Summary

This strain contains 23 protein-level mutations:

  • 12 mutations in Spike protein: L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y, T1027I, V1176F
  • 2 mutations in N protein: P80R, 203-204 RG->KR
  • 1 mutation in NS3 protein: S253P
  • 1 mutation in NS8 protein: E92K
  • 1 mutation in NS9b protein: Q77E
  • 1 mutation in NS9c protein: 49-50 VG->LN
  • 2 mutations in NSP3 protein: S370L, K977Q
  • 1 mutation in NSP6 protein: SGF 106-108 deletion
  • 1 mutation in NSP12 protein: P323L
  • 1 mutation in NSP13 protein: E341D

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

L18F

Reference  MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVF
           ||||||||||||||||| |||||||||||||||||||||||||
Mutated    MFVFLVLLPLVSSQCVNFTNRTQLPSAYTNSFTRGVYYPDKVF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:02 LVSSQCVNL LVSSQCVNF 240 8391
HLA-C*14:02 NLTTRTQL NFTNRTQL 11573 415
HLA-A*02:11 VLLPLVSSQCVNL VLLPLVSSQCVNF 145 3640
HLA-B*15:01 LVSSQCVNL LVSSQCVNF 5243 220
HLA-A*02:02 LLPLVSSQCVNL LLPLVSSQCVNF 254 5928
HLA-A*02:02 VLLPLVSSQCVNL VLLPLVSSQCVNF 417 8137
HLA-C*03:02 LTTRTQLPPAY FTNRTQLPSAY 3676 208
HLA-B*15:03 LVSSQCVNL LVSSQCVNF 4324 259
HLA-A*30:01 VNLTTRTQLPPA VNFTNRTQLPSA 254 4040
HLA-A*02:01 VLLPLVSSQCVNL VLLPLVSSQCVNF 418 6527
HLA-A*01:01 LTTRTQLPPAY FTNRTQLPSAY 827 115
HLA-B*15:01 LTTRTQLPPAY FTNRTQLPSAY 2378 368
HLA-A*29:02 LTTRTQLPPAY FTNRTQLPSAY 1225 223
HLA-B*42:01 LPLVSSQCVNL LPLVSSQCVNF 415 1797
HLA-A*30:01 LTTRTQLPPA FTNRTQLPSA 82 318
HLA-B*15:03 LTTRTQLPPAY FTNRTQLPSAY 1683 495
HLA-B*58:01 VSSQCVNLTT VSSQCVNFTN 1219 416
HLA-A*33:03 SSQCVNLTTR SSQCVNFTNR 283 123
HLA-A*31:01 SQCVNLTTR SQCVNFTNR 105 47
HLA-A*30:02 LTTRTQLPPAY FTNRTQLPSAY 686 324

T20N

Reference  MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRS
           ||||||||||||||||||| |||||||||||||||||||||||||
Mutated    MFVFLVLLPLVSSQCVNFTNRTQLPSAYTNSFTRGVYYPDKVFRS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*14:02 NLTTRTQL NFTNRTQL 11573 415
HLA-A*30:01 TTRTQLPPA TNRTQLPSA 9 240
HLA-A*30:01 TTRTQLPPAY TNRTQLPSAY 263 4995
HLA-C*03:02 LTTRTQLPPAY FTNRTQLPSAY 3676 208
HLA-A*30:01 VNLTTRTQLPPA VNFTNRTQLPSA 254 4040
HLA-A*01:01 LTTRTQLPPAY FTNRTQLPSAY 827 115
HLA-B*15:01 LTTRTQLPPAY FTNRTQLPSAY 2378 368
HLA-A*29:02 LTTRTQLPPAY FTNRTQLPSAY 1225 223
HLA-A*30:01 LTTRTQLPPA FTNRTQLPSA 82 318
HLA-B*15:03 LTTRTQLPPAY FTNRTQLPSAY 1683 495
HLA-A*30:02 TTRTQLPPAY TNRTQLPSAY 288 883
HLA-B*58:01 VSSQCVNLTT VSSQCVNFTN 1219 416
HLA-B*15:03 TRTQLPPAY NRTQLPSAY 158 364
HLA-A*33:03 SSQCVNLTTR SSQCVNFTNR 283 123
HLA-A*31:01 SQCVNLTTR SQCVNFTNR 105 47
HLA-A*30:02 LTTRTQLPPAY FTNRTQLPSAY 686 324

P26S

Reference  MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHST
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    MFVFLVLLPLVSSQCVNFTNRTQLPSAYTNSFTRGVYYPDKVFRSSVLHST

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*11:01 PAYTNSFTR SAYTNSFTR 2670 33
HLA-B*15:03 PAYTNSFTRGVY SAYTNSFTRGVY 4473 78
HLA-C*16:01 PAYTNSFTRGVY SAYTNSFTRGVY 6195 147
HLA-C*03:02 PAYTNSFTRGVY SAYTNSFTRGVY 5003 124
HLA-B*35:01 PAYTNSFTRGVY SAYTNSFTRGVY 13891 421
HLA-C*16:01 PAYTNSFTRGVYY SAYTNSFTRGVYY 7665 237
HLA-A*31:01 PAYTNSFTR SAYTNSFTR 764 25
HLA-C*03:02 PAYTNSFTRGVYY SAYTNSFTRGVYY 7472 253
HLA-A*30:01 TTRTQLPPA TNRTQLPSA 9 240
HLA-A*68:01 PAYTNSFTRG SAYTNSFTRG 10689 474
HLA-B*15:03 PAYTNSFTRGVYY SAYTNSFTRGVYY 5996 271
HLA-A*03:02 PAYTNSFTR SAYTNSFTR 4531 206
HLA-A*68:01 PAYTNSFTR SAYTNSFTR 165 8
HLA-B*53:01 LPPAYTNSF LPSAYTNSF 366 18
HLA-A*30:01 TTRTQLPPAY TNRTQLPSAY 263 4995
HLA-C*12:03 PAYTNSFTRGVY SAYTNSFTRGVY 7698 431
HLA-C*03:02 LTTRTQLPPAY FTNRTQLPSAY 3676 208
HLA-B*15:01 PAYTNSFTRGVY SAYTNSFTRGVY 4911 286
HLA-A*30:01 VNLTTRTQLPPA VNFTNRTQLPSA 254 4040
HLA-A*68:02 PAYTNSFTRGV SAYTNSFTRGV 6906 453
HLA-A*33:03 PAYTNSFTR SAYTNSFTR 509 39
HLA-B*35:01 QLPPAYTNSF QLPSAYTNSF 3994 360
HLA-B*35:01 LPPAYTNSF LPSAYTNSF 43 4
HLA-A*30:02 PAYTNSFTRGVYY SAYTNSFTRGVYY 1100 108
HLA-A*29:02 PAYTNSFTRGVY SAYTNSFTRGVY 3169 338
HLA-A*29:02 PAYTNSFTRGVYY SAYTNSFTRGVYY 925 100
HLA-B*07:02 RTQLPPAYTNSF RTQLPSAYTNSF 1180 150
HLA-A*30:02 PAYTNSFTRGVY SAYTNSFTRGVY 616 82
HLA-A*01:01 LTTRTQLPPAY FTNRTQLPSAY 827 115
HLA-A*68:01 PPAYTNSFTR PSAYTNSFTR 864 129
HLA-B*35:01 LPPAYTNSFTRGVY LPSAYTNSFTRGVY 1763 264
HLA-B*15:01 LTTRTQLPPAY FTNRTQLPSAY 2378 368
HLA-B*15:03 LPPAYTNSF LPSAYTNSF 788 125
HLA-B*07:02 LPPAYTNSF LPSAYTNSF 293 50
HLA-A*29:02 LTTRTQLPPAY FTNRTQLPSAY 1225 223
HLA-B*35:03 LPPAYTNSF LPSAYTNSF 1350 252
HLA-B*42:01 QLPPAYTNSF QLPSAYTNSF 1191 244
HLA-B*42:01 LPPAYTNSF LPSAYTNSF 65 14
HLA-B*15:03 QLPPAYTNSF QLPSAYTNSF 1522 341
HLA-B*42:01 RTQLPPAYTNSF RTQLPSAYTNSF 825 185
HLA-A*30:01 LTTRTQLPPA FTNRTQLPSA 82 318
HLA-B*15:03 LTTRTQLPPAY FTNRTQLPSAY 1683 495
HLA-A*30:02 TTRTQLPPAY TNRTQLPSAY 288 883
HLA-B*15:01 QLPPAYTNSF QLPSAYTNSF 300 103
HLA-C*03:02 LPPAYTNSF LPSAYTNSF 1157 412
HLA-B*15:03 TRTQLPPAY NRTQLPSAY 158 364
HLA-A*30:02 LTTRTQLPPAY FTNRTQLPSAY 686 324
HLA-B*58:01 RTQLPPAYTNSF RTQLPSAYTNSF 1040 492

