA-DQA1*02:01/DQB1*04:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 482 1164
HLA-DPA1*04:01/DPB1*06:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 271 654
HLA-DRB1*16:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 61 147
HLA-DPA1*04:01/DPB1*06:01 HSTQDLFLPFFSNVT HSTRDLFLPFFSNVT 516 215
HLA-DRB1*14:01 KVFRSSVLHSTQDLFL KVFRSSVLHSTRDLFL 832 348
HLA-DRB1*14:01 SVLHSTQDLFLPFFS SVLHSTRDLFLPFFS 717 300
HLA-DRB1*11:02 KVFRSSVLHSTQDLFL KVFRSSVLHSTRDLFL 657 275
HLA-DRB1*13:01 KVFRSSVLHSTQDLFL KVFRSSVLHSTRDLFL 657 275
HLA-DRB1*13:02 SSVLHSTQDLFLPFF SSVLHSTRDLFLPFF 795 333
HLA-DPA1*04:01/DPB1*17:01 VLHSTQDLFLPFFSNV VLHSTRDLFLPFFSNV 1186 497
HLA-DRB1*11:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1004 421
HLA-DQA1*01:03/DQB1*05:03 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 297 707
HLA-DRB1*04:07 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 379 897
HLA-DPA1*03:01/DPB1*17:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 924 391
HLA-DQA1*01:02/DQB1*05:03 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 159 375
HLA-DRB1*14:01 KVFRSSVLHSTQDLFLPFFS KVFRSSVLHSTRDLFLPFFS 570 242
HLA-DQA1*05:01/DQB1*04:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 348 814
HLA-DRB1*14:01 PDKVFRSSVLHSTQDLFLPF PDKVFRSSVLHSTRDLFLPF 557 239
HLA-DPA1*03:01/DPB1*06:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 685 294
HLA-DRB1*14:01 DKVFRSSVLHSTQDLFLPFF DKVFRSSVLHSTRDLFLPFF 561 241
HLA-DPA1*01:03/DPB1*06:01 LHSTQDLFLPFFSNV LHSTRDLFLPFFSNV 913 393
HLA-DPA1*04:01/DPB1*04:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 619 267
HLA-DPA1*04:01/DPB1*105:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 619 267
HLA-DRB1*11:02 KVFRSSVLHSTQDLFLPFF KVFRSSVLHSTRDLFLPFF 671 290
HLA-DRB1*13:01 KVFRSSVLHSTQDLFLPFF KVFRSSVLHSTRDLFLPFF 671 290
HLA-DPA1*01:03/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 393 909
HLA-DRB1*13:02 RSSVLHSTQDLFLPF RSSVLHSTRDLFLPF 661 286
HLA-DRB1*10:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 42 97
HLA-DPA1*03:01/DPB1*10:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 488 1127
HLA-DRB1*11:02 DKVFRSSVLHSTQDLFLPF DKVFRSSVLHSTRDLFLPF 723 314
HLA-DRB1*13:01 DKVFRSSVLHSTQDLFLPF DKVFRSSVLHSTRDLFLPF 723 314
HLA-DPA1*03:01/DPB1*06:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 231 531
HLA-DPA1*03:01/DPB1*85:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 339 779
HLA-DPA1*04:01/DPB1*09:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 360 827
HLA-DPA1*04:01/DPB1*11:01 VLHSTQDLFLPFFSN VLHSTRDLFLPFFSN 992 432
HLA-DPA1*04:01/DPB1*26:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 414 949
HLA-DPA1*02:02/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 401 919
HLA-DRB1*11:04 KVFRSSVLHSTQDLFLPFF KVFRSSVLHSTRDLFLPFF 1105 484
HLA-DPA1*02:02/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 367 835
HLA-DPA1*04:01/DPB1*17:01 HSTQDLFLPFFSNVT HSTRDLFLPFFSNVT 863 380
HLA-DPA1*04:01/DPB1*03:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 461 1042
HLA-DPA1*01:03/DPB1*11:01 SVLHSTQDLFLPFFSNV SVLHSTRDLFLPFFSNV 912 404
HLA-DPA1*03:01/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 161 363
HLA-DRB1*14:04 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1062 472
HLA-DPA1*01:03/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 361 810
HLA-DPA1*04:01/DPB1*06:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 733 327
HLA-DPA1*03:01/DPB1*05:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 437 195
HLA-DRB1*11:04 KVFRSSVLHSTQDLFLPFFS KVFRSSVLHSTRDLFLPFFS 722 323
HLA-DPA1*04:01/DPB1*17:01 LHSTQDLFLPFFSNVT LHSTRDLFLPFFSNVT 914 410
HLA-DRB1*11:02 KVFRSSVLHSTQDLFLP KVFRSSVLHSTRDLFLP 493 222
HLA-DRB1*13:01 KVFRSSVLHSTQDLFLP KVFRSSVLHSTRDLFLP 493 222
HLA-DPA1*02:02/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 336 746
HLA-DPA1*01:03/DPB1*11:01 HSTQDLFLPFFSNVT HSTRDLFLPFFSNVT 695 314
HLA-DQA1*01:02/DQB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 52 115
HLA-DPA1*01:03/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 305 674
HLA-DRB1*11:02 KVFRSSVLHSTQDLFLPFFS KVFRSSVLHSTRDLFLPFFS 464 210
HLA-DRB1*13:01 KVFRSSVLHSTQDLFLPFFS KVFRSSVLHSTRDLFLPFFS 464 210
HLA-DRB1*04:07 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 823 373
HLA-DRB1*11:04 DKVFRSSVLHSTQDLFLPF DKVFRSSVLHSTRDLFLPF 1058 480
HLA-DRB1*14:01 DKVFRSSVLHSTQDLFL DKVFRSSVLHSTRDLFL 676 307
HLA-DPA1*04:01/DPB1*85:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 338 744
HLA-DRB1*04:07 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 393 860
HLA-DPA1*02:02/DPB1*01:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 249 114
HLA-DPA1*04:01/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 199 434
HLA-DPA1*04:01/DPB1*06:01 VLHSTQDLFLPFFSNV VLHSTRDLFLPFFSNV 715 328
HLA-DRB1*10:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 85 39
HLA-DRB1*14:01 PDKVFRSSVLHSTQDLFLP PDKVFRSSVLHSTRDLFLP 784 360
HLA-DPA1*03:01/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 206 448
HLA-DRB1*11:02 DKVFRSSVLHSTQDLFLPFF DKVFRSSVLHSTRDLFLPFF 439 202
HLA-DRB1*13:01 DKVFRSSVLHSTQDLFLPFF DKVFRSSVLHSTRDLFLPFF 439 202
HLA-DRB1*11:04 DKVFRSSVLHSTQDLFLPFF DKVFRSSVLHSTRDLFLPFF 628 289
HLA-DQA1*01:03/DQB1*06:09 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 296 643
HLA-DPA1*03:01/DPB1*85:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 321 697
HLA-DRB1*14:01 KVFRSSVLHSTQDLFLP KVFRSSVLHSTRDLFLP 664 306
HLA-DRB1*10:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 42 91
HLA-DPA1*04:01/DPB1*06:01 VLHSTQDLFLPFFSNVT VLHSTRDLFLPFFSNVT 654 302
HLA-DPA1*04:01/DPB1*06:01 SVLHSTQDLFLPFFSNV SVLHSTRDLFLPFFSNV 844 390
HLA-DPA1*01:03/DPB1*11:01 VLHSTQDLFLPFFSNV VLHSTRDLFLPFFSNV 787 364
HLA-DPA1*04:01/DPB1*17:01 VLHSTQDLFLPFFSNVT VLHSTRDLFLPFFSNVT 1063 492
HLA-DPA1*04:01/DPB1*14:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 459 990
HLA-DQA1*01:01/DQB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 319 686
HLA-DPA1*04:01/DPB1*11:01 HSTQDLFLPFFSNVT HSTRDLFLPFFSNVT 573 267
HLA-DPA1*02:02/DPB1*13:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 839 391
HLA-DPA1*03:01/DPB1*13:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 187 401
HLA-DRB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 235 110
HLA-DRB1*14:01 SSVLHSTQDLFLPFFSNVTW SSVLHSTRDLFLPFFSNVTW 1059 496
HLA-DPA1*04:01/DPB1*06:01 LHSTQDLFLPFFSNVT LHSTRDLFLPFFSNVT 572 268
HLA-DRB1*11:04 KVFRSSVLHSTQDLFL KVFRSSVLHSTRDLFL 771 362
HLA-DPA1*04:01/DPB1*06:01 HSTQDLFLPFFSNVTW HSTRDLFLPFFSNVTW 553 260
HLA-DPA1*04:01/DPB1*06:01 LHSTQDLFLPFFSNVTW LHSTRDLFLPFFSNVTW 621 292
HLA-DPA1*01:03/DPB1*06:01 VLHSTQDLFLPFFSNV VLHSTRDLFLPFFSNV 1041 492
HLA-DPA1*03:01/DPB1*17:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 281 593
HLA-DRB1*11:02 PDKVFRSSVLHSTQDLFLPF PDKVFRSSVLHSTRDLFLPF 405 192
HLA-DRB1*13:01 PDKVFRSSVLHSTQDLFLPF PDKVFRSSVLHSTRDLFLPF 405 192
HLA-DPA1*01:03/DPB1*02:01 QDLFLPFFSNVTWFHAIHV RDLFLPFFSNVTWFHVI 116 55
HLA-DPA1*01:03/DPB1*06:01 HSTQDLFLPFFSNVT HSTRDLFLPFFSNVT 660 313
HLA-DPA1*04:01/DPB1*06:01 SVLHSTQDLFLPFFSN SVLHSTRDLFLPFFSN 1052 499
HLA-DPA1*01:03/DPB1*11:01 LHSTQDLFLPFFSNVT LHSTRDLFLPFFSNVT 669 318
HLA-DPA1*04:01/DPB1*17:01 HSTQDLFLPFFSNVTW HSTRDLFLPFFSNVTW 839 399
HLA-DPA1*04:01/DPB1*17:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1037 494
HLA-DRB1*11:04 DKVFRSSVLHSTQDLFL DKVFRSSVLHSTRDLFL 610 291
HLA-DPA1*03:01/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 199 417
HLA-DPA1*04:01/DPB1*11:01 VLHSTQDLFLPFFSNV VLHSTRDLFLPFFSNV 640 306
HLA-DPA1*01:03/DPB1*11:01 VLHSTQDLFLPFFSNVT VLHSTRDLFLPFFSNVT 715 342
HLA-DPA1*01:03/DPB1*11:01 LHSTQDLFLPFFSNVTW LHSTRDLFLPFFSNVTW 687 329
HLA-DRB1*04:04 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 160 334
HLA-DPA1*02:02/DPB1*05:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 903 433
HLA-DRB1*04:04 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 164 342
HLA-DPA1*04:01/DPB1*06:01 STQDLFLPFFSNVTW STRDLFLPFFSNVTW 458 220
HLA-DPA1*04:01/DPB1*17:01 LHSTQDLFLPFFSNVTW LHSTRDLFLPFFSNVTW 968 465
HLA-DPA1*02:02/DPB1*11:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 411 854
HLA-DPA1*03:01/DPB1*09:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 426 885
HLA-DRB1*14:01 YPDKVFRSSVLHSTQDLFL YPDKVFRSSVLHSTRDLFL 783 377
HLA-DPA1*04:01/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 257 533
HLA-DPA1*01:03/DPB1*13:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 388 804
HLA-DRB1*14:01 YPDKVFRSSVLHSTQDLFLP YPDKVFRSSVLHSTRDLFLP 605 293
HLA-DPA1*04:01/DPB1*11:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 218 450
HLA-DRB1*11:02 PDKVFRSSVLHSTQDLFLP PDKVFRSSVLHSTRDLFLP 747 362
HLA-DRB1*13:01 PDKVFRSSVLHSTQDLFLP PDKVFRSSVLHSTRDLFLP 747 362
HLA-DPA1*01:03/DPB1*06:01 LHSTQDLFLPFFSNVT LHSTRDLFLPFFSNVT 784 380
HLA-DRB1*11:04 KVFRSSVLHSTQDLFLP KVFRSSVLHSTRDLFLP 592 287
HLA-DPA1*02:01/DPB1*04:01 QDLFLPFFSNVTWFHAIHV RDLFLPFFSNVTWFHVI 582 283
HLA-DPA1*01:03/DPB1*11:01 HSTQDLFLPFFSNVTW HSTRDLFLPFFSNVTW 625 305
HLA-DRB1*11:04 PDKVFRSSVLHSTQDLFLPF PDKVFRSSVLHSTRDLFLPF 533 261
HLA-DPA1*02:02/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 377 769
HLA-DPA1*04:01/DPB1*26:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 437 891
HLA-DPA1*04:01/DPB1*05:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 491 241
HLA-DPA1*04:01/DPB1*17:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 375 764
HLA-DPA1*04:01/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 192 391
HLA-DPA1*01:03/DPB1*06:01 HSTQDLFLPFFSNVTW HSTRDLFLPFFSNVTW 745 368
HLA-DPA1*01:03/DPB1*11:01 HSTQDLFLPFFSNVTWF HSTRDLFLPFFSNVTWF 637 316
HLA-DPA1*04:01/DPB1*06:01 HSTQDLFLPFFSNVTWF HSTRDLFLPFFSNVTWF 548 272
HLA-DRB1*08:04 VFRSSVLHSTQDLFL VFRSSVLHSTRDLFL 834 414
HLA-DPA1*04:01/DPB1*17:01 HSTQDLFLPFFSNVTWF HSTRDLFLPFFSNVTWF 833 414
HLA-DPA1*04:01/DPB1*11:01 SVLHSTQDLFLPFFSNV SVLHSTRDLFLPFFSNV 682 339
HLA-DPA1*04:01/DPB1*11:01 LHSTQDLFLPFFSNVT LHSTRDLFLPFFSNVT 512 255
HLA-DPA1*04:01/DPB1*85:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 931 464
HLA-DPA1*03:01/DPB1*85:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 949 473
HLA-DPA1*04:01/DPB1*17:01 STQDLFLPFFSNVTW STRDLFLPFFSNVTW 751 375
HLA-DPA1*01:03/DPB1*01:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 232 116
HLA-DPA1*02:02/DPB1*04:01 QDLFLPFFSNVTWFHAIHV RDLFLPFFSNVTWFHVI 442 221

A67V

Reference  VFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    VFRSSVLHSTRDLFLPFFSNVTWFHVI‑‑SGTNGTKRFDNPVLPFNDGVYF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*15:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 48 1759
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 38 1315
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 35 1124
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 79 2362
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 86 2562
HLA-DRB1*15:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 77 2245
HLA-DRB1*15:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 33 954
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 94 2628
HLA-DRB1*13:02 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 244 6798
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 114 3143
HLA-DRB1*15:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 74 2030
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 32 852
HLA-DRB1*13:02 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 206 5136
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 31 723
HLA-DRB1*13:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 185 4153
HLA-DRB1*15:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 68 1511
HLA-DRB1*13:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 148 3191
HLA-DRB1*13:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 133 2851
HLA-DRB1*04:04 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 342 7235
HLA-DRB1*13:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 170 3442
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 666 34
HLA-DRB1*15:03 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 213 3911
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 107 1940
HLA-DRB1*15:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 135 2443
HLA-DRB1*15:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 31 543
HLA-DRB1*15:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 62 1069
HLA-DRB1*13:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 199 3393
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 94 1572
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 350 21
HLA-DRB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 31 516
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFDN WFHVISGTNGTKRFDN 1140 73
HLA-DQA1*01:03/DQB1*06:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 346 5381
HLA-DRB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 35 527
HLA-DRB1*04:04 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 261 3889
HLA-DRB1*15:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 84 1202
HLA-DRB1*04:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 412 5701
HLA-DRB1*15:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 214 2885
HLA-DQA1*01:03/DQB1*06:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 252 3392
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 269 20
HLA-DQA1*01:03/DQB1*06:02 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 476 6350
HLA-DRB1*15:03 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 62 801
HLA-DRB1*07:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 425 5430
HLA-DQA1*02:01/DQB1*03:01 AIHVSGTNGTKRFDNPVLPF VISGTNGTKRFDNPVLPF 358 4493
HLA-DQA1*02:01/DQB1*03:19 AIHVSGTNGTKRFDNPVLPF VISGTNGTKRFDNPVLPF 358 4493
HLA-DRB1*15:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 77 920
HLA-DRB1*04:04 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 210 2498
HLA-DRB1*15:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 31 366
HLA-DRB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 28 329
HLA-DRB1*07:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 90 1038
HLA-DQA1*02:01/DQB1*03:01 HAIHVSGTNGTKRFDNPVLP HVISGTNGTKRFDNPVLP 272 3110
HLA-DQA1*02:01/DQB1*03:19 HAIHVSGTNGTKRFDNPVLP HVISGTNGTKRFDNPVLP 272 3110
HLA-DRB1*15:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 275 3113
HLA-DRB1*01:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 218 2459
HLA-DQA1*01:03/DQB1*06:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 226 2549
HLA-DRB1*13:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 282 3161
HLA-DRB1*07:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 303 3291
HLA-DRB1*07:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 86 932
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 157 1679
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 157 1679
HLA-DRB1*01:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 230 2458
HLA-DQA1*05:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 153 1624
HLA-DQA1*05:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 153 1624
HLA-DQA1*02:01/DQB1*03:03 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 423 4450
HLA-DRB1*01:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 41 431
HLA-DRB1*16:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 3460 333
HLA-DQA1*05:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 146 1510
HLA-DQA1*05:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 146 1510
HLA-DQA1*02:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 290 2985
HLA-DQA1*02:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 121 1238
HLA-DQA1*02:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 121 1238
HLA-DQA1*05:01/DQB1*03:03 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 391 3972
HLA-DRB1*07:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 114 1156
HLA-DQA1*05:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 186 1858
HLA-DQA1*05:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 186 1858
HLA-DRB1*16:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 1658 166
HLA-DQA1*01:03/DQB1*06:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 207 2062
HLA-DQA1*05:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 272 2691
HLA-DRB1*01:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 224 2213
HLA-DQA1*05:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 168 1659
HLA-DQA1*05:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 168 1659
HLA-DQA1*02:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 93 915
HLA-DQA1*02:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 93 915
HLA-DQA1*01:02/DQB1*06:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 425 4178
HLA-DQA1*02:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 101 992
HLA-DQA1*02:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 101 992
HLA-DRB1*11:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 305 2991
HLA-DRB1*13:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 305 2991
HLA-DQA1*02:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 101 990
HLA-DQA1*02:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 101 990
HLA-DQA1*02:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 85 831
HLA-DQA1*02:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 85 831
HLA-DQA1*02:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 81 791
HLA-DQA1*02:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 81 791
HLA-DRB1*11:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 186 1812
HLA-DQA1*05:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 143 1385
HLA-DQA1*05:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 143 1385
HLA-DQA1*05:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 293 2830
HLA-DQA1*05:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 293 2830
