Summary

This strain contains 23 protein-level mutations:

  • 12 mutations in Spike protein: L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y, T1027I, V1176F
  • 2 mutations in N protein: P80R, 203-204 RG->KR
  • 1 mutation in NS3 protein: S253P
  • 1 mutation in NS8 protein: E92K
  • 1 mutation in NS9b protein: Q77E
  • 1 mutation in NS9c protein: 49-50 VG->LN
  • 2 mutations in NSP3 protein: S370L, K977Q
  • 1 mutation in NSP6 protein: SGF 106-108 deletion
  • 1 mutation in NSP12 protein: P323L
  • 1 mutation in NSP13 protein: E341D

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

L18F

Reference  MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVF
           ||||||||||||||||| |||||||||||||||||||||||||
Mutated    MFVFLVLLPLVSSQCVNFTNRTQLPSAYTNSFTRGVYYPDKVF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:01 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 3176 439
HLA-DRB1*11:01 CVNLTTRTQLPPAYT CVNFTNRTQLPSAYT 2120 415
HLA-DRB1*11:01 QCVNLTTRTQLPPAY QCVNFTNRTQLPSAY 1508 441
HLA-DRB1*11:04 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 1300 496
HLA-DRB1*01:01 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 394 997
HLA-DRB1*01:01 LVSSQCVNLTTRTQL LVSSQCVNFTNRTQL 230 555
HLA-DRB1*01:01 PLVSSQCVNLTTRTQ PLVSSQCVNFTNRTQ 177 425
HLA-DRB1*01:01 LPLVSSQCVNLTTRT LPLVSSQCVNFTNRT 105 240
HLA-DRB1*01:01 LPLVSSQCVNLTTRTQL LPLVSSQCVNFTNRTQL 311 705
HLA-DRB1*10:01 VNLTTRTQLPPAYTNSFTRG VNFTNRTQLPSAYTNSFTRG 556 258
HLA-DRB1*01:01 NLTTRTQLPPAYTNS NFTNRTQLPSAYTNS 668 311
HLA-DRB1*10:01 CVNLTTRTQLPPAYTNSFTR CVNFTNRTQLPSAYTNSFTR 536 250
HLA-DRB1*10:01 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 431 921
HLA-DRB1*01:01 LPLVSSQCVNLTTRTQ LPLVSSQCVNFTNRTQ 389 826
HLA-DRB1*01:01 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 621 293
HLA-DRB1*01:01 LTTRTQLPPAYTNSF FTNRTQLPSAYTNSF 491 235
HLA-DQA1*01:02/DQB1*05:01 NLTTRTQLPPAYTNSFTRGV NFTNRTQLPSAYTNSFTRGV 636 310
HLA-DQA1*01:02/DQB1*05:01 LTTRTQLPPAYTNSFTRGVY FTNRTQLPSAYTNSFTRGVY 622 306
HLA-DRB1*11:04 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 469 951
HLA-DRB1*14:01 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 333 672
HLA-DRB1*10:01 VNLTTRTQLPPAYTNSFTR VNFTNRTQLPSAYTNSFTR 962 477
HLA-DRB1*11:02 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 313 631
HLA-DRB1*13:01 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 313 631

T20N

Reference  MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRS
           ||||||||||||||||||| |||||||||||||||||||||||||
Mutated    MFVFLVLLPLVSSQCVNFTNRTQLPSAYTNSFTRGVYYPDKVFRS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:01 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 3176 439
HLA-DRB1*11:01 CVNLTTRTQLPPAYT CVNFTNRTQLPSAYT 2120 415
HLA-DRB1*11:01 QCVNLTTRTQLPPAY QCVNFTNRTQLPSAY 1508 441
HLA-DRB1*11:04 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 1300 496
HLA-DRB1*01:01 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 394 997
HLA-DRB1*01:01 LVSSQCVNLTTRTQL LVSSQCVNFTNRTQL 230 555
HLA-DRB1*01:01 PLVSSQCVNLTTRTQ PLVSSQCVNFTNRTQ 177 425
HLA-DRB1*01:01 LPLVSSQCVNLTTRT LPLVSSQCVNFTNRT 105 240
HLA-DRB1*01:01 LPLVSSQCVNLTTRTQL LPLVSSQCVNFTNRTQL 311 705
HLA-DRB1*10:01 VNLTTRTQLPPAYTNSFTRG VNFTNRTQLPSAYTNSFTRG 556 258
HLA-DRB1*01:01 NLTTRTQLPPAYTNS NFTNRTQLPSAYTNS 668 311
HLA-DRB1*10:01 CVNLTTRTQLPPAYTNSFTR CVNFTNRTQLPSAYTNSFTR 536 250
HLA-DRB1*10:01 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 431 921
HLA-DRB1*01:01 LPLVSSQCVNLTTRTQ LPLVSSQCVNFTNRTQ 389 826
HLA-DRB1*01:01 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 621 293
HLA-DRB1*01:01 LTTRTQLPPAYTNSF FTNRTQLPSAYTNSF 491 235
HLA-DQA1*01:02/DQB1*05:01 NLTTRTQLPPAYTNSFTRGV NFTNRTQLPSAYTNSFTRGV 636 310
HLA-DQA1*01:02/DQB1*05:01 LTTRTQLPPAYTNSFTRGVY FTNRTQLPSAYTNSFTRGVY 622 306
HLA-DRB1*11:04 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 469 951
HLA-DRB1*14:01 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 333 672
HLA-DRB1*10:01 VNLTTRTQLPPAYTNSFTR VNFTNRTQLPSAYTNSFTR 962 477
HLA-DRB1*11:02 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 313 631
HLA-DRB1*13:01 VSSQCVNLTTRTQLP VSSQCVNFTNRTQLP 313 631

P26S

Reference  MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHST
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    MFVFLVLLPLVSSQCVNFTNRTQLPSAYTNSFTRGVYYPDKVFRSSVLHST

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:01 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 3176 439
HLA-DRB1*11:01 CVNLTTRTQLPPAYT CVNFTNRTQLPSAYT 2120 415
HLA-DRB1*11:01 QCVNLTTRTQLPPAY QCVNFTNRTQLPSAY 1508 441
HLA-DRB1*11:04 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 1300 496
HLA-DRB1*10:01 VNLTTRTQLPPAYTNSFTRG VNFTNRTQLPSAYTNSFTRG 556 258
HLA-DRB1*01:01 NLTTRTQLPPAYTNS NFTNRTQLPSAYTNS 668 311
HLA-DRB1*10:01 CVNLTTRTQLPPAYTNSFTR CVNFTNRTQLPSAYTNSFTR 536 250
HLA-DRB1*01:01 VNLTTRTQLPPAYTN VNFTNRTQLPSAYTN 621 293
HLA-DRB1*01:01 LTTRTQLPPAYTNSF FTNRTQLPSAYTNSF 491 235
HLA-DQA1*01:02/DQB1*05:01 NLTTRTQLPPAYTNSFTRGV NFTNRTQLPSAYTNSFTRGV 636 310
HLA-DQA1*01:02/DQB1*05:01 LTTRTQLPPAYTNSFTRGVY FTNRTQLPSAYTNSFTRGVY 622 306
HLA-DRB1*10:01 VNLTTRTQLPPAYTNSFTR VNFTNRTQLPSAYTNSFTR 962 477

D138Y

Reference  KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSA
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    KTQSLLIVNNATNVVIKVCEFQFCNYPFLGVYYHKNNKSWMESEFRVYSSA