D138Y

Reference  KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSA
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    KTQSLLIVNNATNVVIKVCEFQFCNYPFLGVYYHKNNKSWMESEFRVYSSA

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*14:02 NDPFLGVYY NYPFLGVYY 18829 39
HLA-A*30:02 KVCEFQFCND KVCEFQFCNY 17923 53
HLA-A*29:02 KVCEFQFCND KVCEFQFCNY 32767 165
HLA-B*18:01 CEFQFCND CEFQFCNY 11492 65
HLA-A*11:01 KVCEFQFCND KVCEFQFCNY 30138 228
HLA-C*14:02 NDPFLGVY NYPFLGVY 20112 191
HLA-C*07:02 NDPFLGVYY NYPFLGVYY 23019 404
HLA-A*03:02 KVCEFQFCND KVCEFQFCNY 25740 454
HLA-B*35:01 DPFLGVYYH YPFLGVYYH 992 21
HLA-B*35:01 DPFLGVYY YPFLGVYY 1593 35
HLA-B*15:03 CNDPFLGVY CNYPFLGVY 1048 37
HLA-A*01:01 CNDPFLGVY CNYPFLGVY 232 4976
HLA-A*29:02 NDPFLGVYY NYPFLGVYY 2130 101
HLA-B*15:01 CNDPFLGVY CNYPFLGVY 9489 500
HLA-A*01:01 CNDPFLGVYY CNYPFLGVYY 202 3648
HLA-B*15:03 CNDPFLGVYY CNYPFLGVYY 4293 346
HLA-A*23:01 EFQFCNDPF EFQFCNYPF 1283 109
HLA-A*31:01 DPFLGVYYHK YPFLGVYYHK 2222 224
HLA-A*01:01 FCNDPFLGVY FCNYPFLGVY 317 3011
HLA-A*68:01 DPFLGVYYHK YPFLGVYYHK 398 46
HLA-A*29:02 EFQFCNDPF EFQFCNYPF 2275 288
HLA-A*24:02 EFQFCNDPF EFQFCNYPF 1400 194
HLA-B*15:03 FCNDPFLGVY FCNYPFLGVY 567 79
HLA-A*29:02 CNDPFLGVYY CNYPFLGVYY 439 68
HLA-A*29:02 CNDPFLGVY CNYPFLGVY 566 93
HLA-A*30:02 CNDPFLGVY CNYPFLGVY 310 53
HLA-C*03:02 CNDPFLGVY CNYPFLGVY 2382 465
HLA-A*30:02 CNDPFLGVYY CNYPFLGVYY 549 121
HLA-A*23:01 CEFQFCNDPF CEFQFCNYPF 2202 488
HLA-A*68:01 DPFLGVYYHKNNK YPFLGVYYHKNNK 1317 340
HLA-C*06:02 FQFCNDPFL FQFCNYPFL 1653 434
HLA-B*18:01 FQFCNDPF FQFCNYPF 1795 488
HLA-C*12:03 FQFCNDPFL FQFCNYPFL 350 98
HLA-A*29:02 QFCNDPFLGVY QFCNYPFLGVY 192 57
HLA-C*14:02 FQFCNDPFL FQFCNYPFL 638 191
HLA-C*07:02 FQFCNDPFL FQFCNYPFL 1155 365
HLA-A*29:02 FCNDPFLGVY FCNYPFLGVY 587 189
HLA-C*14:02 EFQFCNDPF EFQFCNYPF 664 232
HLA-B*15:01 FCNDPFLGVY FCNYPFLGVY 887 330
HLA-A*02:11 FQFCNDPFLG FQFCNYPFLG 604 226
HLA-B*18:01 CEFQFCNDPF CEFQFCNYPF 102 39
HLA-C*03:02 FQFCNDPF FQFCNYPF 1019 391
HLA-A*30:02 FCNDPFLGVY FCNYPFLGVY 408 158
HLA-B*44:03 CEFQFCNDPF CEFQFCNYPF 89 37
HLA-A*02:06 FCNDPFLGV FCNYPFLGV 116 272
HLA-B*40:02 CEFQFCNDPF CEFQFCNYPF 245 105
HLA-A*02:11 EFQFCNDPFL EFQFCNYPFL 509 221
HLA-B*50:01 CEFQFCNDP CEFQFCNYP 934 406
HLA-B*45:01 CEFQFCNDPF CEFQFCNYPF 1099 486
HLA-A*02:06 FQFCNDPFLG FQFCNYPFLG 207 92
HLA-A*02:06 EFQFCNDPFLGV EFQFCNYPFLGV 87 194
HLA-C*12:02 FQFCNDPFL FQFCNYPFL 315 142
HLA-A*02:06 FQFCNDPFLGVY FQFCNYPFLGVY 135 295
HLA-A*29:02 FQFCNDPFLGVY FQFCNYPFLGVY 388 179
HLA-A*02:06 EFQFCNDPFL EFQFCNYPFL 227 107
HLA-B*45:01 CEFQFCNDP CEFQFCNYP 303 145
HLA-A*32:01 KVCEFQFCNDPF KVCEFQFCNYPF 376 180
HLA-C*16:01 FQFCNDPFL FQFCNYPFL 473 230
HLA-C*02:02 FQFCNDPFL FQFCNYPFL 522 254
HLA-C*02:10 FQFCNDPFL FQFCNYPFL 522 254
HLA-B*40:06 CEFQFCNDP CEFQFCNYP 782 384
HLA-A*30:02 QFCNDPFLGVY QFCNYPFLGVY 678 334
HLA-A*02:02 EFQFCNDPFLGV EFQFCNYPFLGV 477 964
HLA-B*40:02 FQFCNDPFL FQFCNYPFL 662 329
HLA-A*02:11 FQFCNDPFL FQFCNYPFL 6 3
HLA-B*44:02 CEFQFCNDPF CEFQFCNYPF 126 63

R190S

Reference  NCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NCTFEYVSQPFLMDLEGKQGNFKNLSEFVFKNIDGYFKIYSKHTPINLVRD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*31:01 KQGNFKNLR KQGNFKNLS 17 20961
HLA-A*01:01 LREFVFKNIDGY LSEFVFKNIDGY 14233 179
HLA-A*31:01 GKQGNFKNLR GKQGNFKNLS 475 32767
HLA-A*02:01 NLREFVFKNI NLSEFVFKNI 798 36
HLA-A*02:02 NLREFVFKNI NLSEFVFKNI 275 14
HLA-A*02:06 NLREFVFKNI NLSEFVFKNI 2450 205
HLA-A*02:11 KNLREFVFKNI KNLSEFVFKNI 3605 365
HLA-A*02:11 NLREFVFKNI NLSEFVFKNI 76 8
HLA-A*68:02 NLREFVFKNI NLSEFVFKNI 3406 369
HLA-B*18:01 REFVFKNIDGY SEFVFKNIDGY 1577 297
HLA-B*15:01 KQGNFKNLREF KQGNFKNLSEF 516 120
HLA-B*44:03 REFVFKNIDGY SEFVFKNIDGY 489 134
HLA-B*44:02 REFVFKNIDGY SEFVFKNIDGY 915 274
HLA-B*15:03 NFKNLREFVF NFKNLSEFVF 746 233
HLA-B*44:03 REFVFKNIDGYF SEFVFKNIDGYF 599 188
HLA-B*44:02 REFVFKNIDGYF SEFVFKNIDGYF 916 295
HLA-B*40:02 REFVFKNIDGYFKI SEFVFKNIDGYFKI 272 807
HLA-A*30:02 REFVFKNIDGY SEFVFKNIDGY 485 1323
HLA-B*40:02 REFVFKNIDGYF SEFVFKNIDGYF 254 675
HLA-B*15:03 REFVFKNIDGYF SEFVFKNIDGYF 402 1041
HLA-B*15:03 GKQGNFKNLREF GKQGNFKNLSEF 548 228
HLA-B*15:03 REFVFKNIDGY SEFVFKNIDGY 494 1162
HLA-A*24:02 NFKNLREFVF NFKNLSEFVF 786 356
HLA-B*15:03 GNFKNLREF GNFKNLSEF 136 62
HLA-A*23:01 NFKNLREFVF NFKNLSEFVF 405 200
HLA-B*15:03 KQGNFKNLREF KQGNFKNLSEF 42 21