HLA-DQA1*05:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 155 1495
HLA-DQA1*05:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 155 1495
HLA-DQA1*05:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 186 1788
HLA-DQA1*05:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 186 1788
HLA-DQA1*05:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 227 2172
HLA-DQA1*05:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 227 2172
HLA-DRB1*04:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 277 2640
HLA-DRB1*04:04 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 169 1605
HLA-DQA1*02:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 86 812
HLA-DQA1*02:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 86 812
HLA-DRB1*01:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 263 2481
HLA-DQA1*05:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 213 2006
HLA-DRB1*11:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 268 2517
HLA-DRB1*13:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 268 2517
HLA-DQA1*05:01/DQB1*04:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 251 2344
HLA-DRB1*07:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 85 791
HLA-DRB1*11:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 224 2076
HLA-DRB1*13:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 224 2076
HLA-DRB1*15:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 72 667
HLA-DQA1*02:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 80 734
HLA-DQA1*02:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 80 734
HLA-DRB1*07:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 235 2153
HLA-DQA1*02:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 237 2118
HLA-DRB1*11:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 192 1699
HLA-DRB1*07:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 75 663
HLA-DQA1*01:03/DQB1*06:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 218 1915
HLA-DRB1*16:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 95 830
HLA-DRB1*11:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 278 2393
HLA-DRB1*13:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 278 2393
HLA-DQA1*05:01/DQB1*04:02 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 389 3346
HLA-DQA1*02:01/DQB1*04:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 467 4012
HLA-DQA1*06:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 283 2430
HLA-DQA1*06:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 283 2430
HLA-DQA1*01:03/DQB1*06:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 219 1876
HLA-DRB1*11:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 285 2433
HLA-DRB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 285 2433
HLA-DRB1*16:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 1122 132
HLA-DQA1*05:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 179 1521
HLA-DPA1*03:01/DPB1*02:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 330 2797
HLA-DRB1*01:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 228 1913
HLA-DPA1*03:01/DPB1*02:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 223 1868
HLA-DQA1*06:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 347 2906
HLA-DQA1*06:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 347 2906
HLA-DQA1*01:03/DQB1*06:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 223 1848
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 91 11
HLA-DRB1*04:04 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 150 1235
HLA-DQA1*06:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 228 1876
HLA-DQA1*06:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 228 1876
HLA-DRB1*07:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 163 1341
HLA-DQA1*06:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 234 1925
HLA-DQA1*06:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 234 1925
HLA-DRB1*07:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 72 592
HLA-DQA1*06:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 455 3729
HLA-DQA1*06:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 455 3729
HLA-DQA1*06:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 247 2005
HLA-DQA1*06:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 247 2005
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 243 30
HLA-DQA1*05:01/DQB1*04:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 188 1516
HLA-DQA1*05:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 254 2040
HLA-DQA1*05:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 254 2040
HLA-DRB1*16:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 84 668
HLA-DQA1*05:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 165 1306
HLA-DRB1*11:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 281 2220
HLA-DRB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 281 2220
HLA-DQA1*06:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 244 1912
HLA-DQA1*06:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 244 1912
HLA-DQA1*02:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 201 1573
HLA-DRB1*07:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 65 506
HLA-DQA1*02:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 141 1095
HLA-DQA1*02:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 141 1095
HLA-DQA1*05:01/DQB1*04:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 140 1085
HLA-DQA1*05:01/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 361 2797
HLA-DQA1*05:01/DQB1*04:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 161 1239
HLA-DQA1*05:01/DQB1*04:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 136 1045
HLA-DQA1*01:03/DQB1*06:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 243 1856
HLA-DRB1*10:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 420 3203
HLA-DQA1*01:02/DQB1*06:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 369 2805
HLA-DRB1*16:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 104 790
HLA-DQA1*02:01/DQB1*04:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 337 2554
HLA-DRB1*04:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 197 1492
HLA-DRB1*10:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 21 158
HLA-DRB1*10:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 23 172
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 53 395
HLA-DQA1*05:01/DQB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 135 1003
HLA-DRB1*11:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 271 2010
HLA-DRB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 271 2010
HLA-DQA1*05:01/DQB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 133 981
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 154 21
HLA-DRB1*01:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 255 1866
HLA-DRB1*15:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 478 3493
HLA-DQA1*06:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 267 1946
HLA-DQA1*06:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 267 1946
HLA-DQA1*05:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 303 2208
HLA-DQA1*05:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 333 2405
HLA-DQA1*05:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 331 2389
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 69 497
HLA-DQA1*05:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 158 1132
HLA-DRB1*16:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 530 74
HLA-DQA1*01:03/DQB1*06:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 247 1760
HLA-DQA1*05:01/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 385 2731
HLA-DQA1*05:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 292 2069
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 128 906
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 106 744
HLA-DQA1*02:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 187 1310
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 56 8
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 48 336
HLA-DQA1*01:03/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 169 1177
HLA-DRB1*15:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 66 459
HLA-DQA1*05:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 164 1140
HLA-DRB1*04:04 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 146 1014
HLA-DQA1*02:01/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 337 2338
HLA-DRB1*11:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 267 1851
HLA-DRB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 267 1851
HLA-DQA1*05:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 311 2156
HLA-DQA1*02:01/DQB1*04:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 281 1947
HLA-DQA1*06:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 293 2029
HLA-DQA1*06:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 293 2029
HLA-DQA1*05:01/DQB1*04:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 144 997
HLA-DRB1*11:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 352 2432
HLA-DRB1*13:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 352 2432
HLA-DRB1*11:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 404 2790
HLA-DRB1*13:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 404 2790
HLA-DQA1*01:03/DQB1*06:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 248 1704
HLA-DQA1*01:03/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 200 1365
HLA-DRB1*07:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 65 441
HLA-DQA1*05:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 293 1986
HLA-DQA1*05:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 293 1986
HLA-DRB1*11:02 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 454 3074
HLA-DRB1*13:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 454 3074
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 118 797
HLA-DRB1*11:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 233 1572
HLA-DQA1*05:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 174 1165
HLA-DQA1*02:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 155 1036
HLA-DQA1*02:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 155 1036
HLA-DQA1*05:01/DQB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 428 2854
HLA-DQA1*02:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 296 1973
HLA-DQA1*02:01/DQB1*04:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 243 1617
HLA-DQA1*01:02/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 211 1384
HLA-DRB1*16:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 905 138
HLA-DQA1*01:02/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 254 1665
HLA-DRB1*01:02 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 1518 232
HLA-DRB1*01:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 52 340
HLA-DRB1*10:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 28 182
HLA-DRB1*01:02 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 2442 376
HLA-DQA1*05:01/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 488 3166
HLA-DQA1*02:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 179 1159
HLA-DRB1*11:04 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 366 2365
HLA-DRB1*15:03 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 62 399
HLA-DQA1*01:02/DQB1*06:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 320 2050
HLA-DQA1*02:01/DQB1*04:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 238 1523
HLA-DRB1*08:04 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 275 1749
HLA-DQA1*01:03/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 143 907
HLA-DQA1*01:03/DQB1*06:01 HAIHVSGTNGTKRFDNPVLP HVISGTNGTKRFDNPVLP 409 2589
HLA-DQA1*05:01/DQB1*03:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 185 1169
HLA-DRB1*08:04 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 352 2224
HLA-DQA1*02:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 268 1687
HLA-DQA1*01:02/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 178 1106
HLA-DQA1*02:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 252 1564
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 64 397
HLA-DRB1*08:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 181 1121
HLA-DQA1*02:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 264 1635
HLA-DQA1*02:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 188 1163
HLA-DRB1*13:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 307 1898
HLA-DRB1*08:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 207 1274
HLA-DQA1*01:03/DQB1*06:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 316 1944
HLA-DRB1*10:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 22 135
HLA-DQA1*02:01/DQB1*03:01 AIHVSGTNGTKRFDNPVLP VISGTNGTKRFDNPVLP 460 2822
HLA-DQA1*02:01/DQB1*03:19 AIHVSGTNGTKRFDNPVLP VISGTNGTKRFDNPVLP 460 2822
HLA-DRB1*15:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 77 472
HLA-DQA1*05:01/DQB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 454 2782
HLA-DQA1*02:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 284 1734
HLA-DRB1*11:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 2809 461
HLA-DQA1*02:01/DQB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 235 1430
HLA-DRB1*11:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 207 1258
HLA-DQA1*02:01/DQB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 234 1415
HLA-DRB1*08:04 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 244 1472
HLA-DRB1*16:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 1791 297
HLA-DQA1*02:01/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 345 2074
HLA-DQA1*02:01/DQB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 415 2488
HLA-DQA1*02:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 189 1129
HLA-DQA1*02:01/DQB1*03:01 AIHVSGTNGTKRFDNPV VISGTNGTKRFDNPV 330 1970
HLA-DQA1*02:01/DQB1*03:19 AIHVSGTNGTKRFDNPV VISGTNGTKRFDNPV 330 1970
HLA-DRB1*01:01 FHAIHVSGTNGTKRFDNP FHVISGTNGTKRFDNP 2164 364
HLA-DQA1*05:01/DQB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 143 849
HLA-DQA1*01:03/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 133 789
HLA-DQA1*01:02/DQB1*05:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 427 2521
HLA-DRB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 30 177
HLA-DQA1*05:01/DQB1*03:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 229 1351
HLA-DQA1*01:02/DQB1*06:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 349 2052
HLA-DRB1*08:04 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 295 1731
HLA-DRB1*15:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 46 269
HLA-DRB1*11:04 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 377 2201
HLA-DRB1*13:02 FHAIHVSGTNGTKRFDNPV FHVISGTNGTKRFDNPV 471 2743
HLA-DPA1*04:01/DPB1*02:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 476 2763
HLA-DRB1*04:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 146 844
HLA-DRB1*11:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 287 1657
HLA-DRB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 287 1657
HLA-DQA1*01:03/DQB1*06:09 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 461 2654
HLA-DQA1*02:01/DQB1*04:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 247 1415
HLA-DRB1*11:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 1428 250
HLA-DRB1*15:03 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 501 88
HLA-DRB1*16:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 78 444
HLA-DRB1*11:04 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 389 2208
HLA-DQA1*01:02/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 160 903
HLA-DRB1*08:04 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 308 1734
HLA-DQA1*06:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 402 2254
HLA-DQA1*05:01/DQB1*03:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 220 1233
HLA-DPA1*04:01/DPB1*14:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 475 2655
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 45 251
HLA-DRB1*15:03 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 110 613
HLA-DRB1*11:04 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 374 2076
HLA-DQA1*03:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 320 1776
HLA-DQA1*03:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 320 1776
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 44 244
HLA-DQA1*01:03/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 125 692
HLA-DQA1*05:01/DQB1*04:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 169 935
HLA-DQA1*06:01/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 469 2592
HLA-DQA1*02:01/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 424 2336
HLA-DRB1*10:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 59 323
HLA-DQA1*02:01/DQB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 429 2344
HLA-DRB1*08:04 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 290 1583
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 185 1009
HLA-DQA1*01:03/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 153 829
HLA-DRB1*08:04 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 327 1768
HLA-DPA1*04:01/DPB1*14:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 499 2695
HLA-DQA1*03:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 325 1755
HLA-DQA1*03:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 325 1755
HLA-DQA1*01:03/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 173 934
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 33 178
HLA-DPA1*04:01/DPB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 406 2185
HLA-DRB1*08:04 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 267 1432
HLA-DRB1*15:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 53 284
HLA-DRB1*15:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 31 166