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*01:03/DPB1*04:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1901 239
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1437 223
HLA-DPA1*04:01/DPB1*04:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1326 223
HLA-DPA1*01:03/DPB1*04:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 1527 280
HLA-DRB1*15:01 FQFCNDPFLGVYYHK FQFCNYPFLGVYYHK 1053 203
HLA-DRB1*15:03 FQFCNDPFLGVYYHK FQFCNYPFLGVYYHK 1319 256
HLA-DRB1*15:03 EFQFCNDPFLGVYYH EFQFCNYPFLGVYYH 1297 254
HLA-DRB1*15:03 CEFQFCNDPFLGVYYHK CEFQFCNYPFLGVYYHK 2077 426
HLA-DRB1*15:01 CEFQFCNDPFLGVYYHK CEFQFCNYPFLGVYYHK 1734 356
HLA-DRB1*15:03 CEFQFCNDPFLGVYY CEFQFCNYPFLGVYY 1517 313
HLA-DPA1*04:01/DPB1*02:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 902 187
HLA-DRB1*15:01 FQFCNDPFLGVYYHKN FQFCNYPFLGVYYHKN 2055 437
HLA-DRB1*15:01 EFQFCNDPFLGVYYHK EFQFCNYPFLGVYYHK 1990 426
HLA-DRB1*15:01 CEFQFCNDPFLGVYYH CEFQFCNYPFLGVYYH 2267 486
HLA-DRB1*15:01 EFQFCNDPFLGVYYH EFQFCNYPFLGVYYH 1040 224
HLA-DRB1*15:01 CEFQFCNDPFLGVYY CEFQFCNYPFLGVYY 1187 256
HLA-DRB1*15:01 EFQFCNDPFLGVYYHKN EFQFCNYPFLGVYYHKN 1553 335
HLA-DRB1*15:01 FQFCNDPFLGVYYHKNN FQFCNYPFLGVYYHKNN 1664 361
HLA-DPA1*01:03/DPB1*04:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 1109 244
HLA-DRB1*15:01 VCEFQFCNDPFLGVYYH VCEFQFCNYPFLGVYYH 1816 402
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 343 76
HLA-DRB1*15:01 QFCNDPFLGVYYHKN QFCNYPFLGVYYHKN 1054 235
HLA-DRB1*15:03 VCEFQFCNDPFLGVYYH VCEFQFCNYPFLGVYYH 2177 488
HLA-DPA1*04:01/DPB1*04:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 979 221
HLA-DRB1*04:01 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 368 1613
HLA-DRB1*15:03 KVCEFQFCNDPFLGVYYHK KVCEFQFCNYPFLGVYYHK 2140 490
HLA-DPA1*03:01/DPB1*04:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 544 125
HLA-DRB1*15:01 KVCEFQFCNDPFLGVYY KVCEFQFCNYPFLGVYY 1796 415
HLA-DRB1*15:03 QFCNDPFLGVYYHKN QFCNYPFLGVYYHKN 1224 286
HLA-DRB1*15:03 EFQFCNDPFLGVYYHKN EFQFCNYPFLGVYYHKN 1596 376
HLA-DRB1*15:01 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 1238 293
HLA-DRB1*15:03 FQFCNDPFLGVYYHKNN FQFCNYPFLGVYYHKNN 1762 425
HLA-DRB1*15:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNYPFLGVYYHK 1692 409
HLA-DPA1*01:03/DPB1*04:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 1393 340
HLA-DRB1*15:03 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 1546 379
HLA-DRB1*15:01 CEFQFCNDPFLGVYYHKNN CEFQFCNYPFLGVYYHKNN 1703 424
HLA-DRB1*15:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNYPFLGVYYH 1861 466
HLA-DRB1*15:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNYPFLGVYYHKN 1601 405
HLA-DRB1*10:01 FCNDPFLGVYYHKNN FCNYPFLGVYYHKNN 505 128
HLA-DPA1*01:03/DPB1*02:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 1223 311
HLA-DRB1*15:03 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNYPFLGVYYHK 1372 350
HLA-DPA1*02:02/DPB1*04:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1881 488
HLA-DRB1*15:03 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 1500 390
HLA-DRB1*15:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1765 462
HLA-DPA1*01:03/DPB1*04:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 1154 305
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVYYHK VCEFQFCNYPFLGVYYHK 200 53
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 267 71
HLA-DRB1*15:03 CEFQFCNDPFLGVYYHKNN CEFQFCNYPFLGVYYHKNN 1833 488
HLA-DRB1*15:03 VCEFQFCNDPFLGVYYHKN VCEFQFCNYPFLGVYYHKN 1754 468
HLA-DPA1*03:01/DPB1*04:02 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1394 373
HLA-DPA1*03:01/DPB1*105:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1394 373
HLA-DPA1*04:01/DPB1*04:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 854 230
HLA-DRB1*15:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNYPFLGVYYHK 995 268
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 126 34
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNYPFLGVYYH 188 51
HLA-DRB1*15:03 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNYPFLGVYYH 1544 420
HLA-DRB1*15:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNYPFLGVYYH 1109 306
HLA-DRB1*10:01 QFCNDPFLGVYYHKN QFCNYPFLGVYYHKN 539 149
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 278 77
HLA-DRB1*15:01 QFCNDPFLGVYYHKNNK QFCNYPFLGVYYHKNNK 1501 416
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 90 25
HLA-DRB1*15:01 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 1164 324
HLA-DRB1*15:01 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNYPFLGVYYHKN 846 236
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 165 47
HLA-DRB1*15:01 EFQFCNDPFLGVYYHKNNK EFQFCNYPFLGVYYHKNNK 1469 419
HLA-DRB1*10:01 QFCNDPFLGVYYHKNN QFCNYPFLGVYYHKNN 927 265
HLA-DPA1*04:01/DPB1*04:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 968 277
HLA-DPA1*03:01/DPB1*04:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 405 116
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNYPFLGVYY 184 53
HLA-DRB1*15:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 1691 489
HLA-DPA1*01:03/DPB1*02:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 785 230
HLA-DRB1*04:01 CEFQFCNDPFLGVYY CEFQFCNYPFLGVYY 473 1611
HLA-DRB1*15:01 VCEFQFCNDPFLGVYYHKNN VCEFQFCNYPFLGVYYHKNN 841 248
HLA-DRB1*15:01 FCNDPFLGVYYHKNN FCNYPFLGVYYHKNN 1129 335
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGVY KVCEFQFCNYPFLGVY 101 30
HLA-DPA1*03:01/DPB1*04:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 341 102
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLGV IKVCEFQFCNYPFLGV 137 41
HLA-DPA1*04:01/DPB1*04:01 NVVIKVCEFQFCNDPFLG NVVIKVCEFQFCNYPFLG 1479 443
HLA-DPA1*01:03/DPB1*04:01 TNVVIKVCEFQFCNDPFLG TNVVIKVCEFQFCNYPFLG 1276 384
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNYPFLGVY 199 60
HLA-DRB1*15:03 KVCEFQFCNDPFLGVYYHKN KVCEFQFCNYPFLGVYYHKN 999 302
HLA-DPA1*02:01/DPB1*02:01 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 666 206
HLA-DRB1*15:03 FCNDPFLGVYYHKNN FCNYPFLGVYYHKNN 1296 402
HLA-DRB1*15:03 VCEFQFCNDPFLGVYYHKNN VCEFQFCNYPFLGVYYHKNN 998 310
HLA-DRB1*15:03 EFQFCNDPFLGVYYHKNNK EFQFCNYPFLGVYYHKNNK 1576 490
HLA-DPA1*02:02/DPB1*02:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1513 471
HLA-DRB1*10:01 FCNDPFLGVYYHKNNK FCNYPFLGVYYHKNNK 793 248
HLA-DPA1*03:01/DPB1*02:01 NVVIKVCEFQFCNDPFLG NVVIKVCEFQFCNYPFLG 518 162
HLA-DPA1*03:01/DPB1*04:01 NVVIKVCEFQFCNDPFLG NVVIKVCEFQFCNYPFLG 714 224
HLA-DPA1*04:01/DPB1*04:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 752 236
HLA-DPA1*01:03/DPB1*02:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 1105 347
HLA-DPA1*04:01/DPB1*02:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 697 219
HLA-DPA1*03:01/DPB1*04:02 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 1138 359
HLA-DPA1*03:01/DPB1*105:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 1138 359
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLGVY IKVCEFQFCNYPFLGVY 114 36
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLGV IKVCEFQFCNYPFLGV 354 112
HLA-DRB1*01:01 FCNDPFLGVYYHKNN FCNYPFLGVYYHKNN 840 266
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVYY VCEFQFCNYPFLGVYY 85 27
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFLGV VVIKVCEFQFCNYPFLGV 257 82
HLA-DRB1*15:01 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNYPFLGVYY 1139 364
HLA-DRB1*10:01 QFCNDPFLGVYYHKNNK QFCNYPFLGVYYHKNNK 686 220
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVYYH VCEFQFCNYPFLGVYYH 99 32
HLA-DPA1*03:01/DPB1*02:01 CEFQFCNDPFLGVYY CEFQFCNYPFLGVYY 77 25
HLA-DPA1*02:02/DPB1*01:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 948 308
HLA-DPA1*02:01/DPB1*01:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1248 406
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGVYY KVCEFQFCNYPFLGVYY 98 32
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGVY KVCEFQFCNYPFLGVY 210 69
HLA-DPA1*03:01/DPB1*02:01 EFQFCNDPFLGVYYH EFQFCNYPFLGVYYH 73 24
HLA-DPA1*01:03/DPB1*04:01 NVVIKVCEFQFCNDPFL NVVIKVCEFQFCNYPFL 1158 381
HLA-DPA1*02:01/DPB1*02:01 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 421 139
HLA-DRB1*15:01 CEFQFCNDPFLGVYYHKNNK CEFQFCNYPFLGVYYHKNNK 747 247
HLA-DRB1*10:01 FQFCNDPFLGVYYHK FQFCNYPFLGVYYHK 668 221
HLA-DPA1*01:03/DPB1*02:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 946 314
HLA-DPA1*03:01/DPB1*02:01 CEFQFCNDPFLGVYYHK CEFQFCNYPFLGVYYHK 108 36
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 198 66
HLA-DQA1*01:02/DQB1*06:04 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 453 1356
HLA-DRB1*15:03 CEFQFCNDPFLGVYYHKNNK CEFQFCNYPFLGVYYHKNNK 936 313
HLA-DPA1*03:01/DPB1*02:01 CEFQFCNDPFLGVYYH CEFQFCNYPFLGVYYH 86 29
HLA-DRB1*10:01 FQFCNDPFLGVYYHKNN FQFCNYPFLGVYYHKNN 631 214
HLA-DPA1*04:01/DPB1*04:01 TNVVIKVCEFQFCNDPFLG TNVVIKVCEFQFCNYPFLG 850 289
HLA-DPA1*03:01/DPB1*02:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNYPFLGVYYHK 94 32
HLA-DPA1*03:01/DPB1*02:01 EFQFCNDPFLGVYYHK EFQFCNYPFLGVYYHK 91 31
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNYPFLGVYYH 370 127
HLA-DPA1*04:01/DPB1*04:01 NVVIKVCEFQFCNDPFL NVVIKVCEFQFCNYPFL 837 291
HLA-DRB1*10:01 CNDPFLGVYYHKNNK CNYPFLGVYYHKNNK 417 145
HLA-DRB1*16:01 QFCNDPFLGVYYHKN QFCNYPFLGVYYHKN 1296 454
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 256 90
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 307 108
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVYYHK VCEFQFCNYPFLGVYYHK 375 132
HLA-DPA1*01:03/DPB1*01:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 1006 355
HLA-DPA1*01:03/DPB1*02:01 CEFQFCNDPFLGVYY CEFQFCNYPFLGVYY 124 44
HLA-DPA1*01:03/DPB1*04:01 ATNVVIKVCEFQFCNDPFL ATNVVIKVCEFQFCNYPFL 1246 444
HLA-DPA1*01:03/DPB1*04:01 ATNVVIKVCEFQFCNDPFLG ATNVVIKVCEFQFCNYPFLG 1140 408
HLA-DPA1*01:03/DPB1*02:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNYPFLGVY 502 180
HLA-DPA1*02:02/DPB1*04:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 1355 487
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNYPFLGVYY 406 146
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFLGV VIKVCEFQFCNYPFLGV 136 49
HLA-DPA1*04:01/DPB1*02:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 541 195
HLA-DRB1*01:01 CNDPFLGVYYHKNNK CNYPFLGVYYHKNNK 918 333
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNYPFLGVYYH 88 32
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 376 137
HLA-DPA1*01:03/DPB1*02:01 EFQFCNDPFLGVYYH EFQFCNYPFLGVYYH 112 41
HLA-DRB1*15:01 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNYPFLGVY 1174 430
HLA-DPA1*02:01/DPB1*02:01 EFQFCNDPFLGVYYH EFQFCNYPFLGVYYH 292 107
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 218 80
HLA-DRB1*10:01 FQFCNDPFLGVYYHKN FQFCNYPFLGVYYHKN 702 258
HLA-DPA1*03:01/DPB1*04:01 TNVVIKVCEFQFCNDPFL TNVVIKVCEFQFCNYPFL 640 236
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLGVY IKVCEFQFCNYPFLGVY 238 88
HLA-DPA1*04:01/DPB1*02:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 720 268
HLA-DPA1*03:01/DPB1*04:02 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 921 343
HLA-DPA1*03:01/DPB1*105:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 921 343
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVYY VCEFQFCNYPFLGVYY 158 59
HLA-DPA1*03:01/DPB1*02:01 CEFQFCNDPFLGVYYHKN CEFQFCNYPFLGVYYHKN 112 42
HLA-DPA1*03:01/DPB1*02:01 FQFCNDPFLGVYYHK FQFCNYPFLGVYYHK 101 38
HLA-DPA1*01:03/DPB1*02:01 TNVVIKVCEFQFCNDPFLG TNVVIKVCEFQFCNYPFLG 1078 408
HLA-DPA1*01:03/DPB1*02:01 VVIKVCEFQFCNDPFLGV VVIKVCEFQFCNYPFLGV 726 275
HLA-DPA1*03:01/DPB1*02:01 TNVVIKVCEFQFCNDPFL TNVVIKVCEFQFCNYPFL 473 180
HLA-DPA1*02:01/DPB1*02:01 CEFQFCNDPFLGVYY CEFQFCNYPFLGVYY 323 124
HLA-DPA1*03:01/DPB1*02:01 NVVIKVCEFQFCNDPFLGV NVVIKVCEFQFCNYPFLGV 138 53
HLA-DPA1*04:01/DPB1*04:01 ATNVVIKVCEFQFCNDPFLG ATNVVIKVCEFQFCNYPFLG 726 281
HLA-DPA1*03:01/DPB1*02:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNYPFLGVY 103 40
HLA-DPA1*02:01/DPB1*02:01 KVCEFQFCNDPFLGVY KVCEFQFCNYPFLGVY 503 196
HLA-DPA1*01:03/DPB1*02:01 VIKVCEFQFCNDPFLGV VIKVCEFQFCNYPFLGV 349 136
HLA-DPA1*03:01/DPB1*02:01 EFQFCNDPFLGVYYHKN EFQFCNYPFLGVYYHKN 59 23
HLA-DPA1*01:03/DPB1*02:01 NVVIKVCEFQFCNDPFL NVVIKVCEFQFCNYPFL 879 343
HLA-DPA1*02:01/DPB1*01:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 986 385
HLA-DPA1*03:01/DPB1*04:02 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 931 364
HLA-DPA1*03:01/DPB1*105:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 931 364
HLA-DPA1*03:01/DPB1*04:02 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 1064 416
HLA-DPA1*03:01/DPB1*105:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 1064 416
HLA-DPA1*02:01/DPB1*02:01 IKVCEFQFCNDPFLGV IKVCEFQFCNYPFLGV 786 308
HLA-DPA1*02:01/DPB1*01:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 926 364
HLA-DPA1*04:01/DPB1*04:01 ATNVVIKVCEFQFCNDPFL ATNVVIKVCEFQFCNYPFL 816 322
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNYPFLGVYY 86 34
HLA-DPA1*01:03/DPB1*02:01 EFQFCNDPFLGVYYHK EFQFCNYPFLGVYYHK 149 59
HLA-DPA1*03:01/DPB1*02:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNYPFLGVYYHKN 58 23
HLA-DPA1*01:03/DPB1*02:01 CEFQFCNDPFLGVYYH CEFQFCNYPFLGVYYH 143 57
HLA-DPA1*02:02/DPB1*01:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 736 294
HLA-DPA1*01:03/DPB1*02:01 ATNVVIKVCEFQFCNDPFLG ATNVVIKVCEFQFCNYPFLG 930 372
HLA-DQA1*01:02/DQB1*06:04 KVCEFQFCNDPFLGVY KVCEFQFCNYPFLGVY 424 1056
HLA-DPA1*02:02/DPB1*01:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 676 272
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVYYH VCEFQFCNYPFLGVYYH 164 66
HLA-DPA1*02:01/DPB1*02:01 VCEFQFCNDPFLGVYYHK VCEFQFCNYPFLGVYYHK 768 310
HLA-DPA1*04:01/DPB1*02:01 NVVIKVCEFQFCNDPFLG NVVIKVCEFQFCNYPFLG 1151 465
HLA-DPA1*03:01/DPB1*02:01 TNVVIKVCEFQFCNDPFLG TNVVIKVCEFQFCNYPFLG 250 101
HLA-DPA1*03:01/DPB1*02:01 EFQFCNDPFLGVYYHKNN EFQFCNYPFLGVYYHKNN 99 40
HLA-DRB1*10:01 EFQFCNDPFLGVYYHKN EFQFCNYPFLGVYYHKN 559 226
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGVYY KVCEFQFCNYPFLGVYY 178 72
HLA-DRB1*15:01 TNVVIKVCEFQFCNDPFLGV TNVVIKVCEFQFCNYPFLGV 1186 482
HLA-DRB1*01:01 QFCNDPFLGVYYHKN QFCNYPFLGVYYHKN 661 270
HLA-DPA1*02:01/DPB1*02:01 EFQFCNDPFLGVYYHK EFQFCNYPFLGVYYHK 393 161
HLA-DQA1*01:02/DQB1*06:04 IKVCEFQFCNDPFLGV IKVCEFQFCNYPFLGV 485 1179
HLA-DPA1*02:01/DPB1*02:01 KVCEFQFCNDPFLGVYYH KVCEFQFCNYPFLGVYYH 736 306
HLA-DPA1*02:01/DPB1*02:01 CEFQFCNDPFLGVYYH CEFQFCNYPFLGVYYH 367 153
HLA-DRB1*15:01 CNDPFLGVYYHKNNK CNYPFLGVYYHKNNK 1128 471
HLA-DPA1*03:01/DPB1*04:01 NVVIKVCEFQFCNDPFL NVVIKVCEFQFCNYPFL 305 128
HLA-DPA1*03:01/DPB1*02:01 NVVIKVCEFQFCNDPFL NVVIKVCEFQFCNYPFL 219 92
HLA-DPA1*02:01/DPB1*02:01 VCEFQFCNDPFLGVYY VCEFQFCNYPFLGVYY 392 165
HLA-DPA1*01:03/DPB1*02:01 CEFQFCNDPFLGVYYHK CEFQFCNYPFLGVYYHK 171 72
HLA-DQA1*01:02/DQB1*06:04 VCEFQFCNDPFLGVYY VCEFQFCNYPFLGVYY 443 1049
HLA-DQA1*01:02/DQB1*06:09 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 369 870
HLA-DPA1*02:01/DPB1*02:01 CEFQFCNDPFLGVYYHKN CEFQFCNYPFLGVYYHKN 607 258
HLA-DPA1*01:03/DPB1*01:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 728 310
HLA-DPA1*03:01/DPB1*02:01 CEFQFCNDPFLGVYYHKNN CEFQFCNYPFLGVYYHKNN 54 23
HLA-DPA1*02:01/DPB1*02:01 VCEFQFCNDPFLGVYYH VCEFQFCNYPFLGVYYH 401 171
HLA-DPA1*02:02/DPB1*02:01 VIKVCEFQFCNDPFL VIKVCEFQFCNYPFL 1046 448
HLA-DPA1*04:01/DPB1*02:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 572 245
HLA-DPA1*02:01/DPB1*02:01 IKVCEFQFCNDPFLGVY IKVCEFQFCNYPFLGVY 562 241
HLA-DPA1*02:01/DPB1*02:01 EFQFCNDPFLGVYYHKNN EFQFCNYPFLGVYYHKNN 589 253
HLA-DQA1*01:02/DQB1*06:09 IKVCEFQFCNDPFLGV IKVCEFQFCNYPFLGV 408 946
HLA-DPA1*04:01/DPB1*02:01 ATNVVIKVCEFQFCNDPFLG ATNVVIKVCEFQFCNYPFLG 586 253
HLA-DPA1*01:03/DPB1*02:01 ATNVVIKVCEFQFCNDPFL ATNVVIKVCEFQFCNYPFL 1033 446
HLA-DQA1*01:02/DQB1*06:09 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 436 1008
HLA-DRB1*15:02 EFQFCNDPFLGVYYH EFQFCNYPFLGVYYH 943 408
HLA-DRB1*16:01 FCNDPFLGVYYHKNN FCNYPFLGVYYHKNN 1138 493
HLA-DPA1*02:01/DPB1*02:01 CEFQFCNDPFLGVYYHK CEFQFCNYPFLGVYYHK 428 186
HLA-DPA1*01:03/DPB1*04:01 NATNVVIKVCEFQFCNDPFL NATNVVIKVCEFQFCNYPFL 1089 478
HLA-DPA1*03:01/DPB1*02:01 QFCNDPFLGVYYHKN QFCNYPFLGVYYHKN 66 29
HLA-DPA1*03:01/DPB1*04:01 TNVVIKVCEFQFCNDPFLG TNVVIKVCEFQFCNYPFLG 330 145
HLA-DQA1*01:02/DQB1*06:09 KVCEFQFCNDPFLGVY KVCEFQFCNYPFLGVY 349 793
HLA-DPA1*02:01/DPB1*02:01 KVCEFQFCNDPFLGVYY KVCEFQFCNYPFLGVYY 447 197
HLA-DPA1*03:01/DPB1*04:02 TNVVIKVCEFQFCNDPFLG TNVVIKVCEFQFCNYPFLG 952 420
HLA-DPA1*03:01/DPB1*105:01 TNVVIKVCEFQFCNDPFLG TNVVIKVCEFQFCNYPFLG 952 420
HLA-DPA1*02:01/DPB1*02:01 EFQFCNDPFLGVYYHKN EFQFCNYPFLGVYYHKN 312 138
HLA-DRB1*10:01 CEFQFCNDPFLGVYYHK CEFQFCNYPFLGVYYHK 731 325
HLA-DPA1*02:02/DPB1*02:01 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 400 178
HLA-DPA1*01:03/DPB1*02:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNYPFLGVYYHK 166 74
HLA-DPA1*04:01/DPB1*02:01 TNVVIKVCEFQFCNDPFLG TNVVIKVCEFQFCNYPFLG 672 300
HLA-DPA1*02:01/DPB1*02:01 IKVCEFQFCNDPFLGVYY IKVCEFQFCNYPFLGVYY 802 359
HLA-DRB1*07:01 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 936 419
HLA-DPA1*04:01/DPB1*04:01 NATNVVIKVCEFQFCNDPFL NATNVVIKVCEFQFCNYPFL 680 305
HLA-DPA1*01:03/DPB1*02:01 QFCNDPFLGVYYHKN QFCNYPFLGVYYHKN 69 31
HLA-DPA1*04:01/DPB1*01:01 IKVCEFQFCNDPFLG IKVCEFQFCNYPFLG 774 348
HLA-DPA1*02:01/DPB1*02:01 VIKVCEFQFCNDPFLGV VIKVCEFQFCNYPFLGV 798 359
HLA-DPA1*02:01/DPB1*02:01 VIKVCEFQFCNDPFLGVY VIKVCEFQFCNYPFLGVY 961 438
HLA-DPA1*03:01/DPB1*02:01 IKVCEFQFCNDPFLGVYYHK IKVCEFQFCNYPFLGVYYHK 68 31
HLA-DPA1*01:03/DPB1*02:01 IKVCEFQFCNDPFLGVYYH IKVCEFQFCNYPFLGVYYH 162 74
HLA-DPA1*03:01/DPB1*04:02 NVVIKVCEFQFCNDPFL NVVIKVCEFQFCNYPFL 934 427
HLA-DPA1*03:01/DPB1*105:01 NVVIKVCEFQFCNDPFL NVVIKVCEFQFCNYPFL 934 427
HLA-DPA1*03:01/DPB1*02:01 ATNVVIKVCEFQFCNDPFLG ATNVVIKVCEFQFCNYPFLG 225 103
HLA-DPA1*03:01/DPB1*02:01 EFQFCNDPFLGVYYHKNNK EFQFCNYPFLGVYYHKNNK 50 23
HLA-DPA1*03:01/DPB1*02:01 ATNVVIKVCEFQFCNDPFL ATNVVIKVCEFQFCNYPFL 250 115
HLA-DRB1*10:01 FCNDPFLGVYYHKNNKS FCNYPFLGVYYHKNNKS 412 190
HLA-DPA1*01:03/DPB1*02:01 FQFCNDPFLGVYYHK FQFCNYPFLGVYYHK 145 67
HLA-DPA1*01:03/DPB1*04:01 VVIKVCEFQFCNDPFLGV VVIKVCEFQFCNYPFLGV 616 285
HLA-DRB1*10:01 EFQFCNDPFLGVYYHK EFQFCNYPFLGVYYHK 674 312
HLA-DPA1*01:03/DPB1*01:01 VIKVCEFQFCNDPFLG VIKVCEFQFCNYPFLG 761 353
HLA-DPA1*01:03/DPB1*02:01 VVIKVCEFQFCNDPFLGVY VVIKVCEFQFCNYPFLGVY 237 110
HLA-DQA1*01:02/DQB1*06:09 NVVIKVCEFQFCNDPFLGVY NVVIKVCEFQFCNYPFLGVY 440 947
HLA-DPA1*04:01/DPB1*02:01 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 172 80
HLA-DRB1*15:02 CEFQFCNDPFLGVYYHKNNK CEFQFCNYPFLGVYYHKNNK 1055 496
HLA-DPA1*02:01/DPB1*01:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 965 454
HLA-DPA1*02:01/DPB1*01:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 797 375
HLA-DPA1*02:01/DPB1*02:01 FQFCNDPFLGVYYHK FQFCNYPFLGVYYHK 391 184
HLA-DPA1*01:03/DPB1*02:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNYPFLGVYYHKN 80 38
HLA-DPA1*02:01/DPB1*02:01 VCEFQFCNDPFLGVYYHKN VCEFQFCNYPFLGVYYHKN 311 148
HLA-DRB1*10:01 EFQFCNDPFLGVYYHKNNK EFQFCNYPFLGVYYHKNNK 492 235
HLA-DPA1*03:01/DPB1*04:01 VVIKVCEFQFCNDPFLGV VVIKVCEFQFCNYPFLGV 257 123
HLA-DPA1*01:03/DPB1*02:01 NVVIKVCEFQFCNDPFLGV NVVIKVCEFQFCNYPFLGV 356 171
HLA-DRB1*15:02 CEFQFCNDPFLGVYY CEFQFCNYPFLGVYY 876 421
HLA-DPA1*03:01/DPB1*04:01 ATNVVIKVCEFQFCNDPFL ATNVVIKVCEFQFCNYPFL 312 150
HLA-DPA1*01:03/DPB1*02:01 NATNVVIKVCEFQFCNDPFL NATNVVIKVCEFQFCNYPFL 877 422
HLA-DPA1*03:01/DPB1*04:02 CNDPFLGVYYHKNNK CNYPFLGVYYHKNNK 376 181
HLA-DPA1*03:01/DPB1*105:01 CNDPFLGVYYHKNNK CNYPFLGVYYHKNNK 376 181
HLA-DQA1*01:02/DQB1*06:09 VCEFQFCNDPFLGVYY VCEFQFCNYPFLGVYY 346 718
HLA-DQA1*01:02/DQB1*06:09 IKVCEFQFCNDPFLGVY IKVCEFQFCNYPFLGVY 476 987
HLA-DPA1*04:01/DPB1*02:01 VCEFQFCNDPFLGVY VCEFQFCNYPFLGVY 114 55
HLA-DPA1*03:01/DPB1*02:01 FQFCNDPFLGVYYHKN FQFCNYPFLGVYYHKN 58 28
HLA-DRB1*15:03 FQFCNDPFLGVYYHKNNKS FQFCNYPFLGVYYHKNNKS 847 409
HLA-DPA1*04:01/DPB1*02:01 NVVIKVCEFQFCNDPFL NVVIKVCEFQFCNYPFL 594 287
HLA-DPA1*02:01/DPB1*02:01 CEFQFCNDPFLGVYYHKNN CEFQFCNYPFLGVYYHKNN 304 147
HLA-DPA1*03:01/DPB1*02:01 FQFCNDPFLGVYYHKNN FQFCNYPFLGVYYHKNN 62 30
HLA-DPA1*01:03/DPB1*02:01 CEFQFCNDPFLGVYYHKN CEFQFCNYPFLGVYYHKN 173 84
HLA-DPA1*02:01/DPB1*02:01 KVCEFQFCNDPFLGVYYHK KVCEFQFCNYPFLGVYYHK 416 202
HLA-DPA1*01:03/DPB1*04:01 CNDPFLGVYYHKNNK CNYPFLGVYYHKNNK 253 123
HLA-DPA1*01:03/DPB1*02:01 VIKVCEFQFCNDPFLGVYY VIKVCEFQFCNYPFLGVYY 181 88
HLA-DPA1*04:01/DPB1*04:01 FQFCNDPFLGVYYHK FQFCNYPFLGVYYHK 89 183
HLA-DPA1*02:01/DPB1*02:01 QFCNDPFLGVYYHKN QFCNYPFLGVYYHKN 382 186
HLA-DPA1*02:01/DPB1*02:01 EFQFCNDPFLGVYYHKNNK EFQFCNYPFLGVYYHKNNK 273 133
HLA-DRB1*10:01 CEFQFCNDPFLGVYYHKNN CEFQFCNYPFLGVYYHKNN 558 272
HLA-DPA1*02:02/DPB1*01:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 644 314
HLA-DQA1*01:02/DQB1*06:09 VVIKVCEFQFCNDPFLGVYY VVIKVCEFQFCNYPFLGVYY 443 907
HLA-DPA1*03:01/DPB1*06:01 EFQFCNDPFLGVYYHKN EFQFCNYPFLGVYYHKN 653 319
HLA-DPA1*03:01/DPB1*02:01 FCNDPFLGVYYHKNN FCNYPFLGVYYHKNN 92 45
HLA-DPA1*01:03/DPB1*01:01 VVIKVCEFQFCNDPFLG VVIKVCEFQFCNYPFLG 818 402
HLA-DQA1*01:02/DQB1*06:09 TNVVIKVCEFQFCNDPFLGV TNVVIKVCEFQFCNYPFLGV 478 972
HLA-DPA1*01:03/DPB1*02:01 EFQFCNDPFLGVYYHKN EFQFCNYPFLGVYYHKN 75 37
HLA-DPA1*03:01/DPB1*02:01 FQFCNDPFLGVYYHKNNK FQFCNYPFLGVYYHKNNK 103 51
HLA-DPA1*02:01/DPB1*04:01 KVCEFQFCNDPFLGV KVCEFQFCNYPFLGV 509 253
HLA-DPA1*02:02/DPB1*01:01 VVIKVCEFQFCNDPFL VVIKVCEFQFCNYPFL 575 286
HLA-DPA1*02:02/DPB1*01:01 NVVIKVCEFQFCNDPFLG NVVIKVCEFQFCNYPFLG 979 489
HLA-DPA1*03:01/DPB1*02:01 VIKVCEFQFCNDPFLGVYYH VIKVCEFQFCNYPFLGVYYH 62 31
HLA-DPA1*01:03/DPB1*02:01 CEFQFCNDPFLGVYYHKNN CEFQFCNYPFLGVYYHKNN 68 34