K417T

Reference  FTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    FTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPDDFTGCVIAWNSNNLD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*11:01 GKIADYNYK GTIADYNYK 8565 6
HLA-A*03:01 RQIAPGQTGK RQIAPGQTGT 49 23113
HLA-A*68:01 GKIADYNYK GTIADYNYK 12087 32
HLA-A*03:02 GKIADYNYK GTIADYNYK 14291 44
HLA-A*11:01 RQIAPGQTGK RQIAPGQTGT 103 30673
HLA-A*03:02 RQIAPGQTGK RQIAPGQTGT 123 25727
HLA-A*11:01 QIAPGQTGK QIAPGQTGT 165 32767
HLA-A*68:01 EVRQIAPGQTGK EVRQIAPGQTGT 144 27700
HLA-A*68:01 QIAPGQTGK QIAPGQTGT 136 20478
HLA-A*03:01 GKIADYNYK GTIADYNYK 15362 118
HLA-A*03:02 QIAPGQTGK QIAPGQTGT 278 32767
HLA-A*11:01 GKIADYNYKL GTIADYNYKL 30153 269
HLA-A*03:01 QIAPGQTGK QIAPGQTGT 296 32213
HLA-A*11:01 APGQTGKIADYNYK APGQTGTIADYNYK 15790 166
HLA-A*68:01 TGKIADYNYK TGTIADYNYK 957 13
HLA-A*11:01 TGKIADYNYK TGTIADYNYK 1113 19
HLA-A*68:02 KIADYNYKL TIADYNYKL 1274 34
HLA-A*30:01 GKIADYNYK GTIADYNYK 5364 151
HLA-A*32:01 KIADYNYKL TIADYNYKL 58 1664
HLA-A*31:01 GKIADYNYK GTIADYNYK 11055 392
HLA-A*30:01 RQIAPGQTGK RQIAPGQTGT 275 7151
HLA-A*11:01 GQTGKIADYNYK GQTGTIADYNYK 1342 63
HLA-A*03:02 TGKIADYNYK TGTIADYNYK 3525 241
HLA-C*01:02 IAPGQTGKI IAPGQTGTI 529 115
HLA-A*03:02 KIADYNYK TIADYNYK 476 2050
HLA-A*30:01 TGKIADYNYK TGTIADYNYK 292 948
HLA-C*12:03 IAPGQTGKI IAPGQTGTI 806 253
HLA-A*02:01 KIADYNYKL TIADYNYKL 23 69
HLA-A*02:06 KIADYNYKL TIADYNYKL 20 51
HLA-A*30:02 GQTGKIADY GQTGTIADY 337 135
HLA-A*02:11 KIADYNYKL TIADYNYKL 5 12
HLA-A*01:01 QTGKIADYNY QTGTIADYNY 580 276
HLA-B*07:02 APGQTGKIA APGQTGTIA 507 248

E484K

Reference  SNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYR
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYR

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*40:02 VEGFNCYFPL VKGFNCYFPL 31 7011
HLA-B*40:01 VEGFNCYFPL VKGFNCYFPL 76 15210
HLA-A*11:01 GSTPCNGVE GSTPCNGVK 32767 444
HLA-A*68:02 EGFNCYFPL KGFNCYFPL 117 3877
HLA-A*30:01 EGFNCYFPL KGFNCYFPL 5413 164
HLA-A*32:01 EGFNCYFPL KGFNCYFPL 6548 210
HLA-A*30:02 EGFNCYFPLQSY KGFNCYFPLQSY 1806 72
HLA-B*15:01 GVEGFNCYF GVKGFNCYF 3125 132
HLA-A*31:01 EGFNCYFPL KGFNCYFPL 4227 226
HLA-B*15:03 EGFNCYFPL KGFNCYFPL 2980 212
HLA-A*02:11 EGFNCYFPL KGFNCYFPL 2508 259
HLA-B*15:03 GVEGFNCYF GVKGFNCYF 1657 199
HLA-A*02:06 EGFNCYFPL KGFNCYFPL 1266 169
HLA-B*35:01 TPCNGVEGF TPCNGVKGF 319 1754
HLA-B*15:03 VEGFNCYFPLQSY VKGFNCYFPLQSY 1081 208
HLA-B*35:01 NGVEGFNCY NGVKGFNCY 346 1439
HLA-C*16:01 EGFNCYFPL KGFNCYFPL 1861 498
HLA-B*15:03 VEGFNCYFPL VKGFNCYFPL 943 280

N501Y

Reference  GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    GSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*29:02 QSYGFQPTN QSYGFQPTY 26152 24
HLA-A*29:02 YFPLQSYGFQPTN YFPLQSYGFQPTY 19514 25
HLA-B*15:01 LQSYGFQPTN LQSYGFQPTY 6135 8
HLA-B*35:01 FPLQSYGFQPTN FPLQSYGFQPTY 8715 15
HLA-C*03:02 QSYGFQPTN QSYGFQPTY 12903 23
HLA-B*15:03 LQSYGFQPTN LQSYGFQPTY 2045 4
HLA-B*15:03 QSYGFQPTN QSYGFQPTY 6543 13
HLA-C*16:01 QSYGFQPTN QSYGFQPTY 10868 27
HLA-B*35:01 QSYGFQPTN QSYGFQPTY 24615 71
HLA-C*12:03 QSYGFQPTN QSYGFQPTY 12696 38
HLA-B*15:03 PLQSYGFQPTN PLQSYGFQPTY 22802 80
HLA-C*14:02 TNGVGYQPY TYGVGYQPY 5468 21
HLA-A*29:02 LQSYGFQPTN LQSYGFQPTY 28458 133
HLA-C*03:02 FPLQSYGFQPTN FPLQSYGFQPTY 23840 113
HLA-C*03:02 LQSYGFQPTN LQSYGFQPTY 23421 125
HLA-A*30:02 LQSYGFQPTN LQSYGFQPTY 7508 42
HLA-A*30:02 QSYGFQPTN QSYGFQPTY 5297 30
HLA-B*15:03 FPLQSYGFQPTN FPLQSYGFQPTY 20159 137
HLA-C*03:02 YFPLQSYGFQPTN YFPLQSYGFQPTY 27639 198
HLA-A*29:02 CYFPLQSYGFQPTN CYFPLQSYGFQPTY 27182 196
HLA-C*14:02 SYGFQPTN SYGFQPTY 20230 162
HLA-A*29:02 FPLQSYGFQPTN FPLQSYGFQPTY 32767 264
HLA-B*15:01 QSYGFQPTN QSYGFQPTY 21529 195
HLA-C*14:02 YFPLQSYGFQPTN YFPLQSYGFQPTY 18230 169
HLA-B*15:03 YFPLQSYGFQPTN YFPLQSYGFQPTY 22168 206
HLA-A*11:01 QSYGFQPTN QSYGFQPTY 22068 241
HLA-C*16:01 LQSYGFQPTN LQSYGFQPTY 27149 326
HLA-C*12:02 QSYGFQPTN QSYGFQPTY 21029 267
HLA-B*15:01 PLQSYGFQPTN PLQSYGFQPTY 32767 449
HLA-B*35:01 YFPLQSYGFQPTN YFPLQSYGFQPTY 28375 395
HLA-C*12:03 FPLQSYGFQPTN FPLQSYGFQPTY 27893 431
HLA-C*16:01 FPLQSYGFQPTN FPLQSYGFQPTY 27733 434
HLA-C*02:02 QSYGFQPTN QSYGFQPTY 26598 425
HLA-C*02:10 QSYGFQPTN QSYGFQPTY 26598 425
HLA-A*30:02 YFPLQSYGFQPTN YFPLQSYGFQPTY 18743 310
HLA-B*15:03 LQSYGFQPTNG LQSYGFQPTYG 6387 109
HLA-B*53:01 FPLQSYGFQPTN FPLQSYGFQPTY 8451 151
HLA-C*12:03 LQSYGFQPTN LQSYGFQPTY 26641 480
HLA-A*32:01 QSYGFQPTN QSYGFQPTY 16619 311
HLA-A*30:02 FPLQSYGFQPTN FPLQSYGFQPTY 21475 466
HLA-C*03:02 NGVGYQPY YGVGYQPY 10463 451
HLA-B*57:01 QSYGFQPTN QSYGFQPTY 4070 215
HLA-B*58:01 QSYGFQPTN QSYGFQPTY 1532 83
HLA-A*02:11 NGVGYQPYRV YGVGYQPYRV 5989 327
HLA-B*57:01 LQSYGFQPTN LQSYGFQPTY 3839 244
HLA-B*58:01 LQSYGFQPTN LQSYGFQPTY 1885 155
HLA-B*15:03 NGVGYQPY YGVGYQPY 4677 467
HLA-A*31:01 TNGVGYQPYR TYGVGYQPYR 811 84
HLA-A*33:03 TNGVGYQPYR TYGVGYQPYR 573 62
HLA-A*29:02 TNGVGYQPY TYGVGYQPY 2031 237
HLA-A*29:02 PTNGVGYQPY PTYGVGYQPY 1211 177
HLA-A*02:11 YGFQPTNGV YGFQPTYGV 307 49
HLA-A*02:01 YGFQPTNGV YGFQPTYGV 2160 459
HLA-A*68:01 PTNGVGYQPYR PTYGVGYQPYR 1073 242
HLA-A*02:11 LQSYGFQPTNGV LQSYGFQPTYGV 1446 396
HLA-A*31:01 PTNGVGYQPYR PTYGVGYQPYR 1377 406
HLA-A*02:06 YGFQPTNGV YGFQPTYGV 174 52
HLA-A*33:03 PTNGVGYQPYR PTYGVGYQPYR 1345 407
HLA-A*02:02 YGFQPTNGV YGFQPTYGV 868 287
HLA-A*02:06 QSYGFQPTNGV QSYGFQPTYGV 1121 407
HLA-A*68:02 YGFQPTNGV YGFQPTYGV 73 28
HLA-A*68:02 QSYGFQPTNGV QSYGFQPTYGV 122 48
HLA-B*15:01 GFQPTNGVGY GFQPTYGVGY 774 311
HLA-A*29:02 YGFQPTNGVGY YGFQPTYGVGY 1158 486
HLA-A*31:01 NGVGYQPYR YGVGYQPYR 438 185
HLA-A*02:06 LQSYGFQPTNGV LQSYGFQPTYGV 249 111
HLA-A*30:02 PTNGVGYQPY PTYGVGYQPY 465 210
HLA-B*15:03 FQPTNGVGY FQPTYGVGY 63 29
HLA-A*02:02 LQSYGFQPTNGV LQSYGFQPTYGV 594 280
HLA-B*15:03 GFQPTNGVGY GFQPTYGVGY 769 363