HLA-DQA1*01:02/DQB1*06:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 304 1627
HLA-DQA1*03:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 359 1919
HLA-DQA1*03:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 359 1919
HLA-DQA1*02:01/DQB1*03:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 193 1031
HLA-DQA1*03:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 420 2243
HLA-DQA1*03:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 420 2243
HLA-DQA1*06:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 381 2034
HLA-DQA1*06:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 381 2034
HLA-DRB1*04:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 132 704
HLA-DQA1*03:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 309 1646
HLA-DQA1*03:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 309 1646
HLA-DRB1*10:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 31 165
HLA-DRB1*10:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 22 117
HLA-DQA1*01:03/DQB1*05:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 166 881
HLA-DRB1*15:03 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 62 329
HLA-DQA1*01:03/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 132 699
HLA-DPA1*04:01/DPB1*14:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 445 2355
HLA-DRB1*01:02 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 492 93
HLA-DRB1*15:03 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 105 555
HLA-DQA1*02:01/DQB1*03:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 201 1058
HLA-DQA1*02:01/DQB1*03:19 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 201 1058
HLA-DRB1*01:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 239 1253
HLA-DQA1*01:02/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 146 763
HLA-DQA1*03:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 358 1865
HLA-DQA1*03:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 358 1865
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 164 854
HLA-DRB1*01:02 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 676 130
HLA-DRB1*04:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 125 650
HLA-DQA1*01:03/DQB1*05:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 133 691
HLA-DQA1*06:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 389 2020
HLA-DQA1*01:03/DQB1*06:09 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 349 1807
HLA-DQA1*03:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 350 1809
HLA-DQA1*03:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 350 1809
HLA-DRB1*10:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 24 124
HLA-DQA1*01:03/DQB1*05:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 210 1085
HLA-DRB1*11:04 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 403 2079
HLA-DPA1*04:01/DPB1*13:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 498 2567
HLA-DRB1*11:04 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 367 1888
HLA-DQA1*05:01/DQB1*03:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 293 1507
HLA-DRB1*15:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 65 334
HLA-DRB1*01:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 262 1346
HLA-DPA1*04:01/DPB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 405 2080
HLA-DRB1*10:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 26 133
HLA-DRB1*15:03 LPFFSNVTWFHAIHVSG LPFFSNVTWFHVISG 63 322
HLA-DRB1*08:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 249 1272
HLA-DQA1*01:02/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 150 766
HLA-DPA1*04:01/DPB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 474 2414
HLA-DQA1*02:01/DQB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 243 1232
HLA-DRB1*10:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 137 693
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSG LPFFSNVTWFHVISG 32 161
HLA-DQA1*05:01/DQB1*03:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 425 2138
HLA-DQA1*05:01/DQB1*03:19 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 425 2138
HLA-DPA1*04:01/DPB1*14:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 407 2047
HLA-DRB1*11:04 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 385 1927
HLA-DQA1*01:03/DQB1*05:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 319 1584
HLA-DQA1*01:03/DQB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 216 1067
HLA-DRB1*04:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 144 710
HLA-DQA1*06:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 380 1873
HLA-DQA1*06:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 383 1875
HLA-DQA1*06:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 383 1875
HLA-DPA1*04:01/DPB1*14:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 382 1863
HLA-DQA1*01:02/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 170 829
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 126 614
HLA-DRB1*13:02 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 402 1956
HLA-DRB1*08:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 334 1623
HLA-DQA1*02:01/DQB1*03:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 224 1087
HLA-DQA1*01:02/DQB1*06:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 299 1450
HLA-DPA1*03:01/DPB1*02:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 134 649
HLA-DRB1*11:04 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 432 2092
HLA-DRB1*08:04 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 384 1858
HLA-DQA1*01:02/DQB1*06:02 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 433 2094
HLA-DRB1*15:03 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 176 850
HLA-DRB1*15:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 222 46
HLA-DPA1*04:01/DPB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 496 2388
HLA-DRB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 301 1447
HLA-DRB1*08:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 173 828
HLA-DQA1*03:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 433 2067
HLA-DQA1*03:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 433 2067
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPV FHVISGTNGTKRFDNPV 183 873
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPV FHVISGTNGTKRFDNPV 183 873
HLA-DQA1*01:02/DQB1*05:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 196 934
HLA-DQA1*06:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 421 2002
HLA-DRB1*11:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 297 1410
HLA-DRB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 297 1410
HLA-DRB1*15:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 31 147
HLA-DRB1*16:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 1617 341
HLA-DQA1*01:03/DQB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 221 1043
HLA-DQA1*02:01/DQB1*03:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 224 1056
HLA-DRB1*07:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 71 334
HLA-DQA1*06:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 479 2247
HLA-DQA1*01:03/DQB1*05:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 119 558
HLA-DRB1*16:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 120 562
HLA-DPA1*04:01/DPB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 375 1756
HLA-DQA1*02:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 118 552
HLA-DQA1*02:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 118 552
HLA-DRB1*08:04 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 414 1934
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 143 668
HLA-DRB1*16:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 71 331
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 121 564
HLA-DQA1*02:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 363 1692
HLA-DPA1*04:01/DPB1*14:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 342 1589
HLA-DPA1*04:01/DPB1*09:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 442 2049
HLA-DQA1*01:03/DQB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 111 514
HLA-DQA1*02:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 105 485
HLA-DQA1*02:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 105 485
HLA-DRB1*11:04 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 444 2050
HLA-DQA1*05:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 240 1108
HLA-DQA1*05:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 240 1108
HLA-DQA1*02:01/DQB1*04:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 284 1311
HLA-DQA1*01:02/DQB1*05:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 119 549
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 77 355
HLA-DQA1*01:03/DQB1*06:02 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 476 2192
HLA-DQA1*06:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 411 1890
HLA-DQA1*06:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 411 1890
HLA-DQA1*01:02/DQB1*06:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 296 1360
HLA-DRB1*16:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 799 174
HLA-DRB1*10:01 WFHAIHVSGTNGTKRFDN WFHVISGTNGTKRFDN 669 146
HLA-DQA1*02:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 97 444
HLA-DQA1*02:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 97 444
HLA-DRB1*01:02 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 1045 229
HLA-DRB1*15:03 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 96 438
HLA-DRB1*08:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 215 980
HLA-DPA1*02:02/DPB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 443 2016
HLA-DQA1*05:01/DQB1*03:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 168 764
HLA-DQA1*05:01/DQB1*03:19 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 168 764
HLA-DQA1*02:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 141 641
HLA-DQA1*02:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 141 641
HLA-DQA1*05:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 198 898
HLA-DQA1*05:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 198 898
HLA-DRB1*04:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 173 783
HLA-DRB1*08:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 176 796
HLA-DQA1*01:02/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 191 863
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 149 33
HLA-DQA1*02:01/DQB1*03:01 HAIHVSGTNGTKRFDNPVL HVISGTNGTKRFDNPVL 351 1582
HLA-DQA1*02:01/DQB1*03:19 HAIHVSGTNGTKRFDNPVL HVISGTNGTKRFDNPVL 351 1582
HLA-DQA1*01:03/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 490 2198
HLA-DQA1*01:03/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 490 2198
HLA-DQA1*03:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 458 2045
HLA-DQA1*03:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 458 2045
HLA-DQA1*01:02/DQB1*05:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 91 406
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 31 138
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 89 20
HLA-DPA1*03:01/DPB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 465 2063
HLA-DQA1*02:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 96 425
HLA-DQA1*02:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 96 425
HLA-DQA1*01:02/DQB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 223 987
HLA-DRB1*08:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 157 694
HLA-DRB1*11:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 980 222
HLA-DPA1*04:01/DPB1*17:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 481 2120
HLA-DRB1*10:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 304 69
HLA-DRB1*13:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 318 1399
HLA-DRB1*14:04 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 495 2168
HLA-DQA1*01:03/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 409 1791
HLA-DQA1*01:03/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 409 1791
HLA-DQA1*02:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 92 402
HLA-DQA1*02:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 92 402
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 266 1158
HLA-DQA1*05:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPV FHVISGTNGTKRFDNPV 381 1658
HLA-DQA1*05:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPV FHVISGTNGTKRFDNPV 381 1658
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 137 596
HLA-DQA1*01:03/DQB1*06:09 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 309 1344
HLA-DQA1*01:02/DQB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 220 956
HLA-DRB1*01:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 243 56
HLA-DPA1*02:02/DPB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 431 1870
HLA-DQA1*05:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 219 950
HLA-DQA1*05:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 219 950
HLA-DQA1*06:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 342 1483
HLA-DQA1*06:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 342 1483
HLA-DQA1*01:03/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 350 1515
HLA-DQA1*01:03/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 350 1515
HLA-DRB1*04:04 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 198 856
HLA-DQA1*02:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 116 501
HLA-DQA1*02:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 116 501
HLA-DQA1*05:01/DQB1*03:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 217 936
HLA-DQA1*05:01/DQB1*03:19 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 217 936
HLA-DPA1*03:01/DPB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 391 1684
HLA-DQA1*05:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 346 1489
HLA-DQA1*01:03/DQB1*06:09 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 260 1116
HLA-DRB1*04:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 148 635
HLA-DQA1*05:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 245 1051
HLA-DQA1*05:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 245 1051
HLA-DQA1*02:01/DQB1*03:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 270 1158
HLA-DQA1*05:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 191 819
HLA-DQA1*05:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 191 819
HLA-DRB1*15:03 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 88 377
HLA-DRB1*04:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 145 621
HLA-DQA1*05:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 204 871
HLA-DQA1*05:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 204 871
HLA-DQA1*05:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 299 1275
HLA-DQA1*05:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 299 1275
HLA-DPA1*04:01/DPB1*03:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 403 1716
HLA-DPA1*03:01/DPB1*05:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 407 1724
HLA-DPA1*04:01/DPB1*85:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 473 1997
HLA-DQA1*02:01/DQB1*03:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 93 392
HLA-DQA1*02:01/DQB1*03:19 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 93 392
HLA-DQA1*01:03/DQB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 107 451
HLA-DPA1*03:01/DPB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 373 1567
HLA-DPA1*04:01/DPB1*17:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 441 1848
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 46 11
HLA-DRB1*11:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 656 157
HLA-DPA1*04:01/DPB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 373 1558
HLA-DPA1*04:01/DPB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 439 1832
HLA-DPA1*04:01/DPB1*09:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 409 1706
HLA-DQA1*01:03/DQB1*05:03 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 485 2022
HLA-DRB1*13:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 274 1141
HLA-DPA1*03:01/DPB1*01:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 357 1485
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 32 133
HLA-DPA1*04:01/DPB1*14:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 365 1517
HLA-DQA1*06:01/DQB1*03:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 465 1930
HLA-DQA1*06:01/DQB1*03:19 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 465 1930
HLA-DQA1*01:03/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 301 1249
HLA-DQA1*01:03/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 301 1249
HLA-DQA1*05:01/DQB1*03:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 249 1032
HLA-DQA1*05:01/DQB1*03:19 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 249 1032
HLA-DQA1*06:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 300 1240
HLA-DQA1*06:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 300 1240
HLA-DRB1*16:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 194 47
HLA-DQA1*05:01/DQB1*03:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 155 639
HLA-DQA1*05:01/DQB1*03:19 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 155 639
HLA-DQA1*06:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 313 1289
HLA-DQA1*06:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 313 1289
HLA-DQA1*05:01/DQB1*06:09 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 500 2055
HLA-DQA1*01:02/DQB1*06:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 319 1310
HLA-DQA1*01:03/DQB1*06:02 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 396 1626
HLA-DQA1*06:01/DQB1*03:01 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 414 1696
HLA-DQA1*06:01/DQB1*03:19 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 414 1696