R190S

Reference  NCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NCTFEYVSQPFLMDLEGKQGNFKNLSEFVFKNIDGYFKIYSKHTPINLVRD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*12:02 EGKQGNFKNLREFVFKNIDG EGKQGNFKNLSEFVFKNIDG 349 1011
HLA-DRB1*12:02 GNFKNLREFVFKNID GNFKNLSEFVFKNID 245 700
HLA-DRB1*12:02 LEGKQGNFKNLREFVFKNID LEGKQGNFKNLSEFVFKNID 352 996
HLA-DRB1*12:02 NFKNLREFVFKNIDG NFKNLSEFVFKNIDG 293 817
HLA-DRB1*13:02 GKQGNFKNLREFVFKN GKQGNFKNLSEFVFKN 1016 367
HLA-DRB1*12:02 KQGNFKNLREFVFKNID KQGNFKNLSEFVFKNID 384 1061
HLA-DRB1*12:02 QGNFKNLREFVFKNIDG QGNFKNLSEFVFKNIDG 408 1125
HLA-DRB1*12:02 GNFKNLREFVFKNIDGY GNFKNLSEFVFKNIDGY 476 1307
HLA-DRB1*12:02 GKQGNFKNLREFVFKNIDGY GKQGNFKNLSEFVFKNIDGY 340 932
HLA-DRB1*13:02 EGKQGNFKNLREFVFK EGKQGNFKNLSEFVFK 980 359
HLA-DRB1*13:02 MDLEGKQGNFKNLREFVFKN MDLEGKQGNFKNLSEFVFKN 783 289
HLA-DRB1*12:02 DLEGKQGNFKNLREFVFKNI DLEGKQGNFKNLSEFVFKNI 372 991
HLA-DRB1*12:02 QGNFKNLREFVFKNI QGNFKNLSEFVFKNI 219 577
HLA-DRB1*13:02 DLEGKQGNFKNLREFVFKN DLEGKQGNFKNLSEFVFKN 1217 463
HLA-DRB1*13:02 LMDLEGKQGNFKNLREFVFK LMDLEGKQGNFKNLSEFVFK 875 333
HLA-DRB1*13:02 KQGNFKNLREFVFKN KQGNFKNLSEFVFKN 555 212
HLA-DRB1*12:02 GKQGNFKNLREFVFKNI GKQGNFKNLSEFVFKNI 396 1036
HLA-DRB1*13:02 GKQGNFKNLREFVFK GKQGNFKNLSEFVFK 520 199
HLA-DRB1*11:04 QGNFKNLREFVFKNI QGNFKNLSEFVFKNI 264 686
HLA-DRB1*11:04 GKQGNFKNLREFVFK GKQGNFKNLSEFVFK 376 972
HLA-DRB1*11:02 EGKQGNFKNLREFVF EGKQGNFKNLSEFVF 419 1072
HLA-DRB1*13:01 EGKQGNFKNLREFVF EGKQGNFKNLSEFVF 419 1072
HLA-DRB1*12:02 KQGNFKNLREFVFKNIDGYF KQGNFKNLSEFVFKNIDGYF 327 835
HLA-DRB1*11:04 KQGNFKNLREFVFKN KQGNFKNLSEFVFKN 362 915
HLA-DRB1*11:04 GNFKNLREFVFKNID GNFKNLSEFVFKNID 338 853
HLA-DRB1*12:02 QGNFKNLREFVFKNID QGNFKNLSEFVFKNID 488 1223
HLA-DRB1*12:02 GKQGNFKNLREFVFK GKQGNFKNLSEFVFK 372 913
HLA-DPA1*04:01/DPB1*06:01 KNLREFVFKNIDGYF KNLSEFVFKNIDGYF 409 1002
HLA-DRB1*13:02 EGKQGNFKNLREFVF EGKQGNFKNLSEFVF 702 287
HLA-DRB1*13:02 KQGNFKNLREFVFKNI KQGNFKNLSEFVFKNI 858 354
HLA-DRB1*12:02 KQGNFKNLREFVFKNI KQGNFKNLSEFVFKNI 485 1173
HLA-DRB1*11:01 GNFKNLREFVFKNID GNFKNLSEFVFKNID 379 896
HLA-DRB1*11:01 GKQGNFKNLREFVFK GKQGNFKNLSEFVFK 393 923
HLA-DRB1*13:02 LEGKQGNFKNLREFVFKNI LEGKQGNFKNLSEFVFKNI 1019 436
HLA-DRB1*12:02 QGNFKNLREFVFKNIDGYFK QGNFKNLSEFVFKNIDGYFK 308 719
HLA-DRB1*13:02 DLEGKQGNFKNLREFVFKNI DLEGKQGNFKNLSEFVFKNI 616 267
HLA-DRB1*13:02 LEGKQGNFKNLREFVFKNID LEGKQGNFKNLSEFVFKNID 635 279
HLA-DRB1*11:02 QGNFKNLREFVFKNI QGNFKNLSEFVFKNI 224 509
HLA-DRB1*13:01 QGNFKNLREFVFKNI QGNFKNLSEFVFKNI 224 509
HLA-DRB1*13:02 EGKQGNFKNLREFVFKNID EGKQGNFKNLSEFVFKNID 1037 459
HLA-DRB1*13:02 LEGKQGNFKNLREFVFK LEGKQGNFKNLSEFVFK 1095 485
HLA-DRB1*12:02 KQGNFKNLREFVFKN KQGNFKNLSEFVFKN 335 756
HLA-DRB1*11:01 EGKQGNFKNLREFVFKNIDG EGKQGNFKNLSEFVFKNIDG 433 977
HLA-DRB1*13:02 EGKQGNFKNLREFVFKNIDG EGKQGNFKNLSEFVFKNIDG 660 293
HLA-DRB1*13:02 EGKQGNFKNLREFVFKN EGKQGNFKNLSEFVFKN 1104 492
HLA-DRB1*11:01 GKQGNFKNLREFVFKNIDGY GKQGNFKNLSEFVFKNIDGY 404 906
HLA-DRB1*11:01 QGNFKNLREFVFKNI QGNFKNLSEFVFKNI 287 641
HLA-DRB1*11:02 GNFKNLREFVFKNID GNFKNLSEFVFKNID 298 659
HLA-DRB1*13:01 GNFKNLREFVFKNID GNFKNLSEFVFKNID 298 659
HLA-DRB1*11:04 KQGNFKNLREFVFKNIDGYF KQGNFKNLSEFVFKNIDGYF 494 1087
HLA-DRB1*11:02 GKQGNFKNLREFVFK GKQGNFKNLSEFVFK 277 607
HLA-DRB1*13:01 GKQGNFKNLREFVFK GKQGNFKNLSEFVFK 277 607
HLA-DRB1*11:01 KQGNFKNLREFVFKNIDGYF KQGNFKNLSEFVFKNIDGYF 392 856
HLA-DRB1*12:02 GNFKNLREFVFKNIDGYFKI GNFKNLSEFVFKNIDGYFKI 346 755
HLA-DRB1*11:04 NFKNLREFVFKNIDG NFKNLSEFVFKNIDG 478 1041
HLA-DPA1*04:01/DPB1*06:01 KNLREFVFKNIDGYFK KNLSEFVFKNIDGYFK 402 874
HLA-DRB1*13:02 GKQGNFKNLREFVFKNIDG GKQGNFKNLSEFVFKNIDG 1059 488
HLA-DRB1*11:02 GKQGNFKNLREFVFKNI GKQGNFKNLSEFVFKNI 499 1076
HLA-DRB1*13:01 GKQGNFKNLREFVFKNI GKQGNFKNLSEFVFKNI 499 1076
HLA-DRB1*11:01 KQGNFKNLREFVFKN KQGNFKNLSEFVFKN 355 764
HLA-DRB1*11:02 NFKNLREFVFKNIDG NFKNLSEFVFKNIDG 467 990
HLA-DRB1*13:01 NFKNLREFVFKNIDG NFKNLSEFVFKNIDG 467 990
HLA-DRB1*15:03 GNFKNLREFVFKNID GNFKNLSEFVFKNID 255 536
HLA-DRB1*15:03 NFKNLREFVFKNIDG NFKNLSEFVFKNIDG 316 662
HLA-DPA1*04:01/DPB1*06:01 FKNLREFVFKNIDGY FKNLSEFVFKNIDGY 356 744
HLA-DRB1*11:01 LEGKQGNFKNLREFVFKNID LEGKQGNFKNLSEFVFKNID 435 899
HLA-DRB1*15:03 QGNFKNLREFVFKNI QGNFKNLSEFVFKNI 213 440
HLA-DRB1*11:02 KQGNFKNLREFVFKN KQGNFKNLSEFVFKN 288 590
HLA-DRB1*13:01 KQGNFKNLREFVFKN KQGNFKNLSEFVFKN 288 590
HLA-DRB1*11:01 DLEGKQGNFKNLREFVFKNI DLEGKQGNFKNLSEFVFKNI 449 907
HLA-DRB1*15:03 KQGNFKNLREFVFKNID KQGNFKNLSEFVFKNID 439 884
HLA-DRB1*15:03 GKQGNFKNLREFVFKNI GKQGNFKNLSEFVFKNI 439 882
HLA-DRB1*15:03 QGNFKNLREFVFKNIDG QGNFKNLSEFVFKNIDG 470 944