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*05:01 YQDVNCTEV YQGVNCTEV 82 8597
HLA-C*08:02 YQDVNCTEV YQGVNCTEV 89 8066
HLA-A*02:11 DVNCTEVPV GVNCTEVPV 2140 72
HLA-A*02:02 DVNCTEVPV GVNCTEVPV 4099 213
HLA-A*68:02 DVNCTEVPV GVNCTEVPV 36 659
HLA-A*02:06 DVNCTEVPV GVNCTEVPV 3807 208
HLA-A*68:02 QVAVLYQDV QVAVLYQGV 183 13
HLA-A*68:02 NQVAVLYQDV NQVAVLYQGV 650 52
HLA-A*02:06 QVAVLYQDV QVAVLYQGV 1312 148
HLA-A*02:11 QVAVLYQDV QVAVLYQGV 2169 268
HLA-A*68:02 NTSNQVAVLYQDV NTSNQVAVLYQGV 1858 231
HLA-A*68:02 TSNQVAVLYQDV TSNQVAVLYQGV 3281 457
HLA-A*02:02 QVAVLYQDV QVAVLYQGV 1107 188
HLA-A*02:01 YQDVNCTEV YQGVNCTEV 75 315
HLA-A*02:06 YQDVNCTEV YQGVNCTEV 17 57
HLA-A*02:11 VLYQDVNCT VLYQGVNCT 224 74
HLA-A*02:11 YQDVNCTEV YQGVNCTEV 31 93
HLA-A*02:11 VLYQDVNCTEVP VLYQGVNCTEVP 1000 402
HLA-A*02:02 NQVAVLYQDV NQVAVLYQGV 269 116
HLA-A*02:11 AVLYQDVNCTEV AVLYQGVNCTEV 500 238
HLA-A*02:01 NQVAVLYQDV NQVAVLYQGV 558 267
HLA-A*02:06 NQVAVLYQDV NQVAVLYQGV 36 18

H655Y

Reference  TPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TPTWRVYSTGSNVFQTRAGCLIGAEYVNNSYECDIPIGAGICASYQTQTNS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*15:01 RAGCLIGAEH RAGCLIGAEY 7377 156
HLA-A*30:02 RAGCLIGAEH RAGCLIGAEY 1881 43
HLA-B*15:01 FQTRAGCLIGAEH FQTRAGCLIGAEY 7512 178
HLA-B*15:03 FQTRAGCLIGAEH FQTRAGCLIGAEY 5076 125
HLA-A*30:02 AGCLIGAEH AGCLIGAEY 5331 179
HLA-B*15:03 RAGCLIGAEH RAGCLIGAEY 5254 179
HLA-A*30:02 QTRAGCLIGAEH QTRAGCLIGAEY 8425 342
HLA-B*15:03 AGCLIGAEH AGCLIGAEY 9025 461
HLA-A*02:11 HVNNSYECDIPI YVNNSYECDIPI 1593 109
HLA-A*02:01 HVNNSYECDIPI YVNNSYECDIPI 2384 226
HLA-A*02:06 HVNNSYECDIPI YVNNSYECDIPI 837 92
HLA-A*02:02 HVNNSYECDIPI YVNNSYECDIPI 1466 187
HLA-A*02:11 CLIGAEHV CLIGAEYV 983 221
HLA-B*15:03 AEHVNNSY AEYVNNSY 986 267
HLA-B*18:01 AEHVNNSY AEYVNNSY 902 286

T1027I

Reference  QSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    QSLQTYVTQQLIRAAEIRASANLAAIKMSECVLGQSKRVDFCGKGYHLMSF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*03:03 RASANLAAT RASANLAAI 4611 62
HLA-C*03:04 RASANLAAT RASANLAAI 4611 62
HLA-A*32:01 RASANLAAT RASANLAAI 22711 434
HLA-C*12:03 RASANLAAT RASANLAAI 2694 60
HLA-C*17:01 RASANLAAT RASANLAAI 11235 278
HLA-C*15:02 RASANLAAT RASANLAAI 6895 180
HLA-C*16:01 RASANLAAT RASANLAAI 924 25
HLA-B*40:01 AEIRASANLAAT AEIRASANLAAI 8508 344
HLA-C*03:02 RASANLAAT RASANLAAI 2899 129
HLA-B*58:01 RASANLAAT RASANLAAI 5883 333
HLA-B*15:03 RASANLAAT RASANLAAI 3151 184
HLA-B*44:02 AEIRASANLAAT AEIRASANLAAI 6113 368
HLA-C*12:02 RASANLAAT RASANLAAI 5044 305
HLA-B*40:02 AEIRASANLAAT AEIRASANLAAI 1973 232
HLA-A*02:06 RASANLAAT RASANLAAI 2857 336
HLA-A*30:01 ATKMSECVL AIKMSECVL 173 1150
HLA-C*16:01 ATKMSECVL AIKMSECVL 476 2866
HLA-A*30:01 ATKMSECVLGQSK AIKMSECVLGQSK 464 2739
HLA-A*30:01 RASANLAAT RASANLAAI 1238 321
HLA-A*02:02 NLAATKMSECVL NLAAIKMSECVL 877 285
HLA-A*02:02 NLAATKMSECV NLAAIKMSECV 702 236
HLA-A*02:11 NLAATKMSECV NLAAIKMSECV 647 232

V1176F

Reference  ELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ELDKYFKNHTSPDVDLGDISGINASFVNIQKEIDRLNEVAKNLNESLIDLQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:02 DISGINASV DISGINASF 10 1289
HLA-A*02:11 GDISGINASV GDISGINASF 238 15161
HLA-C*14:02 SVVNIQKEI SFVNIQKEI 6508 124
HLA-A*02:02 GDISGINASV GDISGINASF 71 3625
HLA-A*02:11 LGDISGINASV LGDISGINASF 446 19525
HLA-A*68:02 DLGDISGINASV DLGDISGINASF 362 15753
HLA-B*15:01 GDISGINASV GDISGINASF 15806 370
HLA-A*02:02 LGDISGINASV LGDISGINASF 208 8728
HLA-B*35:01 DISGINASV DISGINASF 16065 447
HLA-A*68:02 GDISGINASV GDISGINASF 453 15954
HLA-A*02:02 VDLGDISGINASV VDLGDISGINASF 413 11912
HLA-A*68:01 SVVNIQKEIDR SFVNIQKEIDR 288 5363
HLA-A*02:02 VVNIQKEIDRLNEV FVNIQKEIDRLNEV 2908 166
HLA-A*25:01 DISGINASV DISGINASF 3057 204
HLA-A*02:06 VVNIQKEIDRLNEV FVNIQKEIDRLNEV 871 59
HLA-A*26:01 DISGINASV DISGINASF 1865 129
HLA-A*02:11 VVNIQKEIDRLNEV FVNIQKEIDRLNEV 2044 152
HLA-A*68:01 VVNIQKEIDR FVNIQKEIDR 1917 242
HLA-A*02:06 GINASVVNI GINASFVNI 1251 237
HLA-A*68:01 SGINASVVNIQK SGINASFVNIQK 913 194
HLA-A*68:01 NASVVNIQKEIDR NASFVNIQKEIDR 127 30
HLA-A*68:01 INASVVNIQK INASFVNIQK 249 62
HLA-A*11:01 ASVVNIQK ASFVNIQK 1597 479
HLA-A*68:02 DISGINASVV DISGINASFV 59 19
HLA-A*03:02 NASVVNIQK NASFVNIQK 949 325
HLA-A*11:01 NASVVNIQK NASFVNIQK 235 83
HLA-A*11:01 SGINASVVNIQK SGINASFVNIQK 411 150
HLA-A*11:01 INASVVNIQK INASFVNIQK 270 101
HLA-A*03:02 INASVVNIQK INASFVNIQK 840 335
HLA-A*11:01 ISGINASVVNIQK ISGINASFVNIQK 1056 450
HLA-A*68:01 NASVVNIQK NASFVNIQK 13 6
HLA-C*16:01 ISGINASVV ISGINASFV 368 787