HLA-DRB1*13:02 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 361 1477
HLA-DPA1*04:01/DPB1*11:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 438 1789
HLA-DRB1*07:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 298 73
HLA-DRB1*11:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 360 1468
HLA-DRB1*13:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 360 1468
HLA-DQA1*02:01/DQB1*03:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 124 504
HLA-DQA1*02:01/DQB1*03:19 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 124 504
HLA-DRB1*08:04 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 430 1747
HLA-DQA1*05:01/DQB1*03:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 147 597
HLA-DQA1*05:01/DQB1*03:19 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 147 597
HLA-DRB1*08:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 161 653
HLA-DQA1*01:03/DQB1*06:09 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 256 1037
HLA-DRB1*10:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 40 162
HLA-DQA1*06:01/DQB1*03:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 316 1278
HLA-DQA1*06:01/DQB1*03:19 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 316 1278
HLA-DQA1*01:03/DQB1*04:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 497 2010
HLA-DPA1*04:01/DPB1*13:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 417 1686
HLA-DRB1*15:02 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 237 954
HLA-DPA1*03:01/DPB1*17:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 478 1918
HLA-DQA1*06:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 289 1158
HLA-DQA1*06:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 289 1158
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 134 536
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 134 536
HLA-DQA1*05:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 311 1243
HLA-DQA1*05:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 311 1243
HLA-DRB1*13:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 247 987
HLA-DPA1*01:03/DPB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 465 1856
HLA-DQA1*01:03/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 280 1116
HLA-DQA1*01:03/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 280 1116
HLA-DQA1*01:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 481 1917
HLA-DQA1*01:03/DQB1*05:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 392 1560
HLA-DRB1*01:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 337 1339
HLA-DRB1*01:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 54 214
HLA-DPA1*03:01/DPB1*01:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 487 1929
HLA-DRB1*15:02 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 201 794
HLA-DQA1*01:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 478 1886
HLA-DQA1*05:01/DQB1*03:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 165 651
HLA-DQA1*05:01/DQB1*03:19 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 165 651
HLA-DQA1*01:03/DQB1*06:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 289 1140
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 243 958
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 114 449
HLA-DRB1*08:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 323 1272
HLA-DQA1*05:01/DQB1*03:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 195 767
HLA-DQA1*05:01/DQB1*03:19 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 195 767
HLA-DPA1*04:01/DPB1*06:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 362 1421
HLA-DQA1*05:01/DQB1*03:01 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 254 994
HLA-DQA1*05:01/DQB1*03:19 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 254 994
HLA-DQA1*02:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 157 614
HLA-DQA1*02:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 157 614
HLA-DQA1*02:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 296 1155
HLA-DPA1*04:01/DPB1*85:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 429 1671
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 70 18
HLA-DQA1*05:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 280 1088
HLA-DQA1*02:01/DQB1*03:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 86 334
HLA-DQA1*02:01/DQB1*03:19 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 86 334
HLA-DRB1*11:04 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 445 1726
HLA-DRB1*10:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 155 40
HLA-DQA1*02:01/DQB1*03:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 130 502
HLA-DQA1*02:01/DQB1*03:19 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 130 502
HLA-DQA1*01:03/DQB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 497 1908
HLA-DPA1*04:01/DPB1*17:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 395 1514
HLA-DRB1*13:02 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 324 1241
HLA-DQA1*01:03/DQB1*06:09 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 234 896
HLA-DRB1*04:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 149 570
HLA-DQA1*02:01/DQB1*03:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 106 405
HLA-DQA1*02:01/DQB1*03:19 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 106 405
HLA-DPA1*02:02/DPB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 389 1486
HLA-DPA1*04:01/DPB1*02:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 329 1253
HLA-DQA1*06:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 339 1291
HLA-DQA1*06:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 339 1291
HLA-DPA1*02:02/DPB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 486 1850
HLA-DPA1*04:01/DPB1*05:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 422 1606
HLA-DQA1*01:02/DQB1*06:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 293 1114
HLA-DQA1*01:02/DQB1*06:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 337 1275
HLA-DQA1*01:03/DQB1*06:09 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 225 851
HLA-DQA1*01:02/DQB1*05:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 76 287
HLA-DQA1*01:03/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 275 1029
HLA-DQA1*01:03/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 275 1029
HLA-DQA1*02:01/DQB1*03:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 85 317
HLA-DQA1*02:01/DQB1*03:19 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 85 317
HLA-DQA1*05:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 226 841
HLA-DRB1*11:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 215 800
HLA-DQA1*02:01/DQB1*03:01 HAIHVSGTNGTKRFDNP HVISGTNGTKRFDNP 260 967
HLA-DQA1*02:01/DQB1*03:19 HAIHVSGTNGTKRFDNP HVISGTNGTKRFDNP 260 967
HLA-DQA1*01:02/DQB1*06:02 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 438 1626
HLA-DPA1*04:01/DPB1*10:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 447 1657
HLA-DPA1*02:02/DPB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 454 1680
HLA-DRB1*10:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 133 36
HLA-DRB1*11:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 1317 357
HLA-DRB1*13:02 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 291 1073
HLA-DRB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 365 1342
HLA-DQA1*01:02/DQB1*06:02 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 367 1348
HLA-DQA1*01:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 491 1802
HLA-DRB1*14:04 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 452 1658
HLA-DPA1*01:03/DPB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 439 1610
HLA-DRB1*07:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 63 231
HLA-DRB1*04:04 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 240 874
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 97 353
HLA-DRB1*11:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 225 817
HLA-DQA1*01:01/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 496 1799
HLA-DQA1*04:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 496 1798
HLA-DPA1*04:01/DPB1*03:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 437 1577
HLA-DRB1*14:04 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 395 1425
HLA-DPA1*04:01/DPB1*09:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 374 1349
HLA-DRB1*15:02 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 129 465
HLA-DPA1*03:01/DPB1*01:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 262 937
HLA-DPA1*03:01/DPB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 323 1155
HLA-DQA1*06:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 370 1322
HLA-DQA1*06:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 370 1322
HLA-DPA1*03:01/DPB1*02:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 429 1530
HLA-DRB1*15:01 LFLPFFSNVTWFHAIHVSG LFLPFFSNVTWFHVISG 47 167
HLA-DPA1*04:01/DPB1*11:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 372 1321
HLA-DPA1*04:01/DPB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 360 1277
HLA-DRB1*15:03 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 320 1134
HLA-DPA1*02:02/DPB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 427 1512
HLA-DPA1*03:01/DPB1*17:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 409 1446
HLA-DQA1*05:01/DQB1*06:09 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 499 1764
HLA-DQA1*01:03/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 379 1339
HLA-DQA1*01:03/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 379 1339
HLA-DRB1*01:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1439 408
HLA-DRB1*13:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 257 904
HLA-DQA1*02:01/DQB1*03:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 89 313
HLA-DQA1*02:01/DQB1*03:19 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 89 313
HLA-DQA1*05:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 360 1266
HLA-DQA1*05:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 360 1266
HLA-DQA1*01:03/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 291 1023
HLA-DQA1*01:03/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 291 1023
HLA-DRB1*07:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 66 232
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 402 1413
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 103 362
HLA-DQA1*06:01/DQB1*03:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 279 980
HLA-DQA1*06:01/DQB1*03:19 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 279 980
HLA-DQA1*02:01/DQB1*04:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 378 1326
HLA-DRB1*13:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 272 954
HLA-DQA1*01:03/DQB1*05:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 296 1037
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 63 18
HLA-DPA1*04:01/DPB1*06:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 332 1161
HLA-DQA1*06:01/DQB1*03:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 272 951
HLA-DQA1*06:01/DQB1*03:19 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 272 951
HLA-DRB1*13:02 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 297 1038
HLA-DQA1*06:01/DQB1*03:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 324 1132
HLA-DQA1*06:01/DQB1*03:19 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 324 1132
HLA-DPA1*04:01/DPB1*85:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 381 1331
HLA-DQA1*01:03/DQB1*05:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 343 1198
HLA-DQA1*01:03/DQB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 483 1686
HLA-DQA1*01:03/DQB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 94 328
HLA-DQA1*06:01/DQB1*03:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 290 1011
HLA-DQA1*06:01/DQB1*03:19 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 290 1011
HLA-DRB1*01:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 60 209
HLA-DRB1*01:02 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 835 240
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 109 379
HLA-DQA1*01:03/DQB1*05:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 287 995
HLA-DRB1*15:03 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 217 752
HLA-DPA1*03:01/DPB1*11:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 460 1594
HLA-DPA1*03:01/DPB1*13:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 459 1588
HLA-DRB1*04:04 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 236 815
HLA-DQA1*05:01/DQB1*06:09 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 471 1624
HLA-DRB1*11:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 324 94
HLA-DQA1*02:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 249 858
HLA-DQA1*01:03/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 335 1152
HLA-DQA1*01:03/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 335 1152
HLA-DQA1*05:01/DQB1*03:01 HAIHVSGTNGTKRFDNP HVISGTNGTKRFDNP 499 1715
HLA-DQA1*05:01/DQB1*03:19 HAIHVSGTNGTKRFDNP HVISGTNGTKRFDNP 499 1715
HLA-DPA1*01:03/DPB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 403 1385
HLA-DPA1*03:01/DPB1*17:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 365 1252
HLA-DQA1*05:01/DQB1*04:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 267 915
HLA-DRB1*15:03 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 61 209
HLA-DRB1*01:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 31 106
HLA-DRB1*14:04 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 384 1312
HLA-DRB1*15:03 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 224 765
HLA-DPA1*04:01/DPB1*01:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 359 1224
HLA-DPA1*04:01/DPB1*85:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 348 1184
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 255 75
HLA-DQA1*01:03/DQB1*06:09 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 252 855
HLA-DQA1*01:03/DQB1*06:02 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 353 1196
HLA-DPA1*04:01/DPB1*11:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 317 1073
HLA-DPA1*04:01/DPB1*10:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 433 1464
HLA-DPA1*03:01/DPB1*06:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 299 1010
HLA-DRB1*15:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 43 145
HLA-DRB1*11:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 267 900
HLA-DPA1*02:02/DPB1*01:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 413 1391
HLA-DPA1*04:01/DPB1*05:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 354 1188
HLA-DRB1*08:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 384 1286
HLA-DPA1*04:01/DPB1*11:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 257 860
HLA-DPA1*04:01/DPB1*17:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 376 1258
HLA-DQA1*02:01/DQB1*03:03 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 500 1671
HLA-DRB1*07:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 147 44
HLA-DPA1*04:01/DPB1*09:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 360 1201
HLA-DQA1*01:02/DQB1*05:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 69 230
HLA-DPA1*01:03/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 270 81
HLA-DRB1*04:04 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 222 740
HLA-DPA1*03:01/DPB1*11:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 379 1263
HLA-DPA1*04:01/DPB1*11:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 290 966
HLA-DRB1*13:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 249 829
HLA-DPA1*01:03/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 183 55
HLA-DPA1*02:02/DPB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 377 1252
HLA-DPA1*04:01/DPB1*26:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 454 1503
HLA-DRB1*15:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 58 192
HLA-DPA1*04:01/DPB1*06:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 316 1045
HLA-DQA1*05:01/DQB1*06:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 371 1225
HLA-DRB1*01:02 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 282 931
HLA-DPA1*03:01/DPB1*17:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 341 1123
HLA-DPA1*04:01/DPB1*17:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 361 1187
HLA-DPA1*01:03/DPB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 384 1260
HLA-DRB1*15:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 196 643
HLA-DPA1*04:01/DPB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 282 925
HLA-DPA1*02:01/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 928 283
HLA-DPA1*04:01/DPB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 334 1095
HLA-DQA1*05:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 210 688
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 316 1033
HLA-DPA1*04:01/DPB1*10:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 411 1343
HLA-DRB1*15:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 98 320
HLA-DQA1*01:03/DQB1*06:02 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 345 1124
HLA-DRB1*08:02 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 1482 455
HLA-DQA1*02:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 179 583
HLA-DQA1*02:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 179 583
HLA-DPA1*02:02/DPB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 433 1409
HLA-DRB1*11:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 374 1216
HLA-DRB1*04:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 692 213
HLA-DQA1*02:01/DQB1*06:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 317 1029
HLA-DQA1*01:02/DQB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 61 198
HLA-DRB1*08:02 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 882 272