K417T

Reference  FTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    FTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPDDFTGCVIAWNSNNLD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*02:01/DQB1*03:01 PGQTGKIADYNYKLP PGQTGTIADYNYKLP 945 435
HLA-DQA1*02:01/DQB1*03:19 PGQTGKIADYNYKLP PGQTGTIADYNYKLP 945 435
HLA-DQA1*02:01/DQB1*03:01 APGQTGKIADYNYKL APGQTGTIADYNYKL 758 350
HLA-DQA1*02:01/DQB1*03:19 APGQTGKIADYNYKL APGQTGTIADYNYKL 758 350

N501Y

Reference  GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    GSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*13:02 YGFQPTNGVGYQPYR YGFQPTYGVGYQPYR 395 1260
HLA-DRB1*13:02 SYGFQPTNGVGYQPY SYGFQPTYGVGYQPY 282 898
HLA-DRB1*13:02 QSYGFQPTNGVGYQP QSYGFQPTYGVGYQP 369 1124
HLA-DRB1*13:02 LQSYGFQPTNGVGYQ LQSYGFQPTYGVGYQ 334 956
HLA-DPA1*03:01/DPB1*04:01 FQPTNGVGYQPYRVV FQPTYGVGYQPYRVV 1189 452
HLA-DRB1*13:02 FPLQSYGFQPTNGVGYQPYR FPLQSYGFQPTYGVGYQPYR 331 867
HLA-DPA1*01:03/DPB1*02:01 FQPTNGVGYQPYRVV FQPTYGVGYQPYRVV 886 340
HLA-DPA1*03:01/DPB1*02:01 FQPTNGVGYQPYRVV FQPTYGVGYQPYRVV 562 218
HLA-DRB1*13:02 YFPLQSYGFQPTNGVGYQPY YFPLQSYGFQPTYGVGYQPY 320 814
HLA-DRB1*13:02 PLQSYGFQPTNGVGYQPYRV PLQSYGFQPTYGVGYQPYRV 347 878
HLA-DPA1*03:01/DPB1*04:01 QSYGFQPTNGVGYQPYRVV QSYGFQPTYGVGYQPYRVV 1073 433
HLA-DPA1*03:01/DPB1*02:01 GFQPTNGVGYQPYRVV GFQPTYGVGYQPYRVV 614 249
HLA-DPA1*03:01/DPB1*04:01 SYGFQPTNGVGYQPYRVVV SYGFQPTYGVGYQPYRVVV 849 349
HLA-DPA1*03:01/DPB1*02:01 YGFQPTNGVGYQPYRVV YGFQPTYGVGYQPYRVV 688 285
HLA-DPA1*03:01/DPB1*02:01 QSYGFQPTNGVGYQPYRVV QSYGFQPTYGVGYQPYRVV 628 261
HLA-DPA1*03:01/DPB1*04:01 FQPTNGVGYQPYRVVV FQPTYGVGYQPYRVVV 1042 439
HLA-DRB1*13:02 LQSYGFQPTNGVGYQPYRVV LQSYGFQPTYGVGYQPYRVV 359 845
HLA-DPA1*01:03/DPB1*02:01 GFQPTNGVGYQPYRVV GFQPTYGVGYQPYRVV 1127 479
HLA-DPA1*03:01/DPB1*04:01 GFQPTNGVGYQPYRVVV GFQPTYGVGYQPYRVVV 1050 450
HLA-DRB1*13:02 CYFPLQSYGFQPTNGVGYQP CYFPLQSYGFQPTYGVGYQP 461 1074
HLA-DPA1*03:01/DPB1*02:01 SYGFQPTNGVGYQPYRVVV SYGFQPTYGVGYQPYRVVV 414 180
HLA-DPA1*03:01/DPB1*01:01 FQPTNGVGYQPYRVV FQPTYGVGYQPYRVV 919 402
HLA-DPA1*03:01/DPB1*02:01 GFQPTNGVGYQPYRVVV GFQPTYGVGYQPYRVVV 466 204
HLA-DRB1*13:02 NCYFPLQSYGFQPTNGVGYQ NCYFPLQSYGFQPTYGVGYQ 499 1139
HLA-DPA1*03:01/DPB1*02:01 FQPTNGVGYQPYRVVV FQPTYGVGYQPYRVVV 393 174
HLA-DPA1*01:03/DPB1*02:01 SYGFQPTNGVGYQPYRVVV SYGFQPTYGVGYQPYRVVV 799 355
HLA-DPA1*01:03/DPB1*02:01 GFQPTNGVGYQPYRVVV GFQPTYGVGYQPYRVVV 744 336
HLA-DPA1*03:01/DPB1*02:01 QPTNGVGYQPYRVVV QPTYGVGYQPYRVVV 380 172
HLA-DPA1*03:01/DPB1*01:01 GFQPTNGVGYQPYRVV GFQPTYGVGYQPYRVV 949 430
HLA-DPA1*03:01/DPB1*04:01 QSYGFQPTNGVGYQPYRVVV QSYGFQPTYGVGYQPYRVVV 603 276
HLA-DPA1*03:01/DPB1*01:01 FQPTNGVGYQPYRVVV FQPTYGVGYQPYRVVV 833 384
HLA-DPA1*03:01/DPB1*02:01 YGFQPTNGVGYQPYRVVV YGFQPTYGVGYQPYRVVV 794 368
HLA-DPA1*03:01/DPB1*01:01 GFQPTNGVGYQPYRVVV GFQPTYGVGYQPYRVVV 916 426
HLA-DPA1*03:01/DPB1*01:01 QPTNGVGYQPYRVVV QPTYGVGYQPYRVVV 941 440
HLA-DPA1*04:01/DPB1*02:01 GFQPTNGVGYQPYRVV GFQPTYGVGYQPYRVV 718 336
HLA-DPA1*04:01/DPB1*02:01 YGFQPTNGVGYQPYRVV YGFQPTYGVGYQPYRVV 828 389
HLA-DPA1*01:03/DPB1*02:01 QSYGFQPTNGVGYQPYRVVV QSYGFQPTYGVGYQPYRVVV 536 253
HLA-DPA1*04:01/DPB1*02:01 FQPTNGVGYQPYRVV FQPTYGVGYQPYRVV 618 292
HLA-DPA1*03:01/DPB1*01:01 QSYGFQPTNGVGYQPYRVV QSYGFQPTYGVGYQPYRVV 814 387
HLA-DPA1*04:01/DPB1*02:01 QSYGFQPTNGVGYQPYRVV QSYGFQPTYGVGYQPYRVV 834 397
HLA-DPA1*03:01/DPB1*04:01 QPTNGVGYQPYRVVV QPTYGVGYQPYRVVV 959 458
HLA-DPA1*03:01/DPB1*02:01 QSYGFQPTNGVGYQPYRVVV QSYGFQPTYGVGYQPYRVVV 265 128
HLA-DRB1*13:02 QSYGFQPTNGVGYQPYRVVV QSYGFQPTYGVGYQPYRVVV 398 823
HLA-DPA1*01:03/DPB1*01:01 QSYGFQPTNGVGYQPYRVVV QSYGFQPTYGVGYQPYRVVV 1014 495
HLA-DPA1*03:01/DPB1*01:01 SYGFQPTNGVGYQPYRVVV SYGFQPTYGVGYQPYRVVV 689 337
HLA-DPA1*01:03/DPB1*02:01 FQPTNGVGYQPYRVVV FQPTYGVGYQPYRVVV 572 280
HLA-DPA1*03:01/DPB1*01:01 YGFQPTNGVGYQPYRVV YGFQPTYGVGYQPYRVV 921 457
HLA-DPA1*01:03/DPB1*02:01 QPTNGVGYQPYRVVV QPTYGVGYQPYRVVV 443 220
HLA-DPA1*02:02/DPB1*01:01 FQPTNGVGYQPYRVVV FQPTYGVGYQPYRVVV 892 443
HLA-DRB1*04:01 CYFPLQSYGFQPTNGVGYQP CYFPLQSYGFQPTYGVGYQP 230 462
HLA-DRB1*10:01 QPTNGVGYQPYRVVV QPTYGVGYQPYRVVV 900 449
HLA-DPA1*01:03/DPB1*02:01 LQSYGFQPTNGVGYQPYRVV LQSYGFQPTYGVGYQPYRVV 579 289

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 533 192
HLA-DRB1*01:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 521 192
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 328 123
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 889 335
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTE NTSNQVAVLYQGVNCTE 281 107
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 677 258
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 243 93
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 227 87
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 130 50
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 403 155
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 136 53
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 228 89
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 176 69
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 181 71
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 150 59
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 167 66
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 200 80
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQD TPGTNTSNQVAVLYQG 276 112
HLA-DRB1*01:01 VAVLYQDVNCTEVPV VAVLYQGVNCTEVPV 347 141
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEV NTSNQVAVLYQGVNCTEV 639 263
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 413 170
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVN TPGTNTSNQVAVLYQGVN 376 155
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQD ITPGTNTSNQVAVLYQG 339 140
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVA QVAVLYQGVNCTEVPVA 814 340
HLA-DRB1*01:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 867 365
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDV ITPGTNTSNQVAVLYQGV 435 184
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDVN ITPGTNTSNQVAVLYQGVN 229 97
HLA-DQA1*01:03/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 960 408
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPV NQVAVLYQGVNCTEVPV 799 340
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 176 75
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCT TNTSNQVAVLYQGVNCT 211 90
HLA-DRB1*01:01 VAVLYQDVNCTEVPVAI VAVLYQGVNCTEVPVAI 996 428
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 292 126
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 417 181
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 852 370
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 312 136
HLA-DRB1*01:01 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 699 305
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNC GTNTSNQVAVLYQGVNC 197 86
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVP NTSNQVAVLYQGVNCTEVP 412 180
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVP TSNQVAVLYQGVNCTEVP 908 399
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 450 198
HLA-DRB1*01:01 QVAVLYQDVNCTEVP QVAVLYQGVNCTEVP 285 126
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 530 235
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDVN VITPGTNTSNQVAVLYQGVN 189 84
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDV VITPGTNTSNQVAVLYQGV 270 121
HLA-DRB1*01:01 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 450 202
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 597 268
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 838 380
HLA-DRB1*01:01 VAVLYQDVNCTEVPVA VAVLYQGVNCTEVPVA 1017 462
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 801 365
HLA-DRB1*10:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 910 416
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVA SNQVAVLYQGVNCTEVPVA 979 449
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 365 168
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 447 206
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVNC PGTNTSNQVAVLYQGVNC 425 196
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 471 218
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTE TNTSNQVAVLYQGVNCTE 477 221
HLA-DRB1*01:01 QVAVLYQDVNCTEVPV QVAVLYQGVNCTEVPV 855 397
HLA-DRB1*01:01 NQVAVLYQDVNCTEV NQVAVLYQGVNCTEV 253 118
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPVA TSNQVAVLYQGVNCTEVPVA 488 228
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNCT GTNTSNQVAVLYQGVNCT 436 204
HLA-DQA1*02:01/DQB1*03:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DQA1*02:01/DQB1*03:19 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DRB1*01:01 NQVAVLYQDVNCTEVP NQVAVLYQGVNCTEVP 887 416
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAI NQVAVLYQGVNCTEVPVAI 991 467
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 984 467
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 485 231
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 641 306
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIH QVAVLYQGVNCTEVPVAIH 1021 488
HLA-DPA1*03:01/DPB1*04:01 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 307 635
HLA-DRB1*01:01 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 850 411
HLA-DRB1*01:01 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 502 243
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVAI SNQVAVLYQGVNCTEVPVAI 481 235
HLA-DQA1*01:02/DQB1*06:02 SVITPGTNTSNQVAVLYQDV SVITPGTNTSNQVAVLYQGV 231 113
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAIH NQVAVLYQGVNCTEVPVAIH 483 237
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 936 460
HLA-DQA1*01:03/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 493 243
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTEV TNTSNQVAVLYQGVNCTEV 298 147
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVNC TPGTNTSNQVAVLYQGVNC 254 126
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQD VITPGTNTSNQVAVLYQG 681 338
HLA-DRB1*01:01 TNTSNQVAVLYQDVNCTEVP TNTSNQVAVLYQGVNCTEVP 523 260
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIHA QVAVLYQGVNCTEVPVAIHA 502 251