N protein

N

P80R

Reference  ALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ALTQHGKEDLKFPRGQGVPINTNSSRDDQIGYYRRATRRIRGGDGKMKDLS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*35:01 SPDDQIGYY SRDDQIGYY 101 17780
HLA-A*68:01 GVPINTNSSP GVPINTNSSR 32767 293
HLA-A*31:01 RGQGVPINTNSSP RGQGVPINTNSSR 32767 464
HLA-A*31:01 PDDQIGYYRRATRR RDDQIGYYRRATRR 9418 219
HLA-A*31:01 PDDQIGYYRRATR RDDQIGYYRRATR 7216 180
HLA-A*31:01 SSPDDQIGYYR SSRDDQIGYYR 625 27
HLA-A*30:02 SSPDDQIGY SSRDDQIGY 2069 139
HLA-B*15:03 SSPDDQIGY SSRDDQIGY 4130 376
HLA-C*03:02 SSPDDQIGY SSRDDQIGY 2626 388
HLA-A*33:03 SSPDDQIGYYR SSRDDQIGYYR 890 132
HLA-C*16:01 SSPDDQIGY SSRDDQIGY 1829 337
HLA-A*30:02 SSPDDQIGYY SSRDDQIGYY 247 48
HLA-A*31:01 SSPDDQIGYYRR SSRDDQIGYYRR 481 108
HLA-A*68:01 NSSPDDQIGYYRR NSSRDDQIGYYRR 487 1247
HLA-A*31:01 NTNSSPDDQIGYYR NTNSSRDDQIGYYR 356 175

203-204 RG->KR

Reference  GGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQ
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    GGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNGGDAALALLLLDRLNQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:01 NSTPGSSRG NSTPGSSKR 32767 34
HLA-A*33:03 NSTPGSSRG NSTPGSSKR 32767 300
HLA-B*15:03 SRGTSPARM SKRTSPARM 2669 106
HLA-A*31:01 RNSTPGSSRG RNSTPGSSKR 7013 340
HLA-A*30:01 SSRNSTPGSSR SSRNSTPGSSK 356 20
HLA-A*30:01 GTSPARMAG RTSPARMAG 493 30
HLA-A*31:01 SSRNSTPGSSRG SSRNSTPGSSKR 3757 231
HLA-A*30:01 GTSPARMAGNGG RTSPARMAGNGG 6051 411
HLA-A*31:01 SSRNSTPGSSR SSRNSTPGSSK 127 1853
HLA-A*30:01 NSSRNSTPGSSR NSSRNSTPGSSK 4255 353
HLA-A*30:01 RNSTPGSSR RNSTPGSSK 2120 188
HLA-A*31:01 RNSTPGSSR RNSTPGSSK 123 1335
HLA-A*03:01 SSRNSTPGSSR SSRNSTPGSSK 4753 442
HLA-A*11:01 SSRNSTPGSSR SSRNSTPGSSK 2231 263
HLA-A*68:01 NSSRNSTPGSSR NSSRNSTPGSSK 270 1385
HLA-A*30:01 GSSRGTSPA GSSKRTSPA 555 145
HLA-A*30:01 SSRNSTPGSSRG SSRNSTPGSSKR 1625 469
HLA-A*30:01 SSRGTSPARMAG SSKRTSPARMAG 449 1031

NS3 protein

NS3

S253P

Reference  VTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
           ||||||||||||||||||||||||| ||||||||||||||||||||||
Mutated    VTFFIYNKIVDEPEEHVQIHTIDGSPGVVNPVMEPIYDEPTTTTSVPL

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*42:01 SSGVVNPVM SPGVVNPVM 7497 28
HLA-B*07:02 SSGVVNPVM SPGVVNPVM 13017 70
HLA-B*35:01 SSGVVNPVM SPGVVNPVM 6921 73
HLA-B*42:01 SSGVVNPV SPGVVNPV 22475 317
HLA-B*35:03 SSGVVNPVM SPGVVNPVM 13571 355
HLA-C*16:01 SSGVVNPVM SPGVVNPVM 119 4324
HLA-C*15:02 GSSGVVNPV GSPGVVNPV 410 2450
HLA-A*68:02 DGSSGVVNPV DGSPGVVNPV 20 98
HLA-A*02:01 HTIDGSSGV HTIDGSPGV 658 140
HLA-A*02:02 GSSGVVNPV GSPGVVNPV 173 736
HLA-A*68:02 GSSGVVNPV GSPGVVNPV 52 214
HLA-A*68:02 VQIHTIDGSSGV VQIHTIDGSPGV 242 782
HLA-A*02:02 TIDGSSGVVNPV TIDGSPGVVNPV 314 1001
HLA-A*02:11 HTIDGSSGV HTIDGSPGV 81 26
HLA-A*02:06 IHTIDGSSGV IHTIDGSPGV 263 90
HLA-A*68:02 IHTIDGSSGV IHTIDGSPGV 40 114
HLA-A*02:06 HTIDGSSGV HTIDGSPGV 33 12
HLA-A*68:02 QIHTIDGSSGV QIHTIDGSPGV 118 318
HLA-A*68:02 TIDGSSGVVNPV TIDGSPGVVNPV 61 163
HLA-A*68:02 HVQIHTIDGSSGV HVQIHTIDGSPGV 63 159
HLA-A*68:02 EHVQIHTIDGSSGV EHVQIHTIDGSPGV 61 153
HLA-A*02:06 HTIDGSSGVV HTIDGSPGVV 589 238
HLA-A*02:11 IHTIDGSSGV IHTIDGSPGV 681 279
HLA-A*26:01 HTIDGSSGV HTIDGSPGV 149 361
HLA-A*02:06 VQIHTIDGSSGV VQIHTIDGSPGV 121 50
HLA-A*02:11 VQIHTIDGSSGV VQIHTIDGSPGV 931 444
HLA-A*02:06 GSSGVVNPV GSPGVVNPV 87 174

NS8 protein

NS8

E92K

Reference  SKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SKSPIQYIDIGNYTVSCLPFTINCQKPKLGSLVVRCSFYEDFLEYHDVRVV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:01 TVSCLPFTINCQE TVSCLPFTINCQK 13170 48
HLA-A*11:01 TVSCLPFTINCQE TVSCLPFTINCQK 31119 132
HLA-A*68:01 YTVSCLPFTINCQE YTVSCLPFTINCQK 14537 66
HLA-A*03:02 CLPFTINCQE CLPFTINCQK 18017 93
HLA-A*03:01 CLPFTINCQE CLPFTINCQK 22259 120
HLA-A*03:02 TVSCLPFTINCQE TVSCLPFTINCQK 31679 311
HLA-A*11:01 CLPFTINCQE CLPFTINCQK 28982 308
HLA-A*11:01 VSCLPFTINCQE VSCLPFTINCQK 28194 308
HLA-A*68:01 CLPFTINCQE CLPFTINCQK 15343 247
HLA-A*68:01 LPFTINCQE LPFTINCQK 17124 303
HLA-B*07:02 EPKLGSLVV KPKLGSLVV 685 18
HLA-B*08:01 CQEPKLGSL CQKPKLGSL 3079 81
HLA-B*07:02 EPKLGSLVVRCSF KPKLGSLVVRCSF 8372 301
HLA-B*07:02 EPKLGSLV KPKLGSLV 11398 438
HLA-B*08:01 NCQEPKLGSL NCQKPKLGSL 5460 397
HLA-B*42:01 EPKLGSLV KPKLGSLV 3548 271
HLA-B*42:01 EPKLGSLVVRCSF KPKLGSLVVRCSF 2752 283
HLA-B*15:01 CQEPKLGSL CQKPKLGSL 1956 239
HLA-B*42:01 EPKLGSLVV KPKLGSLVV 118 15
HLA-A*02:02 FTINCQEPKL FTINCQKPKL 140 765
HLA-A*68:01 PFTINCQEPK PFTINCQKPK 130 626
HLA-A*68:02 FTINCQEPKL FTINCQKPKL 113 534
HLA-A*68:01 FTINCQEPKL FTINCQKPKL 395 1765
HLA-A*02:06 FTINCQEPKL FTINCQKPKL 134 511
HLA-B*15:03 CQEPKLGSL CQKPKLGSL 432 137
HLA-A*31:01 CQEPKLGSLVVR CQKPKLGSLVVR 986 334
HLA-A*68:01 FTINCQEPK FTINCQKPK 7 15
HLA-A*03:02 FTINCQEPK FTINCQKPK 121 245