HLA-DPA1*03:01/DPB1*05:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 339 1096
HLA-DQA1*05:01/DQB1*04:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 256 827
HLA-DPA1*04:01/DPB1*01:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 456 1471
HLA-DRB1*16:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 290 90
HLA-DRB1*16:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 625 194
HLA-DPA1*03:01/DPB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 373 1201
HLA-DPA1*03:01/DPB1*02:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 316 1017
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 33 106
HLA-DPA1*01:03/DPB1*04:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 440 138
HLA-DRB1*13:02 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 423 1347
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 81 257
HLA-DRB1*01:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 248 786
HLA-DRB1*01:02 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 189 599
HLA-DRB1*01:02 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 285 903
HLA-DPA1*04:01/DPB1*14:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 450 1425
HLA-DQA1*01:03/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 480 1520
HLA-DQA1*01:03/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 480 1520
HLA-DQA1*02:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 230 727
HLA-DRB1*15:02 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 115 363
HLA-DQA1*05:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 211 666
HLA-DQA1*06:01/DQB1*03:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 398 1256
HLA-DQA1*06:01/DQB1*03:19 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 398 1256
HLA-DQA1*05:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 227 716
HLA-DQA1*02:01/DQB1*03:03 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 331 1044
HLA-DPA1*04:01/DPB1*01:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 267 842
HLA-DPA1*03:01/DPB1*04:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 301 949
HLA-DPA1*03:01/DPB1*02:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 423 1330
HLA-DQA1*01:02/DQB1*06:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 472 1483
HLA-DQA1*02:01/DQB1*04:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 373 1171
HLA-DPA1*02:02/DPB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 474 1488
HLA-DRB1*04:04 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 206 643
HLA-DQA1*05:01/DQB1*03:03 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 274 855
HLA-DQA1*01:03/DQB1*05:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 314 979
HLA-DPA1*01:03/DPB1*04:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 321 103
HLA-DRB1*08:02 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 757 243
HLA-DQA1*05:01/DQB1*06:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 416 1295
HLA-DRB1*11:04 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 674 217
HLA-DQA1*01:02/DQB1*05:01 AIHVSGTNGTKRFDNPVLPF VISGTNGTKRFDNPVLPF 472 1465
HLA-DQA1*01:02/DQB1*06:02 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 403 1249
HLA-DPA1*04:01/DPB1*09:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 358 1109
HLA-DRB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 356 1102
HLA-DPA1*04:01/DPB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 263 814
HLA-DPA1*01:03/DPB1*04:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 529 171
HLA-DRB1*15:02 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 348 1076
HLA-DQA1*05:01/DQB1*06:09 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 476 1470
HLA-DQA1*05:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 220 679
HLA-DQA1*01:03/DQB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 75 231
HLA-DRB1*01:01 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 314 102
HLA-DPA1*04:01/DPB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 252 775
HLA-DRB1*14:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 498 1530
HLA-DQA1*02:01/DQB1*06:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 361 1109
HLA-DQA1*01:02/DQB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 60 184
HLA-DPA1*03:01/DPB1*09:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 488 1494
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 102 312
HLA-DPA1*01:03/DPB1*04:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 364 119
HLA-DRB1*04:04 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 334 1020
HLA-DPA1*03:01/DPB1*11:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 353 1078
HLA-DPA1*04:01/DPB1*26:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 437 1333
HLA-DQA1*01:02/DQB1*06:02 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 324 988
HLA-DRB1*16:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 433 142
HLA-DRB1*01:01 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 195 64
HLA-DPA1*04:01/DPB1*06:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 304 925
HLA-DPA1*03:01/DPB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 341 1037
HLA-DPA1*03:01/DPB1*06:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 285 866
HLA-DQA1*01:03/DQB1*06:09 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 236 717
HLA-DPA1*04:01/DPB1*85:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 351 1062
HLA-DRB1*14:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 463 1399
HLA-DPA1*04:01/DPB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 231 697
HLA-DQA1*01:03/DQB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 84 253
HLA-DQA1*01:03/DQB1*05:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 286 861
HLA-DRB1*04:04 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 1099 366
HLA-DPA1*01:03/DPB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 370 1110
HLA-DRB1*15:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 234 78
HLA-DQA1*05:01/DQB1*06:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 435 1304
HLA-DRB1*11:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 1217 406
HLA-DQA1*06:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 477 1429
HLA-DQA1*06:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 477 1429
HLA-DPA1*03:01/DPB1*05:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 270 804
HLA-DPA1*04:01/DPB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 288 854
HLA-DQA1*01:03/DQB1*06:02 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 311 920
HLA-DQA1*01:03/DQB1*06:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 485 1434
HLA-DQA1*02:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 444 1311
HLA-DRB1*10:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 124 42
HLA-DQA1*05:01/DQB1*03:03 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 452 1334
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 38 112
HLA-DQA1*02:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 235 691
HLA-DPA1*04:01/DPB1*03:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 406 1193
HLA-DQA1*01:03/DQB1*06:02 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 356 1044
HLA-DRB1*11:04 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 779 266
HLA-DRB1*04:04 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 1186 405
HLA-DQA1*02:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 234 685
HLA-DQA1*05:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 482 1408
HLA-DQA1*03:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 389 1135
HLA-DQA1*03:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 389 1135
HLA-DQA1*01:03/DQB1*05:03 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 248 723
HLA-DRB1*14:04 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 415 1208
HLA-DQA1*03:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 431 1254
HLA-DQA1*03:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 431 1254
HLA-DQA1*06:01/DQB1*03:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 402 1169
HLA-DQA1*06:01/DQB1*03:19 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 402 1169
HLA-DPA1*02:02/DPB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 417 1212
HLA-DPA1*01:03/DPB1*02:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 273 94
HLA-DPA1*02:01/DPB1*04:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 1165 402
HLA-DRB1*11:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 631 218
HLA-DRB1*04:04 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 206 596
HLA-DQA1*05:01/DQB1*03:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 342 989
HLA-DQA1*05:01/DQB1*03:19 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 342 989
HLA-DPA1*02:02/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 639 221
HLA-DQA1*02:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 237 685
HLA-DPA1*01:03/DPB1*02:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 314 109
HLA-DPA1*01:03/DPB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 476 1369
HLA-DPA1*03:01/DPB1*02:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 296 851
HLA-DQA1*03:01/DQB1*03:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 320 919
HLA-DQA1*03:01/DQB1*03:19 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 320 919
HLA-DRB1*16:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 138 395
HLA-DPA1*01:03/DPB1*02:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 240 84
HLA-DRB1*08:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 430 1228
HLA-DQA1*03:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 446 1273
HLA-DQA1*03:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 446 1273
HLA-DRB1*08:02 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 384 1095
HLA-DPA1*03:01/DPB1*11:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 303 864
HLA-DPA1*04:01/DPB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 228 650
HLA-DQA1*01:03/DQB1*06:09 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 245 698
HLA-DQA1*03:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 407 1155
HLA-DQA1*03:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 407 1155
HLA-DQA1*05:01/DQB1*06:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 353 1000
HLA-DQA1*03:01/DQB1*03:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 343 969
HLA-DQA1*03:01/DQB1*03:19 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 343 969
HLA-DPA1*04:01/DPB1*17:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 324 911
HLA-DRB1*01:02 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 297 835
HLA-DPA1*02:01/DPB1*04:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 1293 460
HLA-DQA1*05:01/DQB1*06:09 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 451 1267
HLA-DRB1*10:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 47 132
HLA-DRB1*11:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 386 1084
HLA-DPA1*03:01/DPB1*09:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 451 1266
HLA-DQA1*03:01/DQB1*03:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 439 1230
HLA-DQA1*03:01/DQB1*03:19 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 439 1230
HLA-DQA1*05:01/DQB1*03:03 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 266 745
HLA-DPA1*02:01/DPB1*04:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 1025 366
HLA-DPA1*04:01/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 140 50
HLA-DQA1*05:01/DQB1*03:03 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 337 943
HLA-DQA1*03:01/DQB1*03:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 410 1147
HLA-DQA1*03:01/DQB1*03:19 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 410 1147
HLA-DPA1*04:01/DPB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 241 674
HLA-DQA1*02:01/DQB1*04:02 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 433 1210
HLA-DPA1*01:03/DPB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 442 1234
HLA-DPA1*02:02/DPB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 384 1072
HLA-DQA1*05:01/DQB1*03:03 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 302 842
HLA-DRB1*15:03 LFLPFFSNVTWFHAIHVSG LFLPFFSNVTWFHVISG 93 259
HLA-DRB1*15:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 65 181
HLA-DPA1*01:03/DPB1*04:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 284 102
HLA-DQA1*05:01/DQB1*04:02 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 362 1007
HLA-DRB1*04:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 653 235
HLA-DQA1*01:03/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 478 1320
HLA-DQA1*01:03/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 478 1320
HLA-DQA1*03:01/DQB1*03:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 406 1120
HLA-DQA1*03:01/DQB1*03:19 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 406 1120
HLA-DQA1*02:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 404 1113
HLA-DQA1*01:02/DQB1*06:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 223 612
HLA-DQA1*03:01/DQB1*03:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 351 961
HLA-DQA1*03:01/DQB1*03:19 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 351 961
HLA-DRB1*07:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 855 313
HLA-DPA1*04:01/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 213 78
HLA-DQA1*03:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 433 1182
HLA-DQA1*03:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 433 1182
HLA-DQA1*01:01/DQB1*05:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 453 1234
HLA-DPA1*01:03/DPB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 491 1337
HLA-DQA1*01:03/DQB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 86 234
HLA-DRB1*11:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 206 560
HLA-DRB1*14:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 484 1313
HLA-DRB1*16:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 59 160
HLA-DPA1*04:01/DPB1*09:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 335 908
HLA-DRB1*14:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1300 480
HLA-DQA1*02:01/DQB1*06:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 376 1018
HLA-DPA1*01:03/DPB1*02:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 211 78
HLA-DQA1*03:01/DQB1*03:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 333 900
HLA-DQA1*03:01/DQB1*03:19 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 333 900
HLA-DPA1*04:01/DPB1*10:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 380 1027
HLA-DQA1*01:03/DQB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 84 227
HLA-DRB1*01:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 286 772
HLA-DPA1*01:03/DPB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 448 1209
HLA-DPA1*04:01/DPB1*26:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 448 1208
HLA-DRB1*04:07 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 476 1283
HLA-DRB1*01:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 42 113
HLA-DQA1*05:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 449 1208
HLA-DRB1*15:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 191 71
HLA-DPA1*04:01/DPB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 288 774
HLA-DPA1*01:03/DPB1*04:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 980 365
HLA-DPA1*01:03/DPB1*105:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 980 365
HLA-DPA1*04:01/DPB1*04:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 247 92
HLA-DRB1*04:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 173 464
HLA-DPA1*03:01/DPB1*05:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 254 680
HLA-DPA1*03:01/DPB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 99 37
HLA-DPA1*04:01/DPB1*14:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 420 1118
HLA-DQA1*01:02/DQB1*06:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 494 1313
HLA-DQA1*01:02/DQB1*06:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 212 563
HLA-DRB1*01:02 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 722 272
HLA-DQA1*01:02/DQB1*05:03 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 188 499
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 49 130
HLA-DRB1*13:02 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 262 695
HLA-DQA1*01:02/DQB1*06:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 275 729
HLA-DQA1*01:03/DQB1*06:02 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 300 795
HLA-DPA1*01:03/DPB1*04:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 185 70
HLA-DPA1*04:01/DPB1*04:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 280 106
HLA-DQA1*01:03/DQB1*06:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 184 486
HLA-DPA1*02:02/DPB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 475 1254
HLA-DRB1*15:02 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 105 277
HLA-DPA1*04:01/DPB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 207 546
HLA-DQA1*01:03/DQB1*06:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 160 422
HLA-DPA1*03:01/DPB1*09:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 454 1197
HLA-DQA1*01:02/DQB1*06:09 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 491 1292
HLA-DQA1*01:02/DQB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 54 142
HLA-DQA1*01:03/DQB1*05:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 286 752
HLA-DQA1*03:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 496 1304
HLA-DQA1*03:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 496 1304
HLA-DPA1*02:01/DPB1*04:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 962 366
HLA-DQA1*01:03/DQB1*06:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 346 908
HLA-DPA1*04:01/DPB1*85:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 322 842