H655Y

Reference  TPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TPTWRVYSTGSNVFQTRAGCLIGAEYVNNSYECDIPIGAGICASYQTQTNS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*01:03/DPB1*02:01 AGCLIGAEHVNNSYE AGCLIGAEYVNNSYE 7729 421
HLA-DPA1*01:03/DPB1*02:01 RAGCLIGAEHVNNSY RAGCLIGAEYVNNSY 6530 362
HLA-DPA1*03:01/DPB1*02:01 AGCLIGAEHVNNSYE AGCLIGAEYVNNSYE 3269 245
HLA-DPA1*03:01/DPB1*02:01 AGCLIGAEHVNNSYEC AGCLIGAEYVNNSYEC 3822 292
HLA-DPA1*04:01/DPB1*02:01 AGCLIGAEHVNNSYE AGCLIGAEYVNNSYE 3714 292
HLA-DPA1*03:01/DPB1*02:01 RAGCLIGAEHVNNSY RAGCLIGAEYVNNSY 2699 215
HLA-DPA1*03:01/DPB1*02:01 RAGCLIGAEHVNNSYE RAGCLIGAEYVNNSYE 3203 258
HLA-DPA1*03:01/DPB1*02:01 AGCLIGAEHVNNSYECD AGCLIGAEYVNNSYECD 3409 287
HLA-DPA1*04:01/DPB1*02:01 RAGCLIGAEHVNNSY RAGCLIGAEYVNNSY 3094 266
HLA-DPA1*03:01/DPB1*02:01 GCLIGAEHVNNSYEC GCLIGAEYVNNSYEC 3976 356
HLA-DPA1*03:01/DPB1*02:01 GCLIGAEHVNNSYECD GCLIGAEYVNNSYECD 3618 324
HLA-DPA1*03:01/DPB1*02:01 TRAGCLIGAEHVNNSY TRAGCLIGAEYVNNSY 2708 246
HLA-DPA1*03:01/DPB1*02:01 RAGCLIGAEHVNNSYEC RAGCLIGAEYVNNSYEC 3484 320
HLA-DPA1*03:01/DPB1*02:01 CLIGAEHVNNSYECD CLIGAEYVNNSYECD 3683 344
HLA-DPA1*03:01/DPB1*02:01 TRAGCLIGAEHVNNSYECD TRAGCLIGAEYVNNSYECD 2457 240
HLA-DPA1*03:01/DPB1*02:01 RAGCLIGAEHVNNSYECDI RAGCLIGAEYVNNSYECDI 2543 249
HLA-DPA1*04:01/DPB1*02:01 AGCLIGAEHVNNSYEC AGCLIGAEYVNNSYEC 4451 436
HLA-DPA1*04:01/DPB1*02:01 GCLIGAEHVNNSYEC GCLIGAEYVNNSYEC 4512 445
HLA-DPA1*03:01/DPB1*02:01 AGCLIGAEHVNNSYECDIP AGCLIGAEYVNNSYECDIP 2719 274
HLA-DPA1*03:01/DPB1*02:01 RAGCLIGAEHVNNSYECDIP RAGCLIGAEYVNNSYECDIP 1761 178
HLA-DPA1*04:01/DPB1*02:01 RAGCLIGAEHVNNSYE RAGCLIGAEYVNNSYE 3656 373
HLA-DPA1*03:01/DPB1*02:01 TRAGCLIGAEHVNNSYE TRAGCLIGAEYVNNSYE 2946 302
HLA-DPA1*03:01/DPB1*02:01 TRAGCLIGAEHVNNS TRAGCLIGAEYVNNS 2947 308
HLA-DPA1*03:01/DPB1*02:01 TRAGCLIGAEHVNNSYECDI TRAGCLIGAEYVNNSYECDI 1606 168
HLA-DPA1*03:01/DPB1*02:01 GCLIGAEHVNNSYECDI GCLIGAEYVNNSYECDI 3452 368
HLA-DPA1*03:01/DPB1*02:01 QTRAGCLIGAEHVNNSYECD QTRAGCLIGAEYVNNSYECD 1599 173
HLA-DPA1*03:01/DPB1*02:01 AGCLIGAEHVNNSYECDIPI AGCLIGAEYVNNSYECDIPI 1574 171
HLA-DPA1*03:01/DPB1*02:01 CLIGAEHVNNSYECDI CLIGAEYVNNSYECDI 3333 367
HLA-DPA1*03:01/DPB1*02:01 QTRAGCLIGAEHVNNSY QTRAGCLIGAEYVNNSY 2581 285
HLA-DPA1*03:01/DPB1*02:01 QTRAGCLIGAEHVNNSYEC QTRAGCLIGAEYVNNSYEC 2440 276
HLA-DPA1*04:01/DPB1*02:01 TRAGCLIGAEHVNNS TRAGCLIGAEYVNNS 3224 371
HLA-DPA1*03:01/DPB1*02:01 QTRAGCLIGAEHVNNS QTRAGCLIGAEYVNNS 3017 354
HLA-DPA1*04:01/DPB1*02:01 AGCLIGAEHVNNSYECD AGCLIGAEYVNNSYECD 4076 485
HLA-DPA1*04:01/DPB1*02:01 RAGCLIGAEHVNNSYEC RAGCLIGAEYVNNSYEC 3686 440
HLA-DPA1*04:01/DPB1*02:01 TRAGCLIGAEHVNNSY TRAGCLIGAEYVNNSY 3045 368
HLA-DPA1*03:01/DPB1*04:01 RAGCLIGAEHVNNSYECDI RAGCLIGAEYVNNSYECDI 3841 475
HLA-DPA1*04:01/DPB1*02:01 TRAGCLIGAEHVNNSYE TRAGCLIGAEYVNNSYE 3115 392
HLA-DPA1*03:01/DPB1*04:01 RAGCLIGAEHVNNSYECDIP RAGCLIGAEYVNNSYECDIP 2827 356
HLA-DPA1*03:01/DPB1*02:01 CLIGAEHVNNSYECDIP CLIGAEYVNNSYECDIP 3506 443
HLA-DPA1*03:01/DPB1*02:01 GCLIGAEHVNNSYECDIPIG GCLIGAEYVNNSYECDIPIG 1836 232
HLA-DPA1*03:01/DPB1*04:01 AGCLIGAEHVNNSYECDIPI AGCLIGAEYVNNSYECDIPI 2553 332
HLA-DPA1*03:01/DPB1*02:01 QTRAGCLIGAEHVNN QTRAGCLIGAEYVNN 3106 408
HLA-DPA1*03:01/DPB1*02:01 FQTRAGCLIGAEHVNNSYE FQTRAGCLIGAEYVNNSYE 1926 256
HLA-DPA1*03:01/DPB1*02:01 GCLIGAEHVNNSYECDIPI GCLIGAEYVNNSYECDIPI 2434 326
HLA-DPA1*03:01/DPB1*04:01 TRAGCLIGAEHVNNSY TRAGCLIGAEYVNNSY 3449 470
HLA-DPA1*03:01/DPB1*04:01 RAGCLIGAEHVNNSY RAGCLIGAEYVNNSY 3644 499
HLA-DPA1*03:01/DPB1*02:01 FQTRAGCLIGAEHVNNSYEC FQTRAGCLIGAEYVNNSYEC 1410 194
HLA-DPA1*03:01/DPB1*04:01 TRAGCLIGAEHVNNSYECDI TRAGCLIGAEYVNNSYECDI 2488 350
HLA-DPA1*04:01/DPB1*02:01 RAGCLIGAEHVNNSYECDI RAGCLIGAEYVNNSYECDI 3483 498
HLA-DPA1*03:01/DPB1*04:01 TRAGCLIGAEHVNNSYECD TRAGCLIGAEYVNNSYECD 3343 491
HLA-DPA1*04:01/DPB1*02:01 QTRAGCLIGAEHVNNSY QTRAGCLIGAEYVNNSY 2697 397
HLA-DPA1*03:01/DPB1*04:01 GCLIGAEHVNNSYECDIPIG GCLIGAEYVNNSYECDIPIG 2934 437
HLA-DPA1*04:01/DPB1*02:01 AGCLIGAEHVNNSYECDIPI AGCLIGAEYVNNSYECDIPI 2360 355
HLA-DPA1*04:01/DPB1*02:01 RAGCLIGAEHVNNSYECDIP RAGCLIGAEYVNNSYECDIP 2470 374
HLA-DPA1*04:01/DPB1*02:01 TRAGCLIGAEHVNNSYECD TRAGCLIGAEYVNNSYECD 3276 499
HLA-DPA1*03:01/DPB1*02:01 CLIGAEHVNNSYECDIPIG CLIGAEYVNNSYECDIPIG 2742 419
HLA-DPA1*03:01/DPB1*04:01 QTRAGCLIGAEHVNNSYECD QTRAGCLIGAEYVNNSYECD 2324 374
HLA-DPA1*04:01/DPB1*02:01 TRAGCLIGAEHVNNSYECDI TRAGCLIGAEYVNNSYECDI 2189 354
HLA-DPA1*03:01/DPB1*02:01 CLIGAEHVNNSYECDIPIGA CLIGAEYVNNSYECDIPIGA 1868 307
HLA-DPA1*04:01/DPB1*02:01 QTRAGCLIGAEHVNNSYEC QTRAGCLIGAEYVNNSYEC 2987 491
HLA-DPA1*03:01/DPB1*02:01 FQTRAGCLIGAEHVNNS FQTRAGCLIGAEYVNNS 2262 381
HLA-DPA1*04:01/DPB1*02:01 GCLIGAEHVNNSYECDIPIG GCLIGAEYVNNSYECDIPIG 2675 452
HLA-DPA1*03:01/DPB1*02:01 VFQTRAGCLIGAEHVNNSY VFQTRAGCLIGAEYVNNSY 1410 241
HLA-DPA1*03:01/DPB1*02:01 VFQTRAGCLIGAEHVNNSYE VFQTRAGCLIGAEYVNNSYE 1015 178
HLA-DPA1*01:03/DPB1*02:01 VFQTRAGCLIGAEHVNNSYE VFQTRAGCLIGAEYVNNSYE 2742 485
HLA-DPA1*04:01/DPB1*02:01 QTRAGCLIGAEHVNNSYECD QTRAGCLIGAEYVNNSYECD 2082 369
HLA-DPA1*03:01/DPB1*04:01 FQTRAGCLIGAEHVNNSYEC FQTRAGCLIGAEYVNNSYEC 2042 386
HLA-DPA1*03:01/DPB1*02:01 FQTRAGCLIGAEHVNN FQTRAGCLIGAEYVNN 2375 453
HLA-DPA1*03:01/DPB1*04:01 FQTRAGCLIGAEHVNNSYE FQTRAGCLIGAEYVNNSYE 2478 481
HLA-DPA1*04:01/DPB1*02:01 FQTRAGCLIGAEHVNNSYE FQTRAGCLIGAEYVNNSYE 2132 434
HLA-DPA1*03:01/DPB1*02:01 LIGAEHVNNSYECDIPIGAG LIGAEYVNNSYECDIPIGAG 2239 483
HLA-DPA1*04:01/DPB1*02:01 FQTRAGCLIGAEHVNNSYEC FQTRAGCLIGAEYVNNSYEC 1567 340
HLA-DPA1*03:01/DPB1*04:01 VFQTRAGCLIGAEHVNNSYE VFQTRAGCLIGAEYVNNSYE 1609 360
HLA-DPA1*01:03/DPB1*02:01 NVFQTRAGCLIGAEHVNNSY NVFQTRAGCLIGAEYVNNSY 2152 497
HLA-DPA1*03:01/DPB1*04:01 VFQTRAGCLIGAEHVNNSY VFQTRAGCLIGAEYVNNSY 1965 462
HLA-DPA1*03:01/DPB1*02:01 NVFQTRAGCLIGAEHVNNSY NVFQTRAGCLIGAEYVNNSY 742 175
HLA-DPA1*03:01/DPB1*01:01 AGCLIGAEHVNNSYECDIP AGCLIGAEYVNNSYECDIP 1651 405
HLA-DPA1*04:01/DPB1*02:01 VFQTRAGCLIGAEHVNNSYE VFQTRAGCLIGAEYVNNSYE 1198 304
HLA-DPA1*03:01/DPB1*01:01 GCLIGAEHVNNSYECDIPI GCLIGAEYVNNSYECDIPI 1470 390
HLA-DPA1*04:01/DPB1*02:01 VFQTRAGCLIGAEHVNNSY VFQTRAGCLIGAEYVNNSY 1621 436
HLA-DPA1*03:01/DPB1*02:01 NVFQTRAGCLIGAEHVNNS NVFQTRAGCLIGAEYVNNS 1142 309
HLA-DPA1*03:01/DPB1*01:01 RAGCLIGAEHVNNSYECDI RAGCLIGAEYVNNSYECDI 1334 362
HLA-DPA1*04:01/DPB1*01:01 AGCLIGAEHVNNSYECDIP AGCLIGAEYVNNSYECDIP 1710 470
HLA-DPA1*04:01/DPB1*01:01 AGCLIGAEHVNNSYECDIPI AGCLIGAEYVNNSYECDIPI 1049 290
HLA-DPA1*03:01/DPB1*01:01 AGCLIGAEHVNNSYECDIPI AGCLIGAEYVNNSYECDIPI 887 249
HLA-DPA1*04:01/DPB1*01:01 GCLIGAEHVNNSYECDIPIG GCLIGAEYVNNSYECDIPIG 1213 345
HLA-DPA1*04:01/DPB1*01:01 GCLIGAEHVNNSYECDIPI GCLIGAEYVNNSYECDIPI 1663 474
HLA-DPA1*04:01/DPB1*01:01 AGCLIGAEHVNNSYE AGCLIGAEYVNNSYE 1562 446
HLA-DPA1*03:01/DPB1*01:01 GCLIGAEHVNNSYECDIPIG GCLIGAEYVNNSYECDIPIG 1084 310
HLA-DPA1*03:01/DPB1*01:01 AGCLIGAEHVNNSYECD AGCLIGAEYVNNSYECD 1734 500
HLA-DPA1*04:01/DPB1*01:01 AGCLIGAEHVNNSYEC AGCLIGAEYVNNSYEC 1628 474
HLA-DPA1*03:01/DPB1*01:01 RAGCLIGAEHVNNSYECDIP RAGCLIGAEYVNNSYECDIP 925 271
HLA-DPA1*03:01/DPB1*04:01 NVFQTRAGCLIGAEHVNNSY NVFQTRAGCLIGAEYVNNSY 1145 338
HLA-DPA1*03:01/DPB1*02:01 VFQTRAGCLIGAEHVNN VFQTRAGCLIGAEYVNN 1472 435
HLA-DPA1*03:01/DPB1*01:01 TRAGCLIGAEHVNNSYECD TRAGCLIGAEYVNNSYECD 1164 361
HLA-DPA1*03:01/DPB1*01:01 RAGCLIGAEHVNNSY RAGCLIGAEYVNNSY 1351 426
HLA-DPA1*01:03/DPB1*01:01 TRAGCLIGAEHVNNSYECDI TRAGCLIGAEYVNNSYECDI 1548 490
HLA-DPA1*03:01/DPB1*01:01 RAGCLIGAEHVNNSYE RAGCLIGAEYVNNSYE 1470 472
HLA-DPA1*04:01/DPB1*01:01 RAGCLIGAEHVNNSYECDIP RAGCLIGAEYVNNSYECDIP 904 291
HLA-DPA1*04:01/DPB1*02:01 NVFQTRAGCLIGAEHVNNSY NVFQTRAGCLIGAEYVNNSY 917 296
HLA-DPA1*04:01/DPB1*01:01 RAGCLIGAEHVNNSYECDI RAGCLIGAEYVNNSYECDI 1263 408
HLA-DPA1*04:01/DPB1*01:01 RAGCLIGAEHVNNSY RAGCLIGAEYVNNSY 1110 363
HLA-DPA1*03:01/DPB1*01:01 TRAGCLIGAEHVNNSYECDI TRAGCLIGAEYVNNSYECDI 729 242
HLA-DPA1*03:01/DPB1*01:01 CLIGAEHVNNSYECDIPIGA CLIGAEYVNNSYECDIPIGA 1006 342
HLA-DPA1*04:01/DPB1*01:01 CLIGAEHVNNSYECDIPIGA CLIGAEYVNNSYECDIPIGA 1099 381
HLA-DPA1*04:01/DPB1*01:01 RAGCLIGAEHVNNSYE RAGCLIGAEYVNNSYE 1106 386
HLA-DPA1*03:01/DPB1*01:01 LIGAEHVNNSYECDIPIGAG LIGAEYVNNSYECDIPIGAG 1195 419
HLA-DPA1*03:01/DPB1*01:01 TRAGCLIGAEHVNNSY TRAGCLIGAEYVNNSY 1171 411
HLA-DPA1*03:01/DPB1*02:01 SNVFQTRAGCLIGAEHVNNS SNVFQTRAGCLIGAEYVNNS 599 213
HLA-DPA1*03:01/DPB1*01:01 QTRAGCLIGAEHVNNSYECD QTRAGCLIGAEYVNNSYECD 692 248
HLA-DPA1*04:01/DPB1*01:01 TRAGCLIGAEHVNNSYECDI TRAGCLIGAEYVNNSYECDI 719 261
HLA-DPA1*01:03/DPB1*01:01 QTRAGCLIGAEHVNNSYECD QTRAGCLIGAEYVNNSYECD 1264 461
HLA-DPA1*04:01/DPB1*01:01 TRAGCLIGAEHVNNSYECD TRAGCLIGAEYVNNSYECD 1012 374
HLA-DPA1*03:01/DPB1*01:01 QTRAGCLIGAEHVNNSYEC QTRAGCLIGAEYVNNSYEC 1086 403
HLA-DPA1*04:01/DPB1*01:01 RAGCLIGAEHVNNSYEC RAGCLIGAEYVNNSYEC 1197 451
HLA-DPA1*04:01/DPB1*01:01 TRAGCLIGAEHVNNS TRAGCLIGAEYVNNS 1040 395
HLA-DPA1*03:01/DPB1*01:01 TRAGCLIGAEHVNNS TRAGCLIGAEYVNNS 1189 459
HLA-DPA1*04:01/DPB1*01:01 TRAGCLIGAEHVNNSY TRAGCLIGAEYVNNSY 830 330
HLA-DPA1*03:01/DPB1*01:01 TRAGCLIGAEHVNNSYE TRAGCLIGAEYVNNSYE 1071 426
HLA-DPA1*03:01/DPB1*04:01 SNVFQTRAGCLIGAEHVNNS SNVFQTRAGCLIGAEYVNNS 968 386
HLA-DPA1*03:01/DPB1*01:01 QTRAGCLIGAEHVNNSY QTRAGCLIGAEYVNNSY 939 380
HLA-DPA1*03:01/DPB1*01:01 FQTRAGCLIGAEHVNNSYE FQTRAGCLIGAEYVNNSYE 817 332
HLA-DPA1*04:01/DPB1*01:01 QTRAGCLIGAEHVNNSYECD QTRAGCLIGAEYVNNSYECD 617 256
HLA-DPA1*03:01/DPB1*01:01 QTRAGCLIGAEHVNNS QTRAGCLIGAEYVNNS 1114 463
HLA-DPA1*04:01/DPB1*01:01 TRAGCLIGAEHVNNSYE TRAGCLIGAEYVNNSYE 872 370
HLA-DPA1*03:01/DPB1*02:01 SNVFQTRAGCLIGAEHVNN SNVFQTRAGCLIGAEYVNN 919 390
HLA-DPA1*04:01/DPB1*02:01 SNVFQTRAGCLIGAEHVNNS SNVFQTRAGCLIGAEYVNNS 786 338
HLA-DPA1*01:03/DPB1*01:01 FQTRAGCLIGAEHVNNSYEC FQTRAGCLIGAEYVNNSYEC 937 403
HLA-DPA1*04:01/DPB1*01:01 QTRAGCLIGAEHVNNSYEC QTRAGCLIGAEYVNNSYEC 851 371
HLA-DPA1*03:01/DPB1*01:01 FQTRAGCLIGAEHVNNSYEC FQTRAGCLIGAEYVNNSYEC 560 246
HLA-DPA1*04:01/DPB1*01:01 QTRAGCLIGAEHVNN QTRAGCLIGAEYVNN 945 416
HLA-DPA1*03:01/DPB1*01:01 QTRAGCLIGAEHVNN QTRAGCLIGAEYVNN 1093 484
HLA-DPA1*01:03/DPB1*01:01 VFQTRAGCLIGAEHVNNSYE VFQTRAGCLIGAEYVNNSYE 800 364
HLA-DPA1*03:01/DPB1*01:01 VFQTRAGCLIGAEHVNNSY VFQTRAGCLIGAEYVNNSY 613 282
HLA-DPA1*04:01/DPB1*01:01 QTRAGCLIGAEHVNNS QTRAGCLIGAEYVNNS 799 369
HLA-DPA1*03:01/DPB1*01:01 FQTRAGCLIGAEHVNN FQTRAGCLIGAEYVNN 918 424
HLA-DPA1*04:01/DPB1*01:01 FQTRAGCLIGAEHVNNSYEC FQTRAGCLIGAEYVNNSYEC 487 228
HLA-DPA1*04:01/DPB1*01:01 QTRAGCLIGAEHVNNSY QTRAGCLIGAEYVNNSY 724 339
HLA-DPA1*03:01/DPB1*01:01 FQTRAGCLIGAEHVNNS FQTRAGCLIGAEYVNNS 804 377
HLA-DPA1*03:01/DPB1*01:01 VFQTRAGCLIGAEHVNNSYE VFQTRAGCLIGAEYVNNSYE 452 218
HLA-DQA1*01:02/DQB1*05:01 RAGCLIGAEHVNNSYECDIP RAGCLIGAEYVNNSYECDIP 607 293
HLA-DPA1*02:02/DPB1*01:01 VFQTRAGCLIGAEHVNNSYE VFQTRAGCLIGAEYVNNSYE 1034 500
HLA-DQA1*01:02/DQB1*05:01 RAGCLIGAEHVNNSYECDI RAGCLIGAEYVNNSYECDI 945 457
HLA-DQA1*01:02/DQB1*05:01 GCLIGAEHVNNSYECDIPIG GCLIGAEYVNNSYECDIPIG 563 273
HLA-DQA1*01:02/DQB1*05:01 LIGAEHVNNSYECDIPIGAG LIGAEYVNNSYECDIPIGAG 565 274
HLA-DPA1*04:01/DPB1*01:01 FQTRAGCLIGAEHVNNSYE FQTRAGCLIGAEYVNNSYE 634 313
HLA-DPA1*03:01/DPB1*02:01 GSNVFQTRAGCLIGAEHVNN GSNVFQTRAGCLIGAEYVNN 562 279
HLA-DPA1*04:01/DPB1*01:01 VFQTRAGCLIGAEHVNNSYE VFQTRAGCLIGAEYVNNSYE 384 191
HLA-DPA1*01:03/DPB1*01:01 NVFQTRAGCLIGAEHVNNSY NVFQTRAGCLIGAEYVNNSY 699 348
HLA-DPA1*03:01/DPB1*04:01 GSNVFQTRAGCLIGAEHVNN GSNVFQTRAGCLIGAEYVNN 951 474
HLA-DQA1*01:02/DQB1*05:01 CLIGAEHVNNSYECDIPIGA CLIGAEYVNNSYECDIPIGA 537 268