NS9b protein

NS9b

Q77E

Reference  LSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK
           ||||||||||||||||||||||||| ||||||||||||||||||||
Mutated    LSLNMARKTLNSLEDKAFQLTPIAVEMTKLATTEELPDEFVVVTVK

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:06 VQMTKLATT VEMTKLATT 120 10924
HLA-B*40:01 VQMTKLATTEEL VEMTKLATTEEL 11510 296
HLA-B*45:01 VQMTKLATT VEMTKLATT 11925 346
HLA-B*40:02 VQMTKLATT VEMTKLATT 6271 199
HLA-B*45:01 AVQMTKLATT AVEMTKLATT 11108 369
HLA-B*40:02 VQMTKLATTEEL VEMTKLATTEEL 10699 438
HLA-B*15:03 VQMTKLATT VEMTKLATT 344 6412
HLA-A*03:01 LTPIAVQMTK LTPIAVEMTK 105 337
HLA-B*07:02 TPIAVQMTKL TPIAVEMTKL 278 648
HLA-A*03:01 KAFQLTPIAVQMTK KAFQLTPIAVEMTK 425 895
HLA-B*42:01 TPIAVQMTKL TPIAVEMTKL 86 173
HLA-A*11:01 LTPIAVQMTK LTPIAVEMTK 23 46

NS9c protein

NS9c

49-50 VG->LN

Reference  EAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           |||||||||||||||||||||||||  |||||||||||||||||||||||
Mutated    EAAVKPLLVPHHVVATVQEIQLQAALNELLLLEWLAMAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 AVGELLLLEWL ALNELLLLEWL 3883 38
HLA-A*02:02 AVGELLLLEWL ALNELLLLEWL 3830 57
HLA-A*02:11 AVGELLLL ALNELLLL 10065 162
HLA-A*02:01 AVGELLLLEWL ALNELLLLEWL 6165 133
HLA-A*02:02 AVGELLLL ALNELLLL 7231 159
HLA-A*02:11 AVGELLLLEWLA ALNELLLLEWLA 837 32
HLA-A*02:02 AVGELLLLEWLA ALNELLLLEWLA 2812 125
HLA-B*18:01 GELLLLEWLAM NELLLLEWLAM 4979 247
HLA-A*02:11 AVGELLLLEWLAM ALNELLLLEWLAM 8089 438
HLA-A*02:01 AVGELLLLEWLA ALNELLLLEWLA 2242 175
HLA-B*40:01 VQEIQLQAAV VQEIQLQAAL 747 59
HLA-B*40:01 ATVQEIQLQAAV ATVQEIQLQAAL 1322 126
HLA-B*40:01 TVQEIQLQAAV TVQEIQLQAAL 2519 242
HLA-B*18:01 GELLLLEW NELLLLEW 3915 401
HLA-B*45:01 QEIQLQAAV QEIQLQAAL 51 496
HLA-A*02:06 QLQAAVGEL QLQAALNEL 2794 314
HLA-B*15:01 VQEIQLQAAV VQEIQLQAAL 1183 208
HLA-A*02:11 QLQAAVGEL QLQAALNEL 120 22
HLA-B*15:03 VQEIQLQAAV VQEIQLQAAL 975 183
HLA-A*02:01 QLQAAVGEL QLQAALNEL 1290 245
HLA-B*50:01 QEIQLQAAV QEIQLQAAL 260 1357
HLA-B*40:01 GELLLLEWL NELLLLEWL 28 140
HLA-B*40:01 QEIQLQAAV QEIQLQAAL 42 9
HLA-A*02:11 IQLQAAVGEL IQLQAALNEL 338 75
HLA-B*40:06 QEIQLQAAV QEIQLQAAL 210 901
HLA-A*02:02 QLQAAVGEL QLQAALNEL 92 23
HLA-B*40:02 GELLLLEWL NELLLLEWL 52 204
HLA-B*40:02 GELLLLEWLAM NELLLLEWLAM 201 772
HLA-C*03:03 AAVGELLLL AALNELLLL 107 409
HLA-C*03:04 AAVGELLLL AALNELLLL 107 409
HLA-A*02:01 QLQAAVGELLLL QLQAALNELLLL 748 203
HLA-A*02:01 IQLQAAVGEL IQLQAALNEL 1138 318
HLA-A*02:02 IQLQAAVGEL IQLQAALNEL 170 49
HLA-A*02:06 VQEIQLQAAV VQEIQLQAAL 286 958
HLA-B*40:02 ATVQEIQLQAAV ATVQEIQLQAAL 575 174
HLA-C*12:03 AAVGELLLL AALNELLLL 229 705
HLA-B*40:02 VQEIQLQAAV VQEIQLQAAL 270 89
HLA-B*57:01 AVGELLLLEW ALNELLLLEW 432 1281
HLA-B*40:02 TVQEIQLQAAV TVQEIQLQAAL 1139 394
HLA-A*02:02 AVGELLLLEWLAMA ALNELLLLEWLAMA 1165 403
HLA-C*03:02 AAVGELLLL AALNELLLL 269 710
HLA-B*58:01 AVGELLLLEW ALNELLLLEW 196 513
HLA-A*02:11 QLQAAVGELLLL QLQAALNELLLL 563 217
HLA-B*40:06 GELLLLEWLA NELLLLEWLA 268 677
HLA-B*40:02 GELLLLEWLA NELLLLEWLA 475 1195
HLA-B*58:01 VGELLLLEW LNELLLLEW 330 796
HLA-A*02:01 GELLLLEWLAMA NELLLLEWLAMA 109 258
HLA-A*02:01 QLQAAVGELL QLQAALNELL 961 420
HLA-B*18:01 QEIQLQAAV QEIQLQAAL 316 141
HLA-B*15:03 LQAAVGELL LQAALNELL 25 54
HLA-A*02:11 GELLLLEWLAMA NELLLLEWLAMA 29 61
HLA-B*15:01 LQAAVGELLL LQAALNELLL 109 229
HLA-A*02:02 LQAAVGELL LQAALNELL 44 21
HLA-A*02:02 QLQAAVGELL QLQAALNELL 35 17
HLA-B*15:01 LQAAVGELL LQAALNELL 105 213

NSP3 protein

NSP3

S370L

Reference  RVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKP
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    RVCVDTVRTNVYLAVFDKNLYDKLVLSFLEMKSEKQVEQKIAEIPKEEVKP

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:02 VSSFLEMKSEKQV VLSFLEMKSEKQV 6974 166
HLA-A*02:11 VSSFLEMKSEKQV VLSFLEMKSEKQV 9606 232
HLA-B*08:01 NLYDKLVS NLYDKLVL 11807 327
HLA-A*02:11 NLYDKLVS NLYDKLVL 5915 413
HLA-A*02:11 YDKLVSSFLEM YDKLVLSFLEM 216 2385
HLA-A*02:02 YDKLVSSFLEM YDKLVLSFLEM 366 3365
HLA-A*02:01 YDKLVSSFLEM YDKLVLSFLEM 363 3123
HLA-A*03:02 VSSFLEMKSEK VLSFLEMKSEK 1460 190
HLA-A*02:06 YDKLVSSFLEM YDKLVLSFLEM 489 3706
HLA-A*02:11 KLVSSFLEM KLVLSFLEM 12 77
HLA-A*03:01 VSSFLEMKSEK VLSFLEMKSEK 2465 391
HLA-A*68:01 LVSSFLEMK LVLSFLEMK 23 125
HLA-A*68:01 YDKLVSSFLEMK YDKLVLSFLEMK 207 1110
HLA-A*02:02 KLVSSFLEM KLVLSFLEM 58 309
HLA-A*02:01 KLVSSFLEM KLVLSFLEM 58 291
HLA-A*03:01 DKLVSSFLEMK DKLVLSFLEMK 215 1065
HLA-A*03:01 KLVSSFLEMKS KLVLSFLEMKS 470 2283
HLA-A*02:06 KLVSSFLEM KLVLSFLEM 46 223
HLA-C*03:03 KLVSSFLEM KLVLSFLEM 299 1350
HLA-C*03:04 KLVSSFLEM KLVLSFLEM 299 1350
HLA-C*03:02 KLVSSFLEM KLVLSFLEM 141 565
HLA-A*68:01 KLVSSFLEMK KLVLSFLEMK 497 1977
HLA-A*68:01 DKLVSSFLEMK DKLVLSFLEMK 191 757
HLA-C*14:02 KLVSSFLEM KLVLSFLEM 407 1572
HLA-A*11:01 SSFLEMKSEK LSFLEMKSEK 25 96
HLA-A*68:01 LVSSFLEMKSEK LVLSFLEMKSEK 399 1478
HLA-A*11:01 KLVSSFLEMKSEK KLVLSFLEMKSEK 399 1396
HLA-C*14:02 LYDKLVSSFLEM LYDKLVLSFLEM 307 1057
HLA-A*03:01 KLVSSFLEMKSEK KLVLSFLEMKSEK 80 273
HLA-A*03:02 KLVSSFLEMKSEK KLVLSFLEMKSEK 150 420
HLA-A*30:01 SSFLEMKSEK LSFLEMKSEK 247 617
HLA-B*15:01 KLVSSFLEM KLVLSFLEM 38 93
HLA-B*15:03 KLVSSFLEM KLVLSFLEM 12 29
HLA-C*14:02 LYDKLVSSF LYDKLVLSF 29 70
HLA-A*23:01 NLYDKLVSSF NLYDKLVLSF 760 320
HLA-A*32:01 KLVSSFLEM KLVLSFLEM 237 559
HLA-C*14:02 LYDKLVSSFL LYDKLVLSFL 231 502
HLA-A*03:01 KLVSSFLEMK KLVLSFLEMK 13 28
HLA-A*03:02 SSFLEMKSEK LSFLEMKSEK 232 490
HLA-C*07:02 LYDKLVSSF LYDKLVLSF 234 474