HLA-DQA1*01:02/DQB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 49 128
HLA-DPA1*03:01/DPB1*17:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 280 730
HLA-DQA1*01:03/DQB1*05:03 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 280 730
HLA-DRB1*04:04 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 344 132
HLA-DRB1*04:04 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 1003 385
HLA-DPA1*02:01/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 508 195
HLA-DPA1*02:02/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 463 178
HLA-DQA1*01:03/DQB1*06:02 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 360 935
HLA-DPA1*03:01/DPB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 208 540
HLA-DRB1*14:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 495 1283
HLA-DPA1*03:01/DPB1*10:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 496 1285
HLA-DRB1*14:04 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 412 1067
HLA-DQA1*01:02/DQB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 46 119
HLA-DQA1*02:01/DQB1*03:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 167 432
HLA-DQA1*02:01/DQB1*03:19 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 167 432
HLA-DQA1*01:02/DQB1*06:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 300 774
HLA-DPA1*02:02/DPB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 306 789
HLA-DQA1*01:02/DQB1*06:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 201 518
HLA-DRB1*14:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 471 1212
HLA-DPA1*03:01/DPB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 311 799
HLA-DQA1*05:01/DQB1*06:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 334 858
HLA-DQA1*01:03/DQB1*06:01 HAIHVSGTNGTKRFDNP HVISGTNGTKRFDNP 419 1076
HLA-DPA1*03:01/DPB1*11:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 285 731
HLA-DQA1*01:02/DQB1*06:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 209 536
HLA-DRB1*04:04 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 196 502
HLA-DQA1*05:01/DQB1*03:03 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 238 609
HLA-DQA1*01:03/DQB1*06:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 169 432
HLA-DQA1*02:01/DQB1*03:03 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 290 740
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 279 708
HLA-DRB1*01:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 285 723
HLA-DPA1*03:01/DPB1*85:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 430 1090
HLA-DPA1*04:01/DPB1*02:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 167 66
HLA-DQA1*02:01/DQB1*03:03 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 268 678
HLA-DPA1*02:02/DPB1*02:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 465 1176
HLA-DQA1*01:02/DQB1*06:02 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 380 961
HLA-DPA1*03:01/DPB1*04:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 240 95
HLA-DPA1*03:01/DPB1*105:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 240 95
HLA-DRB1*15:02 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 97 245
HLA-DPA1*03:01/DPB1*02:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 58 23
HLA-DQA1*02:01/DQB1*06:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 303 764
HLA-DQA1*01:02/DQB1*06:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 236 595
HLA-DQA1*01:02/DQB1*06:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 233 587
HLA-DPA1*03:01/DPB1*09:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 402 1012
HLA-DRB1*10:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 29 73
HLA-DRB1*14:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 629 250
HLA-DQA1*05:01/DQB1*06:09 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 477 1200
HLA-DQA1*01:03/DQB1*06:01 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 243 611
HLA-DPA1*03:01/DPB1*04:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 108 43
HLA-DQA1*01:01/DQB1*06:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 489 1227
HLA-DQA1*01:03/DQB1*06:01 FHAIHVSGTNGTKRFDNPV FHVISGTNGTKRFDNPV 347 870
HLA-DRB1*04:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 717 286
HLA-DPA1*04:01/DPB1*04:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 318 127
HLA-DPA1*04:01/DPB1*02:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 185 74
HLA-DRB1*01:02 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 188 470
HLA-DPA1*03:01/DPB1*05:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 222 555
HLA-DQA1*05:01/DQB1*03:03 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 244 610
HLA-DPA1*03:01/DPB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 196 489
HLA-DRB1*15:03 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 212 528
HLA-DQA1*01:02/DQB1*06:01 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 360 896
HLA-DPA1*04:01/DPB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 232 577
HLA-DPA1*03:01/DPB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 189 470
HLA-DPA1*01:03/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 308 765
HLA-DQA1*01:03/DQB1*06:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 200 496
HLA-DQA1*01:02/DQB1*06:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 246 610
HLA-DRB1*01:02 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 327 132
HLA-DQA1*01:03/DQB1*06:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 177 438
HLA-DQA1*05:01/DQB1*03:01 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 352 871
HLA-DQA1*05:01/DQB1*03:19 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 352 871
HLA-DRB1*11:02 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 507 205
HLA-DRB1*13:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 507 205
HLA-DRB1*14:04 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 442 1093
HLA-DQA1*01:02/DQB1*05:03 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 386 954
HLA-DQA1*05:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 447 1103
HLA-DPA1*04:01/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 213 525
HLA-DPA1*04:01/DPB1*02:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 207 84
HLA-DQA1*05:01/DQB1*03:03 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 212 522
HLA-DRB1*04:07 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 455 1119
HLA-DPA1*02:01/DPB1*04:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 597 243
HLA-DRB1*15:03 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 287 117
HLA-DQA1*02:01/DQB1*03:03 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 271 664
HLA-DPA1*01:03/DPB1*05:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 945 386
HLA-DPA1*03:01/DPB1*11:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 250 612
HLA-DPA1*02:02/DPB1*11:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1096 448
HLA-DQA1*02:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 380 928
HLA-DQA1*05:01/DQB1*03:01 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 444 1084
HLA-DQA1*05:01/DQB1*03:19 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 444 1084
HLA-DRB1*16:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 227 93
HLA-DRB1*04:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 944 387
HLA-DQA1*05:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 480 1170
HLA-DQA1*02:01/DQB1*03:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 492 1198
HLA-DQA1*02:01/DQB1*03:19 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 492 1198
HLA-DQA1*01:03/DQB1*06:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 235 572
HLA-DPA1*03:01/DPB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 386 938
HLA-DPA1*03:01/DPB1*105:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 386 938
HLA-DPA1*04:01/DPB1*02:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 243 100
HLA-DPA1*01:03/DPB1*11:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1044 430
HLA-DQA1*03:01/DQB1*03:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 489 1187
HLA-DQA1*03:01/DQB1*03:19 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 489 1187
HLA-DPA1*01:03/DPB1*02:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 189 78
HLA-DPA1*01:03/DPB1*04:01 LPFFSNVTWFHAIHVSG LPFFSNVTWFHVISG 189 78
HLA-DRB1*04:04 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 911 376
HLA-DQA1*01:02/DQB1*06:01 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 382 923
HLA-DQA1*02:01/DQB1*04:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 482 1164
HLA-DPA1*04:01/DPB1*06:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 271 654
HLA-DPA1*03:01/DPB1*02:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 95 229
HLA-DRB1*16:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 61 147
HLA-DPA1*03:01/DPB1*04:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 101 42
HLA-DRB1*01:02 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 196 471
HLA-DRB1*04:07 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 1028 428
HLA-DPA1*04:01/DPB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 481 1155
HLA-DPA1*04:01/DPB1*105:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 481 1155
HLA-DPA1*01:03/DPB1*04:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 156 65
HLA-DQA1*02:01/DQB1*04:02 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 379 909
HLA-DQA1*05:01/DQB1*06:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 362 868
HLA-DRB1*01:02 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 1081 451
HLA-DRB1*01:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 58 139
HLA-DQA1*01:03/DQB1*06:01 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 278 666
HLA-DPA1*03:01/DPB1*04:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 122 51
HLA-DQA1*05:01/DQB1*04:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 184 440
HLA-DPA1*03:01/DPB1*04:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 165 69
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 43 18
HLA-DRB1*11:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1004 421
HLA-DQA1*01:03/DQB1*06:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 226 538
HLA-DQA1*01:03/DQB1*05:03 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 297 707
HLA-DPA1*03:01/DPB1*04:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 138 58
HLA-DPA1*03:01/DPB1*04:02 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 271 114
HLA-DPA1*03:01/DPB1*105:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 271 114
HLA-DRB1*04:04 WFHAIHVSGTNGTKRFDNP WFHVISGTNGTKRFDNP 435 1034
HLA-DPA1*04:01/DPB1*04:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 385 162
HLA-DQA1*01:02/DQB1*05:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 290 689
HLA-DQA1*02:01/DQB1*03:01 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 181 430
HLA-DQA1*02:01/DQB1*03:19 FSNVTWFHAIHVSGTNGT FSNVTWFHVISGTNGT 181 430
HLA-DRB1*04:01 FHAIHVSGTNGTKRFDN FHVISGTNGTKRFDN 365 867
HLA-DQA1*05:01/DQB1*03:03 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 207 491
HLA-DQA1*01:02/DQB1*05:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 49 116
HLA-DRB1*04:07 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 379 897
HLA-DPA1*04:01/DPB1*04:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 227 96
HLA-DPA1*04:01/DPB1*01:01 AIHVSGTNGTKRFDNPVLPF VISGTNGTKRFDNPVLPF 489 1156
HLA-DPA1*03:01/DPB1*17:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 924 391
HLA-DQA1*01:02/DQB1*05:03 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 159 375
HLA-DPA1*03:01/DPB1*01:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 453 1068
HLA-DPA1*04:01/DPB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 292 687
HLA-DQA1*05:01/DQB1*06:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 444 1044
HLA-DQA1*01:02/DQB1*06:09 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 458 1075
HLA-DQA1*01:03/DQB1*06:02 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 375 880
HLA-DRB1*11:02 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 651 278
HLA-DRB1*13:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 651 278
HLA-DQA1*05:01/DQB1*04:02 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 348 814
HLA-DQA1*02:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 393 919
HLA-DQA1*02:01/DQB1*04:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 311 727
HLA-DQA1*06:01/DQB1*03:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 475 1110
HLA-DQA1*06:01/DQB1*03:19 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 475 1110
HLA-DQA1*05:01/DQB1*04:02 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 188 439
HLA-DPA1*02:01/DPB1*02:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 903 387
HLA-DPA1*02:02/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 218 508
HLA-DPA1*03:01/DPB1*06:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 685 294
HLA-DPA1*01:03/DPB1*02:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 135 58
HLA-DQA1*01:02/DQB1*06:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 367 853
HLA-DPA1*03:01/DPB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 278 646
HLA-DQA1*02:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 369 857
HLA-DPA1*03:01/DPB1*13:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 242 562
HLA-DQA1*01:03/DQB1*06:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 218 506
HLA-DQA1*01:03/DQB1*06:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 207 480
HLA-DPA1*04:01/DPB1*04:02 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 619 267
HLA-DPA1*04:01/DPB1*105:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 619 267
HLA-DRB1*01:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 95 41
HLA-DQA1*05:01/DQB1*03:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 287 665
HLA-DQA1*05:01/DQB1*03:19 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 287 665
HLA-DPA1*04:01/DPB1*01:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 401 928
HLA-DPA1*01:03/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 393 909
HLA-DQA1*01:02/DQB1*06:02 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 323 747
HLA-DPA1*01:03/DPB1*04:01 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 918 397
HLA-DRB1*10:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 42 97
HLA-DPA1*03:01/DPB1*10:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 488 1127
HLA-DQA1*06:01/DQB1*06:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 452 1042
HLA-DQA1*02:01/DQB1*06:01 TWFHAIHVSGTNGTKRFDN TWFHVISGTNGTKRFDN 477 1099
HLA-DQA1*05:01/DQB1*03:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 349 804
HLA-DQA1*05:01/DQB1*03:19 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 349 804
HLA-DQA1*01:01/DQB1*05:01 DLFLPFFSNVTWFHAIHVS DLFLPFFSNVTWFHVIS 333 767
HLA-DRB1*11:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 849 369
HLA-DRB1*04:04 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 738 321
HLA-DPA1*03:01/DPB1*06:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 231 531
HLA-DPA1*03:01/DPB1*85:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 339 779
HLA-DPA1*04:01/DPB1*09:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 360 827
HLA-DPA1*01:03/DPB1*04:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 225 98
HLA-DPA1*02:01/DPB1*02:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 684 298
HLA-DPA1*01:03/DPB1*02:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 117 51
HLA-DRB1*11:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 422 184
HLA-DPA1*04:01/DPB1*02:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 149 65
HLA-DPA1*04:01/DPB1*26:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 414 949
HLA-DRB1*11:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 233 534
HLA-DPA1*02:02/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 401 919
HLA-DQA1*05:01/DQB1*03:03 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 281 643
HLA-DRB1*16:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 302 132
HLA-DQA1*02:01/DQB1*04:02 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 346 791
HLA-DPA1*01:03/DPB1*04:02 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 1000 438
HLA-DPA1*01:03/DPB1*105:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 1000 438
HLA-DRB1*08:02 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 721 316
HLA-DPA1*04:01/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 157 358
HLA-DPA1*01:03/DPB1*02:01 LPFFSNVTWFHAIHVSG LPFFSNVTWFHVISG 114 50
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDNP FHVISGTNGTKRFDNP 279 636
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDNP FHVISGTNGTKRFDNP 279 636
HLA-DQA1*05:01/DQB1*03:03 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 210 478
HLA-DQA1*02:01/DQB1*03:03 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 305 694
HLA-DPA1*02:02/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 367 835
HLA-DQA1*02:01/DQB1*03:01 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 234 532
HLA-DQA1*02:01/DQB1*03:19 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 234 532
HLA-DPA1*02:01/DPB1*02:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 782 344
HLA-DPA1*02:01/DPB1*04:01 LPFFSNVTWFHAIHVSG LPFFSNVTWFHVISG 586 258
HLA-DPA1*01:03/DPB1*01:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 382 865
HLA-DRB1*15:02 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 312 706
HLA-DQA1*01:02/DQB1*06:09 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 408 923
HLA-DPA1*04:01/DPB1*03:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 461 1042
HLA-DQA1*01:03/DQB1*05:03 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 333 752
HLA-DQA1*05:01/DQB1*03:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 326 736