T1027I

Reference  QSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    QSLQTYVTQQLIRAAEIRASANLAAIKMSECVLGQSKRVDFCGKGYHLMSF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*13:02 LAATKMSECVLGQSK LAAIKMSECVLGQSK 5209 484
HLA-DRB1*04:04 LAATKMSECVLGQSK LAAIKMSECVLGQSK 1833 222
HLA-DRB1*04:04 NLAATKMSECVLGQSK NLAAIKMSECVLGQSK 3170 421
HLA-DRB1*04:04 NLAATKMSECVLGQS NLAAIKMSECVLGQS 2374 318
HLA-DRB1*04:04 ANLAATKMSECVLGQSK ANLAAIKMSECVLGQSK 2673 370
HLA-DRB1*04:04 NLAATKMSECVLGQSKR NLAAIKMSECVLGQSKR 2533 379
HLA-DRB1*04:04 LAATKMSECVLGQSKR LAAIKMSECVLGQSKR 2842 447
HLA-DRB1*04:04 ANLAATKMSECVLGQ ANLAAIKMSECVLGQ 2445 398
HLA-DRB1*11:02 LAATKMSECVLGQSK LAAIKMSECVLGQSK 2480 414
HLA-DRB1*13:01 LAATKMSECVLGQSK LAAIKMSECVLGQSK 2480 414
HLA-DRB1*04:04 AATKMSECVLGQSKR AAIKMSECVLGQSKR 1886 321
HLA-DRB1*01:01 LAATKMSECVLGQSK LAAIKMSECVLGQSK 740 136
HLA-DRB1*01:02 LAATKMSECVLGQSK LAAIKMSECVLGQSK 1865 371
HLA-DRB1*11:02 AATKMSECVLGQSKR AAIKMSECVLGQSKR 2389 487
HLA-DRB1*13:01 AATKMSECVLGQSKR AAIKMSECVLGQSKR 2389 487
HLA-DRB1*01:01 AATKMSECVLGQSKR AAIKMSECVLGQSKR 990 202
HLA-DRB1*04:04 LAATKMSECVLGQSKRV LAAIKMSECVLGQSKRV 1923 401
HLA-DRB1*04:04 ASANLAATKMSECVLGQSKR ASANLAAIKMSECVLGQSKR 2017 422
HLA-DRB1*01:01 NLAATKMSECVLGQSK NLAAIKMSECVLGQSK 1972 431
HLA-DRB1*10:01 NLAATKMSECVLGQSK NLAAIKMSECVLGQSK 1436 315
HLA-DRB1*04:04 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 1839 410
HLA-DRB1*10:01 LAATKMSECVLGQSK LAAIKMSECVLGQSK 841 188
HLA-DRB1*10:01 ANLAATKMSECVLGQSK ANLAAIKMSECVLGQSK 1120 259
HLA-DRB1*01:01 NLAATKMSECVLGQS NLAAIKMSECVLGQS 804 189
HLA-DRB1*01:01 LAATKMSECVLGQSKR LAAIKMSECVLGQSKR 1962 463
HLA-DRB1*04:04 SANLAATKMSECVLGQSKRV SANLAAIKMSECVLGQSKRV 1758 417
HLA-DRB1*01:01 NLAATKMSECVLGQSKR NLAAIKMSECVLGQSKR 1546 375
HLA-DRB1*01:01 ANLAATKMSECVLGQSK ANLAAIKMSECVLGQSK 1517 369
HLA-DQA1*01:02/DQB1*05:01 ASANLAATKMSECVLGQ ASANLAAIKMSECVLGQ 777 191
HLA-DRB1*10:01 LAATKMSECVLGQSKR LAAIKMSECVLGQSKR 1353 334
HLA-DQA1*01:02/DQB1*05:01 ANLAATKMSECVLGQ ANLAAIKMSECVLGQ 953 236
HLA-DRB1*10:01 NLAATKMSECVLGQS NLAAIKMSECVLGQS 924 229
HLA-DQA1*01:02/DQB1*05:01 SANLAATKMSECVLG SANLAAIKMSECVLG 906 225
HLA-DQA1*01:02/DQB1*05:01 RASANLAATKMSECVLG RASANLAAIKMSECVLG 686 171
HLA-DRB1*10:01 NLAATKMSECVLGQSKR NLAAIKMSECVLGQSKR 1082 272
HLA-DQA1*01:02/DQB1*05:01 ANLAATKMSECVLGQSK ANLAAIKMSECVLGQSK 843 213
HLA-DQA1*01:02/DQB1*05:01 ASANLAATKMSECVLG ASANLAAIKMSECVLG 680 172
HLA-DRB1*10:01 ANLAATKMSECVLGQ ANLAAIKMSECVLGQ 894 230
HLA-DRB1*04:04 ANLAATKMSECVLGQSKRVD ANLAAIKMSECVLGQSKRVD 1723 447
HLA-DQA1*01:02/DQB1*05:01 SANLAATKMSECVLGQS SANLAAIKMSECVLGQS 797 207
HLA-DQA1*01:02/DQB1*05:01 SANLAATKMSECVLGQ SANLAAIKMSECVLGQ 681 177
HLA-DRB1*10:01 ANLAATKMSECVLGQS ANLAAIKMSECVLGQS 1540 408
HLA-DQA1*01:02/DQB1*05:01 ANLAATKMSECVLGQS ANLAAIKMSECVLGQS 706 188
HLA-DQA1*01:02/DQB1*05:01 NLAATKMSECVLGQS NLAAIKMSECVLGQS 957 258
HLA-DQA1*01:02/DQB1*05:01 NLAATKMSECVLGQSKR NLAAIKMSECVLGQSKR 957 260
HLA-DRB1*10:01 SANLAATKMSECVLGQS SANLAAIKMSECVLGQS 1110 303
HLA-DQA1*01:02/DQB1*05:01 LAATKMSECVLGQSK LAAIKMSECVLGQSK 1068 292
HLA-DQA1*01:02/DQB1*05:01 NLAATKMSECVLGQSK NLAAIKMSECVLGQSK 786 217
HLA-DRB1*10:01 AATKMSECVLGQSKR AAIKMSECVLGQSKR 890 247
HLA-DRB1*01:01 ANLAATKMSECVLGQ ANLAAIKMSECVLGQ 758 215
HLA-DQA1*01:02/DQB1*05:01 LAATKMSECVLGQSKR LAAIKMSECVLGQSKR 947 269
HLA-DRB1*10:01 ASANLAATKMSECVLGQ ASANLAAIKMSECVLGQ 1042 298
HLA-DQA1*01:02/DQB1*05:01 AATKMSECVLGQSKR AAIKMSECVLGQSKR 1697 489
HLA-DQA1*01:02/DQB1*05:01 ASANLAATKMSECVLGQSK ASANLAAIKMSECVLGQSK 701 202
HLA-DRB1*10:01 ASANLAATKMSECVLGQSK ASANLAAIKMSECVLGQSK 1134 328
HLA-DQA1*01:02/DQB1*05:01 RASANLAATKMSECVLGQ RASANLAAIKMSECVLGQ 1172 339
HLA-DQA1*01:02/DQB1*05:01 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 412 121
HLA-DRB1*10:01 SANLAATKMSECVLGQ SANLAAIKMSECVLGQ 1357 399
HLA-DRB1*10:01 SANLAATKMSECVLG SANLAAIKMSECVLG 823 242
HLA-DQA1*01:02/DQB1*05:01 SANLAATKMSECVLGQSKR SANLAAIKMSECVLGQSKR 736 217
HLA-DQA1*01:02/DQB1*05:01 RASANLAATKMSECVLGQS RASANLAAIKMSECVLGQS 616 182
HLA-DRB1*01:01 ASANLAATKMSECVLGQSK ASANLAAIKMSECVLGQSK 1663 493
HLA-DQA1*01:02/DQB1*05:01 SANLAATKMSECVLGQSK SANLAAIKMSECVLGQSK 1314 394
HLA-DQA1*01:02/DQB1*05:01 ASANLAATKMSECVLGQS ASANLAAIKMSECVLGQS 1285 386
HLA-DQA1*01:02/DQB1*05:01 ASANLAATKMSECVLGQSKR ASANLAAIKMSECVLGQSKR 461 139
HLA-DQA1*01:02/DQB1*05:01 ANLAATKMSECVLGQSKR ANLAAIKMSECVLGQSKR 1468 445
HLA-DQA1*01:03/DQB1*05:01 NLAATKMSECVLGQSK NLAAIKMSECVLGQSK 1469 447
HLA-DRB1*10:01 SANLAATKMSECVLGQSKR SANLAAIKMSECVLGQSKR 1135 348
HLA-DRB1*01:01 SANLAATKMSECVLGQS SANLAAIKMSECVLGQS 1507 465
HLA-DQA1*01:02/DQB1*05:01 RASANLAATKMSECV RASANLAAIKMSECV 969 299
HLA-DRB1*04:04 NLAATKMSECVLGQSKRVDF NLAAIKMSECVLGQSKRVDF 1487 459
HLA-DQA1*01:03/DQB1*05:01 ANLAATKMSECVLGQS ANLAAIKMSECVLGQS 1393 438
HLA-DQA1*01:03/DQB1*05:01 SANLAATKMSECVLGQ SANLAAIKMSECVLGQ 1405 448
HLA-DQA1*01:03/DQB1*05:01 ANLAATKMSECVLGQSK ANLAAIKMSECVLGQSK 1481 478
HLA-DQA1*01:02/DQB1*05:01 LAATKMSECVLGQSKRV LAAIKMSECVLGQSKRV 889 287
HLA-DQA1*01:03/DQB1*05:01 ASANLAATKMSECVLG ASANLAAIKMSECVLG 1360 440
HLA-DRB1*04:04 ATKMSECVLGQSKRV AIKMSECVLGQSKRV 1392 452
HLA-DQA1*01:02/DQB1*05:01 RASANLAATKMSECVL RASANLAAIKMSECVL 626 206
HLA-DQA1*01:02/DQB1*06:02 RASANLAATKMSECVLG RASANLAAIKMSECVLG 425 140
HLA-DQA1*01:02/DQB1*06:02 RASANLAATKMSECV RASANLAAIKMSECV 387 128
HLA-DRB1*10:01 ASANLAATKMSECVLG ASANLAAIKMSECVLG 1228 408
HLA-DQA1*01:02/DQB1*06:02 RASANLAATKMSECVLGQ RASANLAAIKMSECVLGQ 815 272
HLA-DQA1*01:02/DQB1*05:01 ANLAATKMSECVLGQSKRV ANLAAIKMSECVLGQSKRV 665 223
HLA-DRB1*10:01 ASANLAATKMSECVLGQSKR ASANLAAIKMSECVLGQSKR 603 203
HLA-DQA1*01:03/DQB1*05:01 SANLAATKMSECVLGQS SANLAAIKMSECVLGQS 1463 494
HLA-DQA1*01:03/DQB1*06:02 RASANLAATKMSECV RASANLAAIKMSECV 470 159
HLA-DRB1*01:01 ASANLAATKMSECVLGQSKR ASANLAAIKMSECVLGQSKR 850 288
HLA-DQA1*01:02/DQB1*05:01 SANLAATKMSECVLGQSKRV SANLAAIKMSECVLGQSKRV 424 144
HLA-DRB1*10:01 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 509 173
HLA-DRB1*10:01 ASANLAATKMSECVL ASANLAAIKMSECVL 636 220
HLA-DRB1*10:01 LAATKMSECVLGQSKRV LAAIKMSECVLGQSKRV 739 258
HLA-DRB1*10:01 RASANLAATKMSECVLGQS RASANLAAIKMSECVLGQS 915 320
HLA-DQA1*01:02/DQB1*06:02 RASANLAATKMSECVL RASANLAAIKMSECVL 339 119
HLA-DQA1*01:03/DQB1*05:01 RASANLAATKMSECVLG RASANLAAIKMSECVLG 1267 445
HLA-DQA1*01:02/DQB1*05:01 ANLAATKMSECVLGQSKRVD ANLAAIKMSECVLGQSKRVD 456 161
HLA-DRB1*01:01 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 612 219
HLA-DRB1*01:01 RASANLAATKMSECVLGQS RASANLAAIKMSECVLGQS 1256 450
HLA-DQA1*01:02/DQB1*05:01 ASANLAATKMSECVL ASANLAAIKMSECVL 820 295
HLA-DRB1*01:01 ASANLAATKMSECVLGQ ASANLAAIKMSECVLGQ 1297 468
HLA-DQA1*01:03/DQB1*05:01 ASANLAATKMSECVLGQSK ASANLAAIKMSECVLGQSK 1213 440
HLA-DRB1*01:01 SANLAATKMSECVLG SANLAAIKMSECVLG 683 248
HLA-DQA1*01:03/DQB1*05:01 RASANLAATKMSECVLGQS RASANLAAIKMSECVLGQS 1092 404
HLA-DQA1*01:02/DQB1*06:02 IRASANLAATKMSEC IRASANLAAIKMSEC 378 140
HLA-DQA1*01:03/DQB1*06:02 RASANLAATKMSECVLG RASANLAAIKMSECVLG 506 188
HLA-DQA1*01:02/DQB1*06:02 RASANLAATKMSECVLGQS RASANLAAIKMSECVLGQS 517 193
HLA-DRB1*10:01 RASANLAATKMSECVLG RASANLAAIKMSECVLG 688 257
HLA-DQA1*01:03/DQB1*06:02 RASANLAATKMSECVL RASANLAAIKMSECVL 495 186
HLA-DQA1*01:03/DQB1*05:01 SANLAATKMSECVLGQSKR SANLAAIKMSECVLGQSKR 1208 455
HLA-DQA1*01:02/DQB1*06:02 IRASANLAATKMSECV IRASANLAAIKMSECV 270 102
HLA-DQA1*01:02/DQB1*05:01 NLAATKMSECVLGQSKRVD NLAAIKMSECVLGQSKRVD 727 276
HLA-DQA1*01:03/DQB1*05:01 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 729 278
HLA-DQA1*01:03/DQB1*05:01 ASANLAATKMSECVLGQSKR ASANLAAIKMSECVLGQSKR 826 316
HLA-DQA1*01:03/DQB1*05:01 LAATKMSECVLGQSKRV LAAIKMSECVLGQSKRV 1266 486
HLA-DQA1*01:02/DQB1*05:01 AATKMSECVLGQSKRVD AAIKMSECVLGQSKRVD 1125 435
HLA-DQA1*01:02/DQB1*05:03 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 1070 415
HLA-DRB1*10:01 ANLAATKMSECVLGQSKRV ANLAAIKMSECVLGQSKRV 916 365
HLA-DQA1*01:02/DQB1*05:01 NLAATKMSECVLGQSKRVDF NLAAIKMSECVLGQSKRVDF 489 195
HLA-DQA1*01:02/DQB1*05:01 AATKMSECVLGQSKRV AAIKMSECVLGQSKRV 954 381
HLA-DQA1*01:02/DQB1*06:02 IRASANLAATKMSECVL IRASANLAAIKMSECVL 295 118
HLA-DQA1*01:03/DQB1*05:01 ANLAATKMSECVLGQSKRV ANLAAIKMSECVLGQSKRV 1055 422
HLA-DRB1*01:01 ASANLAATKMSECVL ASANLAAIKMSECVL 537 215
HLA-DQA1*01:02/DQB1*06:02 IRASANLAATKMSECVLG IRASANLAAIKMSECVLG 560 225
HLA-DRB1*10:01 AATKMSECVLGQSKRV AAIKMSECVLGQSKRV 898 362
HLA-DQA1*01:02/DQB1*05:03 ASANLAATKMSECVLGQSKR ASANLAAIKMSECVLGQSKR 1153 468
HLA-DQA1*01:03/DQB1*05:01 NLAATKMSECVLGQSKRVD NLAAIKMSECVLGQSKRVD 1189 483
HLA-DRB1*01:01 RASANLAATKMSECVLG RASANLAAIKMSECVLG 862 352
HLA-DQA1*01:03/DQB1*05:01 SANLAATKMSECVLGQSKRV SANLAAIKMSECVLGQSKRV 688 283
HLA-DPA1*03:01/DPB1*02:01 AAEIRASANLAATKM AAEIRASANLAAIKM 728 300
HLA-DRB1*10:01 SANLAATKMSECVLGQSKRV SANLAAIKMSECVLGQSKRV 508 210
HLA-DQA1*01:02/DQB1*06:02 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 384 159
HLA-DQA1*01:03/DQB1*06:02 RASANLAATKMSECVLGQS RASANLAAIKMSECVLGQS 630 262
HLA-DRB1*10:01 NLAATKMSECVLGQSKRVD NLAAIKMSECVLGQSKRVD 940 391
HLA-DQA1*01:03/DQB1*06:02 ASANLAATKMSECVLG ASANLAAIKMSECVLG 558 233
HLA-DQA1*01:03/DQB1*05:01 ANLAATKMSECVLGQSKRVD ANLAAIKMSECVLGQSKRVD 756 316
HLA-DQA1*01:02/DQB1*05:01 LAATKMSECVLGQSKRVDFC LAAIKMSECVLGQSKRVDFC 604 254
HLA-DQA1*01:02/DQB1*06:02 ASANLAATKMSECVLG ASANLAAIKMSECVLG 372 157
HLA-DRB1*10:01 RASANLAATKMSECVL RASANLAAIKMSECVL 772 326
HLA-DQA1*01:03/DQB1*06:02 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 374 158
HLA-DPA1*03:01/DPB1*02:01 EIRASANLAATKMSE EIRASANLAAIKMSE 1075 455
HLA-DQA1*01:02/DQB1*06:02 IRASANLAATKMSECVLGQ IRASANLAAIKMSECVLGQ 378 160
HLA-DQA1*01:02/DQB1*06:02 ASANLAATKMSECVLGQ ASANLAAIKMSECVLGQ 431 183
HLA-DPA1*03:01/DPB1*02:01 AEIRASANLAATKMS AEIRASANLAAIKMS 803 341
HLA-DQA1*01:02/DQB1*05:01 ATKMSECVLGQSKRVD AIKMSECVLGQSKRVD 1026 436
HLA-DQA1*01:03/DQB1*06:02 ASANLAATKMSECVL ASANLAAIKMSECVL 468 199
HLA-DPA1*02:01/DPB1*09:01 AEIRASANLAATKMS AEIRASANLAAIKMS 866 369
HLA-DQA1*01:03/DQB1*06:02 ASANLAATKMSECVLGQ ASANLAAIKMSECVLGQ 567 243
HLA-DQA1*01:02/DQB1*05:01 LAATKMSECVLGQSKRVDF LAAIKMSECVLGQSKRVDF 734 316
HLA-DQA1*01:02/DQB1*06:02 ASANLAATKMSECVLGQS ASANLAAIKMSECVLGQS 868 375