K977Q

Reference  YMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    YMGTLSYEQFKKGVQIPCTCGKQATQYLVQQESPFVMMSAPPAQYELKHGT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*11:01 CTCGKQATK CTCGKQATQ 217 18007
HLA-A*68:01 CTCGKQATK CTCGKQATQ 128 7381
HLA-A*03:02 CTCGKQATK CTCGKQATQ 400 19435
HLA-B*15:01 TKYLVQQESPF TQYLVQQESPF 2003 83
HLA-A*02:06 TKYLVQQESPFV TQYLVQQESPFV 3595 354
HLA-B*15:03 TKYLVQQESPFVM TQYLVQQESPFVM 491 80
HLA-B*15:03 ATKYLVQQESPF ATQYLVQQESPF 1335 317
HLA-B*15:03 KYLVQQESPFVM QYLVQQESPFVM 253 1053
HLA-B*15:03 TKYLVQQESPF TQYLVQQESPF 65 16
HLA-B*15:03 KYLVQQESPF QYLVQQESPF 286 791
HLA-B*15:01 KYLVQQESPF QYLVQQESPF 95 262
HLA-A*23:01 KYLVQQESPFVM QYLVQQESPFVM 410 1103
HLA-A*24:02 KYLVQQESPF QYLVQQESPF 145 373
HLA-A*23:01 KYLVQQESPF QYLVQQESPF 98 247

NSP6 protein

NSP6

SGF 106-108 deletion

Reference  FNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYD
           |||||||||||||||||||||||||   |||||||||||||||||||||||||
Mutated    FNMVYMPASWVMRIMTWLDMVDTSL‑‑‑KLKDCVMYASAVVLLILMTARTVYD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:02 FKLKDCVMYA - 8 -
HLA-A*02:11 FKLKDCVMYA - 12 -
HLA-B*15:03 FKLKDCVMY - 15 -
HLA-A*02:01 FKLKDCVMYA - 27 -
HLA-A*02:06 FKLKDCVMYA - 90 -
HLA-A*02:02 SGFKLKDCVMYA - 126 -
HLA-A*02:11 SGFKLKDCVMYA - 200 -
HLA-A*02:02 GFKLKDCVMYA - 239 -
HLA-A*23:01 TWLDMVDTSLSGF - 387 -
HLA-A*02:11 GFKLKDCVMYA - 394 -
HLA-A*02:02 WLDMVDTSLS - 441 -
HLA-A*02:11 FKLKDCVMYASAVV - 481 -
HLA-B*15:03 LSGFKLKDCVMY LKLKDCVMY 3466 22
HLA-A*02:11 LDMVDTSLSGFKL LDMVDTSLKL 16396 166
HLA-A*02:02 LDMVDTSLSGFKL LDMVDTSLKL 9971 106
HLA-A*02:11 SLSGFKLKDCV SLKLKDCV 122 9934
HLA-A*02:01 LDMVDTSLSGFKL LDMVDTSLKL 20579 311
HLA-B*08:01 SLSGFKLKDCVM SLKLKDCVM 929 36
HLA-A*02:02 SLSGFKLKDCV SLKLKDCV 408 10216
HLA-C*05:01 WLDMVDTSLSGFKL WLDMVDTSLKL 8375 417
HLA-B*15:01 SLSGFKLKDCVMY SLKLKDCVMY 2952 158
HLA-B*08:01 TSLSGFKLKDCVM TSLKLKDCVM 4628 289
HLA-B*15:01 SLSGFKLKDCVM SLKLKDCVM 2654 197
HLA-A*68:01 DMVDTSLSGFK DMVDTSLK 366 4919
HLA-A*02:11 WLDMVDTSLSGFKL WLDMVDTSLKL 1342 108
HLA-C*08:02 MVDTSLSGFKL MVDTSLKL 2134 174
HLA-B*15:03 SLSGFKLKDCVM SLKLKDCVM 3634 297
HLA-A*02:01 WLDMVDTSLSGFKL WLDMVDTSLKL 2214 195
HLA-A*03:02 WLDMVDTSLSGFK WLDMVDTSLK 1756 156
HLA-A*02:02 LSGFKLKDCVMYA LKLKDCVMYA 305 28
HLA-A*02:01 LSGFKLKDCVMYA LKLKDCVMYA 1788 165
HLA-A*02:11 LSGFKLKDCVMYA LKLKDCVMYA 578 54
HLA-B*15:03 SLSGFKLKDCVMY SLKLKDCVMY 3626 349
HLA-A*03:01 WLDMVDTSLSGFK WLDMVDTSLK 2900 287
HLA-C*05:01 MVDTSLSGFKL MVDTSLKL 1125 124
HLA-A*11:01 WLDMVDTSLSGFK WLDMVDTSLK 4020 492
HLA-A*02:02 WLDMVDTSLSGFKL WLDMVDTSLKL 788 116
HLA-A*68:01 DMVDTSLSGFKLK DMVDTSLKLK 1679 251
HLA-A*02:01 SLSGFKLKDCVMYA SLKLKDCVMYA 203 853
HLA-A*02:11 SLSGFKLKDCVMYA SLKLKDCVMYA 64 223
HLA-A*02:02 SLSGFKLKDCVMYA SLKLKDCVMYA 55 171
HLA-A*29:02 SLSGFKLKDCVMY SLKLKDCVMY 404 1192
HLA-A*11:01 MVDTSLSGFKLK MVDTSLKLK 143 50
HLA-A*03:02 MVDTSLSGFKLK MVDTSLKLK 312 127
HLA-A*68:01 MVDTSLSGFKLK MVDTSLKLK 602 246
HLA-A*03:01 MVDTSLSGFKLK MVDTSLKLK 441 190