HLA-DQA1*05:01/DQB1*03:19 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 326 736
HLA-DQA1*02:01/DQB1*06:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 455 1026
HLA-DPA1*03:01/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 161 363
HLA-DQA1*06:01/DQB1*06:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 452 1019
HLA-DQA1*02:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 236 532
HLA-DQA1*02:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 236 532
HLA-DQA1*01:02/DQB1*06:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 238 536
HLA-DPA1*03:01/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 144 324
HLA-DRB1*14:04 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1062 472
HLA-DQA1*06:01/DQB1*06:01 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 494 1109
HLA-DPA1*01:03/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 361 810
HLA-DPA1*02:02/DPB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 206 462
HLA-DPA1*04:01/DPB1*06:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 733 327
HLA-DPA1*03:01/DPB1*05:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 437 195
HLA-DQA1*05:01/DQB1*04:02 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 270 605
HLA-DQA1*02:01/DQB1*06:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 287 642
HLA-DRB1*04:04 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 916 410
HLA-DQA1*05:01/DQB1*03:01 WFHAIHVSGTNGTKRFDN WFHVISGTNGTKRFDN 426 951
HLA-DQA1*05:01/DQB1*03:19 WFHAIHVSGTNGTKRFDN WFHVISGTNGTKRFDN 426 951
HLA-DQA1*01:02/DQB1*05:01 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 250 558
HLA-DQA1*01:03/DQB1*06:02 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 299 666
HLA-DRB1*11:02 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 458 1020
HLA-DRB1*13:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 458 1020
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 308 685
HLA-DQA1*02:01/DQB1*04:02 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 336 747
HLA-DRB1*01:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 220 99
HLA-DQA1*05:01/DQB1*04:02 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 199 442
HLA-DQA1*05:01/DQB1*03:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 308 684
HLA-DQA1*05:01/DQB1*03:19 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 308 684
HLA-DPA1*02:02/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 336 746
HLA-DPA1*01:03/DPB1*04:01 LFLPFFSNVTWFHAIHVSG LFLPFFSNVTWFHVISG 242 109
HLA-DQA1*01:03/DQB1*06:02 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 379 841
HLA-DQA1*05:01/DQB1*03:03 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 238 527
HLA-DQA1*01:03/DQB1*05:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 99 219
HLA-DPA1*02:01/DPB1*02:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 606 274
HLA-DRB1*16:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 189 418
HLA-DQA1*01:02/DQB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 52 115
HLA-DPA1*01:03/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 305 674
HLA-DRB1*04:07 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 823 373
HLA-DPA1*03:01/DPB1*02:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 75 34
HLA-DRB1*01:02 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 619 281
HLA-DPA1*04:01/DPB1*85:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 338 744
HLA-DRB1*11:04 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 1052 478
HLA-DPA1*03:01/DPB1*04:02 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 299 136
HLA-DPA1*03:01/DPB1*105:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 299 136
HLA-DQA1*01:02/DQB1*06:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 222 488
HLA-DQA1*01:01/DQB1*05:01 LFLPFFSNVTWFHAIHV LFLPFFSNVTWFHVI 444 976
HLA-DPA1*01:03/DPB1*02:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 323 710
HLA-DRB1*15:02 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 200 91
HLA-DQA1*05:01/DQB1*03:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 475 1043
HLA-DQA1*05:01/DQB1*03:19 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 475 1043
HLA-DRB1*01:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 373 818
HLA-DQA1*01:03/DQB1*06:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 187 410
HLA-DPA1*01:03/DPB1*04:01 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 267 122
HLA-DRB1*04:07 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 393 860
HLA-DQA1*01:02/DQB1*06:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 226 494
HLA-DQA1*01:02/DQB1*06:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 259 566
HLA-DPA1*04:01/DPB1*04:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 443 968
HLA-DPA1*04:01/DPB1*105:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 443 968
HLA-DPA1*02:02/DPB1*01:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 249 114
HLA-DPA1*04:01/DPB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 199 434
HLA-DPA1*02:02/DPB1*02:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 343 748
HLA-DQA1*06:01/DQB1*03:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 490 1068
HLA-DQA1*06:01/DQB1*03:19 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 490 1068
HLA-DRB1*10:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 85 39
HLA-DPA1*01:03/DPB1*04:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 316 145
HLA-DQA1*02:01/DQB1*03:01 WFHAIHVSGTNGTKRFDN WFHVISGTNGTKRFDN 210 457
HLA-DQA1*02:01/DQB1*03:19 WFHAIHVSGTNGTKRFDN WFHVISGTNGTKRFDN 210 457
HLA-DPA1*03:01/DPB1*11:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 206 448
HLA-DQA1*01:02/DQB1*05:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 69 150
HLA-DPA1*03:01/DPB1*02:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 63 29
HLA-DQA1*01:03/DQB1*06:09 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 296 643
HLA-DPA1*03:01/DPB1*85:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 321 697
HLA-DQA1*01:03/DQB1*06:09 VTWFHAIHVSGTNGTKRFD VTWFHVISGTNGTKRFD 451 978
HLA-DRB1*10:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 42 91
HLA-DQA1*02:01/DQB1*03:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 168 364
HLA-DQA1*02:01/DQB1*03:19 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 168 364
HLA-DQA1*02:01/DQB1*03:03 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 266 575
HLA-DQA1*05:01/DQB1*04:02 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 205 443
HLA-DPA1*02:01/DPB1*04:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 501 232
HLA-DRB1*11:04 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 935 433
HLA-DPA1*04:01/DPB1*14:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 459 990
HLA-DPA1*01:03/DPB1*04:01 DLFLPFFSNVTWFHAIHVS DLFLPFFSNVTWFHVIS 196 91
HLA-DQA1*01:01/DQB1*05:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 319 686
HLA-DRB1*04:07 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 900 419
HLA-DPA1*02:02/DPB1*13:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 839 391
HLA-DPA1*04:01/DPB1*02:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 241 517
HLA-DQA1*02:01/DQB1*03:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 145 311
HLA-DQA1*02:01/DQB1*03:19 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 145 311
HLA-DPA1*03:01/DPB1*13:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 187 401
HLA-DRB1*15:01 DLFLPFFSNVTWFHAIHVS DLFLPFFSNVTWFHVIS 49 105
HLA-DQA1*05:01/DQB1*04:02 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 128 274
HLA-DQA1*05:01/DQB1*04:02 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 229 490
HLA-DRB1*04:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 235 110
HLA-DQA1*06:01/DQB1*03:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 455 970
HLA-DQA1*06:01/DQB1*03:19 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 455 970
HLA-DQA1*05:01/DQB1*04:02 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 184 392
HLA-DRB1*01:02 LFLPFFSNVTWFHAIHVSG LFLPFFSNVTWFHVISG 330 703
HLA-DPA1*01:03/DPB1*04:01 LFLPFFSNVTWFHAI LFLPFFSNVTWFHVI 149 70
HLA-DRB1*11:02 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 570 268
HLA-DRB1*13:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 570 268
HLA-DQA1*06:01/DQB1*03:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 415 882
HLA-DQA1*06:01/DQB1*03:19 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 415 882
HLA-DQA1*01:03/DQB1*06:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 194 412
HLA-DQA1*02:01/DQB1*04:02 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 313 664
HLA-DQA1*02:01/DQB1*03:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 157 333
HLA-DQA1*02:01/DQB1*03:19 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 157 333
HLA-DQA1*05:01/DQB1*04:02 FLPFFSNVTWFHAIHVSGT FLPFFSNVTWFHVISGT 213 451
HLA-DQA1*02:01/DQB1*03:03 NVTWFHAIHVSGTNGTK NVTWFHVISGTNGTK 249 527
HLA-DPA1*03:01/DPB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 124 262
HLA-DPA1*04:01/DPB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 143 302
HLA-DPA1*03:01/DPB1*17:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 281 593
HLA-DPA1*03:01/DPB1*04:02 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 249 118
HLA-DPA1*03:01/DPB1*105:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 249 118
HLA-DPA1*01:03/DPB1*02:01 QDLFLPFFSNVTWFHAIHV RDLFLPFFSNVTWFHVI 116 55
HLA-DPA1*02:01/DPB1*04:01 DLFLPFFSNVTWFHA DLFLPFFSNVTWFHV 565 268
HLA-DQA1*05:01/DQB1*04:02 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 139 293
HLA-DPA1*03:01/DPB1*04:02 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 347 165
HLA-DPA1*03:01/DPB1*105:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 347 165
HLA-DQA1*01:03/DQB1*06:09 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 412 866
HLA-DRB1*04:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 180 378
HLA-DQA1*01:02/DQB1*06:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 292 613
HLA-DPA1*04:01/DPB1*17:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 1037 494
HLA-DQA1*01:02/DQB1*06:02 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 324 680
HLA-DQA1*02:01/DQB1*04:02 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 314 659
HLA-DPA1*03:01/DPB1*05:01 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 470 986
HLA-DQA1*02:01/DQB1*03:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 175 367
HLA-DQA1*02:01/DQB1*03:19 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 175 367
HLA-DPA1*03:01/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 199 417
HLA-DPA1*03:01/DPB1*02:01 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 88 42
HLA-DQA1*01:01/DQB1*05:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 431 903
HLA-DRB1*16:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 118 247
HLA-DQA1*01:03/DQB1*03:01 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 409 856
HLA-DQA1*01:03/DQB1*03:19 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 409 856
HLA-DPA1*04:01/DPB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 123 257
HLA-DPA1*01:03/DPB1*02:01 FFSNVTWFHAIHVSGTNG FFSNVTWFHVISGTNG 514 246
HLA-DRB1*04:04 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 160 334
HLA-DPA1*01:03/DPB1*02:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 96 46
HLA-DPA1*01:03/DPB1*04:01 LFLPFFSNVTWFHAIHV LFLPFFSNVTWFHVI 146 70
HLA-DQA1*05:01/DQB1*04:02 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 187 390
HLA-DPA1*02:02/DPB1*05:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 903 433
HLA-DRB1*04:04 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 164 342
HLA-DPA1*03:01/DPB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 237 494
HLA-DPA1*03:01/DPB1*105:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 237 494
HLA-DPA1*03:01/DPB1*04:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 77 37
HLA-DQA1*01:02/DQB1*06:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 299 622
HLA-DQA1*01:03/DQB1*06:02 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 287 597
HLA-DPA1*02:02/DPB1*11:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 411 854
HLA-DPA1*03:01/DPB1*09:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 426 885
HLA-DPA1*04:01/DPB1*06:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 446 925
HLA-DPA1*04:01/DPB1*13:01 QDLFLPFFSNVTWFHAIHVS RDLFLPFFSNVTWFHVIS 257 533
HLA-DQA1*01:03/DQB1*06:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 259 537
HLA-DPA1*01:03/DPB1*13:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 388 804
HLA-DQA1*06:01/DQB1*03:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 492 1019
HLA-DQA1*06:01/DQB1*03:19 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 492 1019
HLA-DQA1*01:02/DQB1*05:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 238 492
HLA-DRB1*14:04 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 587 284
HLA-DRB1*01:02 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 746 361
HLA-DPA1*04:01/DPB1*11:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 218 450
HLA-DPA1*01:03/DPB1*04:02 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 941 456
HLA-DPA1*01:03/DPB1*105:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 941 456
HLA-DRB1*07:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 143 295
HLA-DPA1*03:01/DPB1*02:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 101 49
HLA-DPA1*02:01/DPB1*04:01 QDLFLPFFSNVTWFHAIHV RDLFLPFFSNVTWFHVI 582 283
HLA-DQA1*01:03/DQB1*06:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 256 526
HLA-DQA1*02:01/DQB1*06:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 381 780
HLA-DPA1*04:01/DPB1*04:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 389 796
HLA-DPA1*04:01/DPB1*105:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 389 796
HLA-DPA1*02:01/DPB1*04:01 LFLPFFSNVTWFHAI LFLPFFSNVTWFHVI 497 243
HLA-DPA1*02:01/DPB1*04:01 LFLPFFSNVTWFHAIHVSG LFLPFFSNVTWFHVISG 746 365
HLA-DRB1*04:04 LPFFSNVTWFHAIHVSGT LPFFSNVTWFHVISGT 656 321
HLA-DPA1*01:03/DPB1*02:01 FFSNVTWFHAIHVSGTN FFSNVTWFHVISGTN 235 115
HLA-DPA1*02:01/DPB1*04:01 PFFSNVTWFHAIHVSGT PFFSNVTWFHVISGT 639 313
HLA-DQA1*01:03/DQB1*06:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 292 596
HLA-DPA1*02:02/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 377 769
HLA-DPA1*02:02/DPB1*04:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 622 305
HLA-DPA1*04:01/DPB1*26:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 437 891
HLA-DRB1*11:01 SNVTWFHAIHVSGTNGTKR SNVTWFHVISGTNGTKR 367 180
HLA-DQA1*01:02/DQB1*06:02 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 391 797
HLA-DPA1*04:01/DPB1*05:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 491 241
HLA-DPA1*04:01/DPB1*17:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 375 764
HLA-DPA1*04:01/DPB1*05:01 TQDLFLPFFSNVTWFHAIHV TRDLFLPFFSNVTWFHVI 192 391
HLA-DPA1*03:01/DPB1*02:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 57 28
HLA-DPA1*02:01/DPB1*02:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 344 169
HLA-DPA1*02:02/DPB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 188 382
HLA-DPA1*02:02/DPB1*04:01 PFFSNVTWFHAIHVSGTN PFFSNVTWFHVISGTN 909 448
HLA-DPA1*01:03/DPB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 285 578
HLA-DQA1*01:03/DQB1*06:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 226 458
HLA-DRB1*04:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 312 154
HLA-DQA1*01:03/DQB1*06:01 LPFFSNVTWFHAIHVSGTN LPFFSNVTWFHVISGTN 310 627
HLA-DRB1*15:02 LPFFSNVTWFHAIHVSG LPFFSNVTWFHVISG 95 192
HLA-DRB1*11:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 299 604
HLA-DQA1*01:03/DQB1*06:09 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 324 654
HLA-DQA1*01:02/DQB1*06:09 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 414 835
HLA-DQA1*02:01/DQB1*03:03 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 243 490
HLA-DPA1*02:02/DPB1*04:01 LFLPFFSNVTWFHAIHVS LFLPFFSNVTWFHVIS 631 313
HLA-DPA1*02:01/DPB1*02:01 DLFLPFFSNVTWFHAIHV DLFLPFFSNVTWFHVI 535 266
HLA-DPA1*02:02/DPB1*04:01 FLPFFSNVTWFHAIHVSG FLPFFSNVTWFHVISG 693 345
HLA-DRB1*11:04 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 801 399
HLA-DRB1*11:02 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 558 278
HLA-DRB1*13:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 558 278
HLA-DQA1*01:02/DQB1*06:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 295 592
HLA-DPA1*04:01/DPB1*85:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 931 464
HLA-DPA1*03:01/DPB1*85:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 949 473
HLA-DQA1*02:01/DQB1*06:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 328 658
HLA-DRB1*01:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 56 28
HLA-DPA1*04:01/DPB1*02:01 FLPFFSNVTWFHAIHVS FLPFFSNVTWFHVIS 88 44
HLA-DPA1*04:01/DPB1*04:01 LFLPFFSNVTWFHAIH LFLPFFSNVTWFHVI 142 71
HLA-DPA1*01:03/DPB1*01:01 QDLFLPFFSNVTWFHAIH RDLFLPFFSNVTWFHVI 232 116
HLA-DQA1*01:02/DQB1*05:01 NVTWFHAIHVSGTNGTKRF NVTWFHVISGTNGTKRF 160 320
HLA-DQA1*01:02/DQB1*05:03 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 163 326
HLA-DPA1*01:03/DPB1*04:01 PFFSNVTWFHAIHVSGTNG PFFSNVTWFHVISGTNG 372 186
HLA-DPA1*02:02/DPB1*04:01 QDLFLPFFSNVTWFHAIHV RDLFLPFFSNVTWFHVI 442 221
HLA-DRB1*11:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 307 614

HV 69-70 deletion

Reference  RSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAST
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    RSSVLHSTRDLFLPFFSNVTWFHVI‑‑SGTNGTKRFDNPVLPFNDGVYFAST

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*04:01/DPB1*01:01 HVSGTNGTKRFDNPVLPFND - 367 -
HLA-DPA1*04:01/DPB1*01:01 VSGTNGTKRFDNPVLPFNDG - 381 -
HLA-DPA1*03:01/DPB1*01:01 HVSGTNGTKRFDNPVLPFND - 478 -