HLA-DPA1*02:01/DPB1*09:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 902 394
HLA-DPA1*02:01/DPB1*09:01 RAAEIRASANLAATKMS RAAEIRASANLAAIKMS 963 421
HLA-DPA1*03:01/DPB1*02:01 RAAEIRASANLAATK RAAEIRASANLAAIK 987 432
HLA-DPA1*02:01/DPB1*09:01 AAEIRASANLAATKM AAEIRASANLAAIKM 806 354
HLA-DPA1*03:01/DPB1*02:01 RAAEIRASANLAATKMS RAAEIRASANLAAIKMS 724 318
HLA-DPA1*02:01/DPB1*09:01 AAEIRASANLAATKMSE AAEIRASANLAAIKMSE 982 433
HLA-DQA1*01:02/DQB1*05:01 IRASANLAATKMSECVLGQS IRASANLAAIKMSECVLGQS 147 65
HLA-DQA1*01:03/DQB1*06:02 SANLAATKMSECVLG SANLAAIKMSECVLG 538 238
HLA-DPA1*02:01/DPB1*09:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 771 342
HLA-DRB1*10:01 RASANLAATKMSECV RASANLAAIKMSECV 455 202
HLA-DPA1*01:03/DPB1*01:01 AEIRASANLAATKMS AEIRASANLAAIKMS 716 319
HLA-DPA1*01:03/DPB1*01:01 AAEIRASANLAATKM AAEIRASANLAAIKM 688 307
HLA-DPA1*02:01/DPB1*09:01 RAAEIRASANLAATKMSEC RAAEIRASANLAAIKMSEC 1061 475
HLA-DPA1*03:01/DPB1*02:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 751 337
HLA-DPA1*03:01/DPB1*01:01 RAAEIRASANLAATKMSE RAAEIRASANLAAIKMSE 687 309
HLA-DPA1*03:01/DPB1*05:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 773 348
HLA-DRB1*01:01 RASANLAATKMSECVL RASANLAAIKMSECVL 1078 487
HLA-DPA1*01:03/DPB1*13:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 898 406
HLA-DPA1*01:03/DPB1*01:01 EIRASANLAATKMSE EIRASANLAAIKMSE 847 383
HLA-DPA1*02:01/DPB1*09:01 RAAEIRASANLAATKM RAAEIRASANLAAIKM 802 363
HLA-DPA1*04:01/DPB1*02:01 AEIRASANLAATKMS AEIRASANLAAIKMS 678 307
HLA-DRB1*10:01 ANLAATKMSECVLGQSKRVD ANLAAIKMSECVLGQSKRVD 516 234
HLA-DPA1*03:01/DPB1*02:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 882 400
HLA-DPA1*03:01/DPB1*02:01 RAAEIRASANLAATKM RAAEIRASANLAAIKM 710 322
HLA-DPA1*03:01/DPB1*13:01 AEIRASANLAATKMS AEIRASANLAAIKMS 837 380
HLA-DRB1*10:01 AATKMSECVLGQSKRVD AAIKMSECVLGQSKRVD 719 327
HLA-DRB1*01:01 RASANLAATKMSECV RASANLAAIKMSECV 334 152
HLA-DQA1*01:02/DQB1*06:02 ASANLAATKMSECVLGQSK ASANLAAIKMSECVLGQSK 533 243
HLA-DPA1*03:01/DPB1*02:01 AAEIRASANLAATKMSE AAEIRASANLAAIKMSE 756 345
HLA-DPA1*04:01/DPB1*02:01 EIRASANLAATKMSE EIRASANLAAIKMSE 944 431
HLA-DPA1*01:03/DPB1*13:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 1007 460
HLA-DPA1*01:03/DPB1*13:01 AEIRASANLAATKMS AEIRASANLAAIKMS 989 452
HLA-DPA1*02:02/DPB1*13:01 AEIRASANLAATKMS AEIRASANLAAIKMS 798 365
HLA-DPA1*03:01/DPB1*05:01 AAEIRASANLAATKMSE AAEIRASANLAAIKMSE 642 294
HLA-DQA1*01:03/DQB1*05:01 NLAATKMSECVLGQSKRVDF NLAAIKMSECVLGQSKRVDF 744 341
HLA-DPA1*03:01/DPB1*09:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 554 254
HLA-DPA1*01:03/DPB1*13:01 RAAEIRASANLAATKM RAAEIRASANLAAIKM 907 417
HLA-DPA1*03:01/DPB1*01:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 379 175
HLA-DPA1*03:01/DPB1*01:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 413 191
HLA-DPA1*03:01/DPB1*01:01 AAEIRASANLAATKMSE AAEIRASANLAAIKMSE 356 165
HLA-DPA1*01:03/DPB1*13:01 AAEIRASANLAATKM AAEIRASANLAAIKM 920 428
HLA-DPA1*03:01/DPB1*05:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 724 337
HLA-DPA1*03:01/DPB1*09:01 RAAEIRASANLAATKMSEC RAAEIRASANLAAIKMSEC 549 256
HLA-DPA1*04:01/DPB1*02:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 754 352
HLA-DQA1*01:02/DQB1*05:01 ATKMSECVLGQSKRVDF AIKMSECVLGQSKRVDF 1047 489
HLA-DQA1*01:03/DQB1*06:02 SANLAATKMSECVLGQ SANLAAIKMSECVLGQ 607 284
HLA-DQA1*01:02/DQB1*06:02 EIRASANLAATKMSECV EIRASANLAAIKMSECV 190 89
HLA-DPA1*03:01/DPB1*09:01 AEIRASANLAATKMS AEIRASANLAAIKMS 540 253
HLA-DPA1*01:03/DPB1*01:01 RAAEIRASANLAATK RAAEIRASANLAAIK 842 396
HLA-DPA1*03:01/DPB1*13:01 AAEIRASANLAATKM AAEIRASANLAAIKM 754 355
HLA-DPA1*03:01/DPB1*09:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 474 224
HLA-DPA1*01:03/DPB1*01:01 AAEIRASANLAATKMSECV AAEIRASANLAAIKMSECV 562 266
HLA-DQA1*01:02/DQB1*05:01 AATKMSECVLGQSKRVDFC AAIKMSECVLGQSKRVDFC 993 470
HLA-DPA1*03:01/DPB1*01:01 RAAEIRASANLAATKM RAAEIRASANLAAIKM 357 169
HLA-DPA1*01:03/DPB1*01:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 629 298
HLA-DQA1*01:02/DQB1*06:02 IRASANLAATKMSECVLGQS IRASANLAAIKMSECVLGQS 287 136
HLA-DPA1*03:01/DPB1*05:01 AEIRASANLAATKMSEC AEIRASANLAAIKMSEC 673 319
HLA-DPA1*03:01/DPB1*01:01 RAAEIRASANLAATKMSEC RAAEIRASANLAAIKMSEC 327 155
HLA-DPA1*01:03/DPB1*01:01 RAAEIRASANLAATKMSEC RAAEIRASANLAAIKMSEC 559 265
HLA-DPA1*03:01/DPB1*05:01 EIRASANLAATKMSE EIRASANLAAIKMSE 1010 479
HLA-DPA1*03:01/DPB1*01:01 AEIRASANLAATKMS AEIRASANLAAIKMS 470 223
HLA-DQA1*01:03/DQB1*05:01 AATKMSECVLGQSKRVDFCG AAIKMSECVLGQSKRVDFCG 1043 495
HLA-DPA1*01:03/DPB1*01:01 EIRASANLAATKMSECVLG EIRASANLAAIKMSECVLG 693 329
HLA-DPA1*01:03/DPB1*01:01 AEIRASANLAATKMSECVL AEIRASANLAAIKMSECVL 572 272
HLA-DPA1*03:01/DPB1*09:01 AAEIRASANLAATKM AAEIRASANLAAIKM 496 236
HLA-DQA1*01:02/DQB1*06:02 ASANLAATKMSECVL ASANLAAIKMSECVL 332 158
HLA-DPA1*03:01/DPB1*09:01 AAEIRASANLAATKMSECV AAEIRASANLAAIKMSECV 569 271
HLA-DPA1*03:01/DPB1*13:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 725 346
HLA-DPA1*03:01/DPB1*01:01 EIRASANLAATKMSE EIRASANLAAIKMSE 551 263
HLA-DPA1*03:01/DPB1*01:01 RAAEIRASANLAATKMS RAAEIRASANLAAIKMS 354 169
HLA-DPA1*03:01/DPB1*09:01 RAAEIRASANLAATKMSE RAAEIRASANLAAIKMSE 1045 499
HLA-DPA1*03:01/DPB1*09:01 EIRASANLAATKMSEC EIRASANLAAIKMSEC 711 340
HLA-DPA1*03:01/DPB1*05:01 RAAEIRASANLAATKMS RAAEIRASANLAAIKMS 623 298
HLA-DPA1*03:01/DPB1*13:01 RAAEIRASANLAATK RAAEIRASANLAAIK 932 446
HLA-DQA1*01:02/DQB1*06:02 ASANLAATKMSECVLGQSKR ASANLAAIKMSECVLGQSKR 428 205
HLA-DPA1*01:03/DPB1*01:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 595 285
HLA-DPA1*03:01/DPB1*09:01 AAEIRASANLAATKMSE AAEIRASANLAAIKMSE 559 268
HLA-DPA1*02:02/DPB1*13:01 AAEIRASANLAATKM AAEIRASANLAAIKM 723 347
HLA-DPA1*02:02/DPB1*09:01 AEIRASANLAATKMSE AEIRASANLAAIKMSE 450 216
HLA-DRB1*11:02 ATKMSECVLGQSKRV AIKMSECVLGQSKRV 741 356
HLA-DRB1*13:01 ATKMSECVLGQSKRV AIKMSECVLGQSKRV 741 356
HLA-DPA1*02:01/DPB1*09:01 IRAAEIRASANLAATKMSE IRAAEIRASANLAAIKMSE 920 442
HLA-DPA1*02:01/DPB1*09:01 IRAAEIRASANLAATKM IRAAEIRASANLAAIKM 896 431
HLA-DPA1*03:01/DPB1*09:01 EIRASANLAATKMSE EIRASANLAAIKMSE 738 355
HLA-DPA1*01:03/DPB1*09:01 EIRASANLAATKMSE EIRASANLAAIKMSE 613 295
HLA-DPA1*02:02/DPB1*13:01 EIRASANLAATKMSE EIRASANLAAIKMSE 1024 493
HLA-DPA1*01:03/DPB1*09:01 AEIRASANLAATKMS AEIRASANLAAIKMS 469 226
HLA-DPA1*03:01/DPB1*13:01 AEIRASANLAATKMSEC AEIRASANLAAIKMSEC 855 413
HLA-DPA1*02:02/DPB1*09:01 EIRASANLAATKMSEC EIRASANLAAIKMSEC 656 317
HLA-DPA1*03:01/DPB1*09:01 AEIRASANLAATKMSEC AEIRASANLAAIKMSEC 631 305
HLA-DPA1*01:03/DPB1*01:01 RAAEIRASANLAATKM RAAEIRASANLAAIKM 583 282
HLA-DPA1*03:01/DPB1*13:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 648 314
HLA-DPA1*01:03/DPB1*01:01 AAEIRASANLAATKMSE AAEIRASANLAAIKMSE 555 269
HLA-DPA1*04:01/DPB1*02:01 AAEIRASANLAATKM AAEIRASANLAAIKM 573 278
HLA-DPA1*03:01/DPB1*05:01 AEIRASANLAATKMS AEIRASANLAAIKMS 876 426
HLA-DPA1*03:01/DPB1*01:01 AAEIRASANLAATKMSEC AAEIRASANLAAIKMSEC 627 305
HLA-DPA1*03:01/DPB1*09:01 RAAEIRASANLAATKMS RAAEIRASANLAAIKMS 524 255
HLA-DPA1*03:01/DPB1*01:01 AAEIRASANLAATKM AAEIRASANLAAIKM 423 206
HLA-DQA1*01:03/DQB1*05:01 LAATKMSECVLGQSKRVDFC LAAIKMSECVLGQSKRVDFC 829 404
HLA-DQA1*01:02/DQB1*06:02 EIRASANLAATKMSE EIRASANLAAIKMSE 199 97
HLA-DPA1*02:02/DPB1*09:01 EIRASANLAATKMSE EIRASANLAAIKMSE 571 279
HLA-DPA1*03:01/DPB1*13:01 EIRASANLAATKMSEC EIRASANLAAIKMSEC 912 446
HLA-DPA1*03:01/DPB1*13:01 AAEIRASANLAATKMSE AAEIRASANLAAIKMSE 764 374
HLA-DQA1*01:02/DQB1*05:01 AATKMSECVLGQSKRVDFCG AAIKMSECVLGQSKRVDFCG 725 355
HLA-DPA1*03:01/DPB1*01:01 EIRASANLAATKMSEC EIRASANLAAIKMSEC 439 215
HLA-DPA1*03:01/DPB1*13:01 RAAEIRASANLAATKM RAAEIRASANLAAIKM 647 317
HLA-DPA1*03:01/DPB1*05:01 RAAEIRASANLAATKMSEC RAAEIRASANLAAIKMSEC 655 321
HLA-DPA1*04:01/DPB1*02:01 RAAEIRASANLAATK RAAEIRASANLAAIK 734 360
HLA-DQA1*01:02/DQB1*05:01 IRASANLAATKMSECVLG IRASANLAAIKMSECVLG 318 156
HLA-DPA1*03:01/DPB1*01:01 IRASANLAATKMSEC IRASANLAAIKMSEC 593 291
HLA-DPA1*03:01/DPB1*01:01 IRAAEIRASANLAATKMS IRAAEIRASANLAAIKMS 597 293
HLA-DPA1*01:03/DPB1*01:01 RAAEIRASANLAATKMS RAAEIRASANLAAIKMS 552 271
HLA-DPA1*03:01/DPB1*01:01 IRAAEIRASANLAATKMSE IRAAEIRASANLAAIKMSE 299 147
HLA-DPA1*01:03/DPB1*05:01 AEIRASANLAATKMSEC AEIRASANLAAIKMSEC 973 479
HLA-DPA1*01:03/DPB1*13:01 RAAEIRASANLAATKMS RAAEIRASANLAAIKMS 975 480
HLA-DPA1*01:03/DPB1*05:01 AAEIRASANLAATKMSE AAEIRASANLAAIKMSE 918 452
HLA-DPA1*03:01/DPB1*09:01 RAAEIRASANLAATKM RAAEIRASANLAAIKM 463 228
HLA-DPA1*02:02/DPB1*09:01 AEIRASANLAATKMS AEIRASANLAAIKMS 402 198
HLA-DPA1*03:01/DPB1*05:01 RAAEIRASANLAATKM RAAEIRASANLAAIKM 682 336
HLA-DPA1*03:01/DPB1*09:01 AEIRASANLAATKMSECVL AEIRASANLAAIKMSECVL 625 308
HLA-DPA1*01:03/DPB1*01:01 AEIRASANLAATKMSEC AEIRASANLAAIKMSEC 578 285
HLA-DQA1*01:02/DQB1*06:02 SANLAATKMSECVLGQSK SANLAAIKMSECVLGQSK 944 466
HLA-DPA1*03:01/DPB1*02:01 AEIRASANLAATKMSEC AEIRASANLAAIKMSEC 711 351
HLA-DPA1*04:01/DPB1*11:01 RASANLAATKMSECVLGQSK RASANLAAIKMSECVLGQSK 824 407
HLA-DPA1*03:01/DPB1*02:01 IRAAEIRASANLAATKM IRAAEIRASANLAAIKM 589 291
HLA-DPA1*03:01/DPB1*01:01 AEIRASANLAATKMSEC AEIRASANLAAIKMSEC 346 171
HLA-DPA1*03:01/DPB1*05:01 AEIRASANLAATKMSECVL AEIRASANLAAIKMSECVL 629 311
HLA-DQA1*01:02/DQB1*05:01 IRASANLAATKMSECVLGQ IRASANLAAIKMSECVLGQ 198 98
HLA-DPA1*03:01/DPB1*13:01 RAAEIRASANLAATKMS RAAEIRASANLAAIKMS 741 367
HLA-DPA1*02:02/DPB1*09:01 AEIRASANLAATKMSEC AEIRASANLAAIKMSEC 536 266
HLA-DPA1*04:01/DPB1*02:01 AAEIRASANLAATKMS AAEIRASANLAAIKMS 610 303
HLA-DPA1*03:01/DPB1*05:01 AAEIRASANLAATKM AAEIRASANLAAIKM 801 398
HLA-DPA1*03:01/DPB1*05:01 EIRASANLAATKMSEC EIRASANLAAIKMSEC 873 434
HLA-DPA1*03:01/DPB1*09:01 IRAAEIRASANLAATKMSE IRAAEIRASANLAAIKMSE 480 239
HLA-DPA1*04:01/DPB1*85:01 EIRASANLAATKMSE EIRASANLAAIKMSE 484 241
HLA-DRB1*01:02 RASANLAATKMSECV RASANLAAIKMSECV 976 486
HLA-DPA1*03:01/DPB1*02:01 IRAAEIRASANLAATKMSE IRAAEIRASANLAAIKMSE 582 290
HLA-DRB1*10:01 LAATKMSECVLGQSKRVDF LAAIKMSECVLGQSKRVDF 806 402
HLA-DPA1*02:01/DPB1*09:01 AEIRASANLAATKMSECVLG AEIRASANLAAIKMSECVLG 677 338
HLA-DPA1*02:01/DPB1*09:01 RAAEIRASANLAATKMSECV RAAEIRASANLAAIKMSECV 494 247
HLA-DPA1*03:01/DPB1*13:01 RAAEIRASANLAATKMSEC RAAEIRASANLAAIKMSEC 698 349