NSP12 protein

NSP12

P323L

Reference  CVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    CVNCLDDRCILHCANFNVLFSTVFPLTSFGPLVRKIFVDGVPFVVSTGYHF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:01 FPPTSFGPLV FPLTSFGPLV 8999 21
HLA-A*02:02 FPPTSFGPLV FPLTSFGPLV 7237 18
HLA-A*02:11 FPPTSFGPLV FPLTSFGPLV 3405 9
HLA-A*32:01 VLFSTVFPP VLFSTVFPL 5415 27
HLA-A*02:11 LFSTVFPP LFSTVFPL 6706 35
HLA-A*02:11 ANFNVLFSTVFPP ANFNVLFSTVFPL 1827 12
HLA-A*02:11 NFNVLFSTVFPP NFNVLFSTVFPL 1779 13
HLA-A*02:11 NVLFSTVFPP NVLFSTVFPL 739 6
HLA-C*03:03 VLFSTVFPP VLFSTVFPL 28468 265
HLA-C*03:04 VLFSTVFPP VLFSTVFPL 28468 265
HLA-A*02:11 FNVLFSTVFPP FNVLFSTVFPL 413 4
HLA-C*14:02 VLFSTVFPP VLFSTVFPL 21407 220
HLA-A*02:11 FNVLFSTVFPPT FNVLFSTVFPLT 2618 27
HLA-A*02:01 LFSTVFPP LFSTVFPL 7475 81
HLA-C*14:02 LFSTVFPP LFSTVFPL 11979 138
HLA-B*15:03 VLFSTVFPP VLFSTVFPL 3115 36
HLA-A*02:11 VLFSTVFPP VLFSTVFPL 78 1
HLA-C*03:02 VLFSTVFPP VLFSTVFPL 20533 273
HLA-A*02:01 FNVLFSTVFPP FNVLFSTVFPL 656 9
HLA-A*02:01 ANFNVLFSTVFPP ANFNVLFSTVFPL 2569 37
HLA-A*02:11 FNVLFSTVFPPTS FNVLFSTVFPLTS 9448 142
HLA-A*02:02 NVLFSTVFPP NVLFSTVFPL 1088 17
HLA-A*02:11 CANFNVLFSTVFPP CANFNVLFSTVFPL 6143 96
HLA-A*02:02 FNVLFSTVFPP FNVLFSTVFPL 1014 16
HLA-A*68:02 NVLFSTVFPP NVLFSTVFPL 2213 37
HLA-A*02:02 ANFNVLFSTVFPP ANFNVLFSTVFPL 3126 53
HLA-A*02:11 PPTSFGPLV PLTSFGPLV 28329 483
HLA-C*16:01 VLFSTVFPP VLFSTVFPL 24733 432
HLA-C*17:01 VLFSTVFPP VLFSTVFPL 25087 439
HLA-A*02:01 FNVLFSTVFPPT FNVLFSTVFPLT 3765 66
HLA-A*02:02 LFSTVFPP LFSTVFPL 9311 167
HLA-A*02:01 NVLFSTVFPP NVLFSTVFPL 928 17
HLA-A*02:02 NFNVLFSTVFPP NFNVLFSTVFPL 2542 47
HLA-A*02:02 VLFSTVFPP VLFSTVFPL 269 5
HLA-A*02:01 NFNVLFSTVFPP NFNVLFSTVFPL 2286 44
HLA-A*02:06 FPPTSFGPLV FPLTSFGPLV 3379 73
HLA-A*02:01 VLFSTVFPP VLFSTVFPL 179 4
HLA-A*02:06 FNVLFSTVFPP FNVLFSTVFPL 1609 37
HLA-A*02:02 FNVLFSTVFPPT FNVLFSTVFPLT 4116 110
HLA-A*02:11 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 6695 180
HLA-A*02:01 FNVLFSTVFPPTS FNVLFSTVFPLTS 11451 311
HLA-A*02:06 VLFSTVFPP VLFSTVFPL 368 10
HLA-A*02:11 ANFNVLFSTVFPPT ANFNVLFSTVFPLT 14639 409
HLA-A*02:01 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 12596 425
HLA-A*68:01 PTSFGPLVR LTSFGPLVR 908 36
HLA-A*02:06 NVLFSTVFPP NVLFSTVFPL 1611 66
HLA-B*15:01 VLFSTVFPP VLFSTVFPL 5731 243
HLA-B*35:01 FPPTSFGPL FPLTSFGPL 304 13
HLA-B*53:01 FPPTSFGPL FPLTSFGPL 3581 154
HLA-C*01:02 FPPTSFGPL FPLTSFGPL 217 4855
HLA-A*02:01 CANFNVLFSTVFPP CANFNVLFSTVFPL 8519 384
HLA-A*02:02 FNVLFSTVFPPTS FNVLFSTVFPLTS 10920 497
HLA-A*02:02 FSTVFPPTSFGPLV FSTVFPLTSFGPLV 6958 322
HLA-A*02:11 VFPPTSFGPLV VFPLTSFGPLV 4242 199
HLA-A*02:02 CANFNVLFSTVFPP CANFNVLFSTVFPL 8183 391
HLA-A*02:11 NFNVLFSTVFPPT NFNVLFSTVFPLT 9111 472
HLA-A*02:06 ANFNVLFSTVFPP ANFNVLFSTVFPL 5191 304
HLA-A*02:06 NFNVLFSTVFPP NFNVLFSTVFPL 4220 274
HLA-A*02:06 FNVLFSTVFPPT FNVLFSTVFPLT 4868 388
HLA-B*35:03 FPPTSFGPL FPLTSFGPL 286 24
HLA-A*03:01 PTSFGPLVRK LTSFGPLVRK 554 47
HLA-A*31:01 PTSFGPLVR LTSFGPLVR 4402 390
HLA-A*11:01 PTSFGPLVR LTSFGPLVR 4068 379
HLA-A*03:02 PTSFGPLVRK LTSFGPLVRK 868 88
HLA-B*07:02 STVFPPTSFGPL STVFPLTSFGPL 777 79
HLA-A*68:01 PTSFGPLVRK LTSFGPLVRK 308 34
HLA-B*07:02 TVFPPTSFGPL TVFPLTSFGPL 1498 171
HLA-A*02:11 STVFPPTSFGPLV STVFPLTSFGPLV 2427 285
HLA-A*02:11 NVLFSTVFPPT NVLFSTVFPLT 1183 139
HLA-A*33:03 PTSFGPLVR LTSFGPLVR 3228 381
HLA-A*26:01 STVFPPTSF STVFPLTSF 786 95
HLA-B*07:02 VFPPTSFGPL VFPLTSFGPL 339 43
HLA-A*02:01 NVLFSTVFPPT NVLFSTVFPLT 2111 290
HLA-B*42:01 FSTVFPPTSFGPL FSTVFPLTSFGPL 1320 185
HLA-B*42:01 STVFPPTSFGPL STVFPLTSFGPL 738 111
HLA-A*02:01 VLFSTVFPPTSF VLFSTVFPLTSF 2225 342
HLA-B*08:01 FPPTSFGPL FPLTSFGPL 973 153
HLA-B*42:01 TVFPPTSFGPL TVFPLTSFGPL 843 142
HLA-A*11:01 PTSFGPLVRK LTSFGPLVRK 123 21
HLA-B*42:01 VFPPTSFGPL VFPLTSFGPL 274 47
HLA-A*02:01 VLFSTVFPPTS VLFSTVFPLTS 708 124
HLA-B*07:02 FSTVFPPTSFGPL FSTVFPLTSFGPL 2537 466
HLA-B*07:02 FPPTSFGPL FPLTSFGPL 42 8
HLA-A*02:11 VLFSTVFPPTSF VLFSTVFPLTSF 1019 195
HLA-A*25:01 STVFPPTSF STVFPLTSF 1533 296
HLA-B*07:02 FPPTSFGPLV FPLTSFGPLV 1131 236
HLA-B*42:01 FPPTSFGPL FPLTSFGPL 21 5
HLA-A*26:01 FSTVFPPTSF FSTVFPLTSF 1667 398
HLA-B*51:01 FPPTSFGPL FPLTSFGPL 1809 433
HLA-A*02:11 VLFSTVFPPTS VLFSTVFPLTS 309 74
HLA-B*42:01 FPPTSFGPLV FPLTSFGPLV 368 89
HLA-A*02:02 VLFSTVFPPTS VLFSTVFPLTS 1210 377
HLA-C*03:02 FPPTSFGPL FPLTSFGPL 960 313
HLA-A*32:01 STVFPPTSF STVFPLTSF 230 86
HLA-B*58:01 FSTVFPPTSF FSTVFPLTSF 88 33
HLA-B*15:01 STVFPPTSF STVFPLTSF 130 49
HLA-A*02:01 VLFSTVFPPT VLFSTVFPLT 61 23
HLA-C*03:03 FPPTSFGPL FPLTSFGPL 375 145
HLA-C*03:04 FPPTSFGPL FPLTSFGPL 375 145
HLA-A*02:02 VLFSTVFPPT VLFSTVFPLT 113 44
HLA-C*16:01 FSTVFPPTS FSTVFPLTS 1127 460
HLA-C*14:02 LFSTVFPPTSF LFSTVFPLTSF 396 950
HLA-C*01:02 VFPPTSFGPL VFPLTSFGPL 429 997
HLA-A*02:02 TVFPPTSFGPLV TVFPLTSFGPLV 789 343
HLA-A*68:02 STVFPPTSFGPLV STVFPLTSFGPLV 169 74
HLA-A*02:11 VLFSTVFPPT VLFSTVFPLT 25 11
HLA-A*03:01 TVFPPTSFGPLVRK TVFPLTSFGPLVRK 92 198
HLA-C*14:02 VFPPTSFGPL VFPLTSFGPL 47 99
HLA-A*23:01 LFSTVFPPTSF LFSTVFPLTSF 370 179

NSP13 protein

NSP13

E341D

Reference  ALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPET
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ALCEKALKYLPIDKCSRIIPARARVDCFDKFKVNSTLEQYVFCTVNALPET

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*42:01 IPARARVEC IPARARVDC 60 315
HLA-B*07:02 IPARARVEC IPARARVDC 98 491
HLA-A*02:11 RVECFDKFKV RVDCFDKFKV 1174 238
HLA-A*30:01 RVECFDKFK RVDCFDKFK 337 1022
HLA-A*02:06 RVECFDKFKV RVDCFDKFKV 1311 435
HLA-B*07:02 IPARARVECF IPARARVDCF 45 117
HLA-A*11:01 ARVECFDKFK ARVDCFDKFK 876 354
HLA-B*42:01 IPARARVECF IPARARVDCF 45 96
HLA-A*11:01 RVECFDKFK RVDCFDKFK 195 92