HLA-DRB1*15:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 48 1759
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 38 1315
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 35 1124
HLA-DRB1*15:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 79 2362
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 86 2562
HLA-DRB1*15:03 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 77 2245
HLA-DRB1*15:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 33 954
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 94 2628
HLA-DRB1*13:02 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 244 6798
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 114 3143
HLA-DRB1*15:03 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 74 2030
HLA-DRB1*15:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 32 852
HLA-DRB1*13:02 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 206 5136
HLA-DRB1*15:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 31 723
HLA-DRB1*13:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 185 4153
HLA-DRB1*15:03 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 68 1511
HLA-DRB1*13:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 148 3191
HLA-DRB1*13:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 133 2851
HLA-DRB1*04:04 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 342 7235
HLA-DRB1*13:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 170 3442
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 666 34
HLA-DRB1*15:03 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 213 3911
HLA-DRB1*15:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 107 1940
HLA-DRB1*15:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 135 2443
HLA-DRB1*15:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 31 543
HLA-DRB1*15:03 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 62 1069
HLA-DRB1*13:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 199 3393
HLA-DRB1*15:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 94 1572
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 350 21
HLA-DRB1*01:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 31 516
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFDN WFHVISGTNGTKRFDN 1140 73
HLA-DQA1*01:03/DQB1*06:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 346 5381
HLA-DRB1*01:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 35 527
HLA-DRB1*04:04 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 261 3889
HLA-DRB1*15:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 84 1202
HLA-DRB1*04:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 412 5701
HLA-DRB1*15:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 214 2885
HLA-DQA1*01:03/DQB1*06:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 252 3392
HLA-DRB1*01:01 NVTWFHAIHVSGTNGTKR NVTWFHVISGTNGTKR 269 20
HLA-DQA1*01:03/DQB1*06:02 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 476 6350
HLA-DRB1*15:03 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 62 801
HLA-DRB1*07:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 425 5430
HLA-DQA1*02:01/DQB1*03:01 AIHVSGTNGTKRFDNPVLPF VISGTNGTKRFDNPVLPF 358 4493
HLA-DQA1*02:01/DQB1*03:19 AIHVSGTNGTKRFDNPVLPF VISGTNGTKRFDNPVLPF 358 4493
HLA-DRB1*15:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 77 920
HLA-DRB1*04:04 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 210 2498
HLA-DRB1*15:01 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 31 366
HLA-DRB1*01:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 28 329
HLA-DRB1*07:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 90 1038
HLA-DQA1*02:01/DQB1*03:01 HAIHVSGTNGTKRFDNPVLP HVISGTNGTKRFDNPVLP 272 3110
HLA-DQA1*02:01/DQB1*03:19 HAIHVSGTNGTKRFDNPVLP HVISGTNGTKRFDNPVLP 272 3110
HLA-DRB1*15:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 275 3113
HLA-DRB1*01:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 218 2459
HLA-DQA1*01:03/DQB1*06:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 226 2549
HLA-DRB1*13:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 282 3161
HLA-DRB1*07:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 303 3291
HLA-DRB1*07:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 86 932
HLA-DQA1*02:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 157 1679
HLA-DQA1*02:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 157 1679
HLA-DRB1*01:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 230 2458
HLA-DQA1*05:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 153 1624
HLA-DQA1*05:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 153 1624
HLA-DQA1*02:01/DQB1*03:03 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 423 4450
HLA-DRB1*01:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 41 431
HLA-DRB1*16:01 TWFHAIHVSGTNGTKRFD TWFHVISGTNGTKRFD 3460 333
HLA-DQA1*05:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 146 1510
HLA-DQA1*05:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 146 1510
HLA-DQA1*02:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 290 2985
HLA-DQA1*02:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 121 1238
HLA-DQA1*02:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 121 1238
HLA-DQA1*05:01/DQB1*03:03 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 391 3972
HLA-DRB1*07:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 114 1156
HLA-DQA1*05:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 186 1858
HLA-DQA1*05:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 186 1858
HLA-DRB1*16:01 VTWFHAIHVSGTNGTKRF VTWFHVISGTNGTKRF 1658 166
HLA-DQA1*01:03/DQB1*06:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 207 2062
HLA-DQA1*05:01/DQB1*03:03 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 272 2691
HLA-DRB1*01:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 224 2213
HLA-DQA1*05:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 168 1659
HLA-DQA1*05:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 168 1659
HLA-DQA1*02:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 93 915
HLA-DQA1*02:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 93 915
HLA-DQA1*01:02/DQB1*06:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 425 4178
HLA-DQA1*02:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 101 992
HLA-DQA1*02:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 101 992
HLA-DRB1*11:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 305 2991
HLA-DRB1*13:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 305 2991
HLA-DQA1*02:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 101 990
HLA-DQA1*02:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 101 990
HLA-DQA1*02:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 85 831
HLA-DQA1*02:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 85 831
HLA-DQA1*02:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 81 791
HLA-DQA1*02:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 81 791
HLA-DRB1*11:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 186 1812
HLA-DQA1*05:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 143 1385
HLA-DQA1*05:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 143 1385
HLA-DQA1*05:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 293 2830
HLA-DQA1*05:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 293 2830
HLA-DQA1*05:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 155 1495
HLA-DQA1*05:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 155 1495
HLA-DQA1*05:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 186 1788
HLA-DQA1*05:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 186 1788
HLA-DQA1*05:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 227 2172
HLA-DQA1*05:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 227 2172
HLA-DRB1*04:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 277 2640
HLA-DRB1*04:04 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 169 1605
HLA-DQA1*02:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 86 812
HLA-DQA1*02:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 86 812
HLA-DRB1*01:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 263 2481
HLA-DQA1*05:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 213 2006
HLA-DRB1*11:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 268 2517
HLA-DRB1*13:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 268 2517
HLA-DQA1*05:01/DQB1*04:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 251 2344
HLA-DRB1*07:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 85 791
HLA-DRB1*11:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 224 2076
HLA-DRB1*13:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 224 2076
HLA-DRB1*15:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 72 667
HLA-DQA1*02:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 80 734
HLA-DQA1*02:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 80 734
HLA-DRB1*07:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 235 2153
HLA-DQA1*02:01/DQB1*03:03 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 237 2118
HLA-DRB1*11:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 192 1699
HLA-DRB1*07:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 75 663
HLA-DQA1*01:03/DQB1*06:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 218 1915
HLA-DRB1*16:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 95 830
HLA-DRB1*11:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 278 2393
HLA-DRB1*13:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 278 2393
HLA-DQA1*05:01/DQB1*04:02 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 389 3346
HLA-DQA1*02:01/DQB1*04:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 467 4012
HLA-DQA1*06:01/DQB1*03:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 283 2430
HLA-DQA1*06:01/DQB1*03:19 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 283 2430
HLA-DQA1*01:03/DQB1*06:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 219 1876
HLA-DRB1*11:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 285 2433
HLA-DRB1*13:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 285 2433
HLA-DRB1*16:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 1122 132
HLA-DQA1*05:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 179 1521
HLA-DPA1*03:01/DPB1*02:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 330 2797
HLA-DRB1*01:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 228 1913
HLA-DPA1*03:01/DPB1*02:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 223 1868
HLA-DQA1*06:01/DQB1*03:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 347 2906
HLA-DQA1*06:01/DQB1*03:19 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 347 2906
HLA-DQA1*01:03/DQB1*06:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 223 1848
HLA-DRB1*01:01 TWFHAIHVSGTNGTKRF TWFHVISGTNGTKRF 91 11
HLA-DRB1*04:04 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 150 1235
HLA-DQA1*06:01/DQB1*03:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 228 1876
HLA-DQA1*06:01/DQB1*03:19 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 228 1876
HLA-DRB1*07:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 163 1341
HLA-DQA1*06:01/DQB1*03:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 234 1925
HLA-DQA1*06:01/DQB1*03:19 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 234 1925
HLA-DRB1*07:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 72 592
HLA-DQA1*06:01/DQB1*03:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 455 3729
HLA-DQA1*06:01/DQB1*03:19 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 455 3729
HLA-DQA1*06:01/DQB1*03:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 247 2005
HLA-DQA1*06:01/DQB1*03:19 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 247 2005
HLA-DRB1*01:01 SNVTWFHAIHVSGTNGTK SNVTWFHVISGTNGTK 243 30
HLA-DQA1*05:01/DQB1*04:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 188 1516
HLA-DQA1*05:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 254 2040
HLA-DQA1*05:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 254 2040
HLA-DRB1*16:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 84 668
HLA-DQA1*05:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 165 1306
HLA-DRB1*11:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 281 2220
HLA-DRB1*13:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 281 2220
HLA-DQA1*06:01/DQB1*03:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 244 1912
HLA-DQA1*06:01/DQB1*03:19 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 244 1912
HLA-DQA1*02:01/DQB1*03:03 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 201 1573
HLA-DRB1*07:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 65 506
HLA-DQA1*02:01/DQB1*03:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 141 1095
HLA-DQA1*02:01/DQB1*03:19 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 141 1095
HLA-DQA1*05:01/DQB1*04:02 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 140 1085
HLA-DQA1*05:01/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 361 2797
HLA-DQA1*05:01/DQB1*04:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 161 1239
HLA-DQA1*05:01/DQB1*04:02 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 136 1045
HLA-DQA1*01:03/DQB1*06:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 243 1856
HLA-DRB1*10:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 420 3203
HLA-DQA1*01:02/DQB1*06:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 369 2805
HLA-DRB1*16:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 104 790
HLA-DQA1*02:01/DQB1*04:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 337 2554
HLA-DRB1*04:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 197 1492
HLA-DRB1*10:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 21 158
HLA-DRB1*10:01 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 23 172
HLA-DRB1*15:01 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 53 395
HLA-DQA1*05:01/DQB1*04:02 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 135 1003
HLA-DRB1*11:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 271 2010
HLA-DRB1*13:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 271 2010
HLA-DQA1*05:01/DQB1*04:02 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 133 981
HLA-DRB1*01:01 WFHAIHVSGTNGTKRFD WFHVISGTNGTKRFD 154 21
HLA-DRB1*01:02 DLFLPFFSNVTWFHAIHVSG DLFLPFFSNVTWFHVISG 255 1866
HLA-DRB1*15:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 478 3493
HLA-DQA1*06:01/DQB1*03:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 267 1946
HLA-DQA1*06:01/DQB1*03:19 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 267 1946
HLA-DQA1*05:01/DQB1*06:01 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 303 2208
HLA-DQA1*05:01/DQB1*06:01 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK 333 2405
HLA-DQA1*05:01/DQB1*06:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 331 2389
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNG FSNVTWFHVISGTNG 69 497
HLA-DQA1*05:01/DQB1*03:03 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 158 1132
HLA-DRB1*16:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 530 74
HLA-DQA1*01:03/DQB1*06:02 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 247 1760
HLA-DQA1*05:01/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 385 2731
HLA-DQA1*05:01/DQB1*06:01 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 292 2069
HLA-DRB1*15:03 FSNVTWFHAIHVSGTNGTK FSNVTWFHVISGTNGTK 128 906
HLA-DRB1*15:03 SNVTWFHAIHVSGTNGT SNVTWFHVISGTNGT 106 744
HLA-DQA1*02:01/DQB1*03:03 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 187 1310
HLA-DRB1*01:01 VTWFHAIHVSGTNGTKR VTWFHVISGTNGTKR 56 8
HLA-DRB1*15:01 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 48 336
HLA-DQA1*01:03/DQB1*06:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 169 1177
HLA-DRB1*15:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 66 459
HLA-DQA1*05:01/DQB1*03:03 FSNVTWFHAIHVSGTNGTKR FSNVTWFHVISGTNGTKR 164 1140
HLA-DRB1*04:04 SNVTWFHAIHVSGTNGTKRF SNVTWFHVISGTNGTKRF 146 1014
HLA-DQA1*02:01/DQB1*06:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 337 2338
HLA-DRB1*11:02 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 267 1851
HLA-DRB1*13:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 267 1851
HLA-DQA1*05:01/DQB1*06:01 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 311 2156
HLA-DQA1*02:01/DQB1*04:02 NVTWFHAIHVSGTNGTKRFD NVTWFHVISGTNGTKRFD 281 1947
HLA-DQA1*06:01/DQB1*03:01 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 293 2029
HLA-DQA1*06:01/DQB1*03:19 PFFSNVTWFHAIHVSGTNGT PFFSNVTWFHVISGTNGT 293 2029
HLA-DQA1*05:01/DQB1*04:02 LPFFSNVTWFHAIHVSGTNG LPFFSNVTWFHVISGTNG 144 997
HLA-DRB1*11:02 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 352 2432
HLA-DRB1*13:01 VTWFHAIHVSGTNGTKRFDN VTWFHVISGTNGTKRFDN 352 2432
HLA-DRB1*11:02 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 404 2790
HLA-DRB1*13:01 TWFHAIHVSGTNGTKRFDNP TWFHVISGTNGTKRFDNP 404 2790
HLA-DQA1*01:03/DQB1*06:01 FHAIHVSGTNGTKRFDNPVL FHVISGTNGTKRFDNPVL 248 1704
HLA-DQA1*01:03/DQB1*06:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 200 1365
HLA-DRB1*07:01 LFLPFFSNVTWFHAIHVSGT LFLPFFSNVTWFHVISGT 65 441
HLA-DQA1*05:01/DQB1*03:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 293 1986
HLA-DQA1*05:01/DQB1*03:19 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 293 1986
HLA-DRB1*11:02 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 454 3074
HLA-DRB1*13:01 WFHAIHVSGTNGTKRFDNPV WFHVISGTNGTKRFDNPV 454 3074
HLA-DRB1*15:03 FFSNVTWFHAIHVSGTNGT FFSNVTWFHVISGTNGT 118 797
HLA-DRB1*11:01 FLPFFSNVTWFHAIHVSGTN FLPFFSNVTWFHVISGTN 233 1572
HLA-DQA1*05:01/DQB1*03:03 FFSNVTWFHAIHVSGTNGTK FFSNVTWFHVISGTNGTK