V1176F

Reference  ELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ELDKYFKNHTSPDVDLGDISGINASFVNIQKEIDRLNEVAKNLNESLIDLQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:01 ASVVNIQKEIDRLNE ASFVNIQKEIDRLNE 1675 185
HLA-DRB1*11:01 SVVNIQKEIDRLNEV SFVNIQKEIDRLNEV 2234 292
HLA-DRB1*11:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 1315 180
HLA-DRB1*11:01 SGINASVVNIQKEIDRLNEV SGINASFVNIQKEIDRLNEV 1752 241
HLA-DRB1*11:01 GINASVVNIQKEIDRLNEVA GINASFVNIQKEIDRLNEVA 1746 243
HLA-DRB1*11:01 NASVVNIQKEIDRLN NASFVNIQKEIDRLN 1306 184
HLA-DRB1*11:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 1716 244
HLA-DRB1*11:01 INASVVNIQKEIDRLNEVAK INASFVNIQKEIDRLNEVAK 1725 254
HLA-DRB1*11:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 1726 255
HLA-DRB1*11:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 1909 287
HLA-DRB1*11:01 NASVVNIQKEIDRLNEVAKN NASFVNIQKEIDRLNEVAKN 1773 275
HLA-DRB1*11:01 NASVVNIQKEIDRLNEV NASFVNIQKEIDRLNEV 2439 389
HLA-DRB1*11:01 ASVVNIQKEIDRLNEVA ASFVNIQKEIDRLNEVA 2924 467
HLA-DRB1*11:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 1984 321
HLA-DRB1*11:01 NASVVNIQKEIDRLNE NASFVNIQKEIDRLNE 2580 418
HLA-DRB1*11:01 INASVVNIQKEIDRLNE INASFVNIQKEIDRLNE 2256 367
HLA-DRB1*11:01 GINASVVNIQKEIDRLNEV GINASFVNIQKEIDRLNEV 2972 499
HLA-DRB1*11:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 2611 445
HLA-DRB1*11:01 GINASVVNIQKEIDRLN GINASFVNIQKEIDRLN 2146 367
HLA-DRB1*11:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 2360 404
HLA-DRB1*11:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 2882 498
HLA-DRB1*11:01 INASVVNIQKEIDRLN INASFVNIQKEIDRLN 2263 400
HLA-DRB1*11:01 ASVVNIQKEIDRLNEVAKNL ASFVNIQKEIDRLNEVAKNL 1742 350
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQK GDISGINASFVNIQK 1335 275
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKE DISGINASFVNIQKE 1221 272
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEI ISGINASFVNIQKEI 1029 249
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEIDR ISGINASFVNIQKEIDR 1281 311
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKEID DISGINASFVNIQKEID 1196 291
HLA-DPA1*03:01/DPB1*04:01 ISGINASVVNIQKEIDR ISGINASFVNIQKEIDR 1853 451
HLA-DPA1*03:01/DPB1*04:01 DISGINASVVNIQKEID DISGINASFVNIQKEID 1703 432
HLA-DPA1*03:01/DPB1*04:01 ISGINASVVNIQKEID ISGINASFVNIQKEID 1768 455
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQKEI GDISGINASFVNIQKEI 1126 293
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQKEIDR GDISGINASFVNIQKEIDR 971 258
HLA-DPA1*03:01/DPB1*04:01 GDISGINASVVNIQKEIDR GDISGINASFVNIQKEIDR 1449 387
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEID SGINASFVNIQKEID 1547 414
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQKE GDISGINASFVNIQKE 1254 337
HLA-DRB1*10:01 ASVVNIQKEIDRLNE ASFVNIQKEIDRLNE 1044 281
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEID ISGINASFVNIQKEID 1104 301
HLA-DRB1*10:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 966 266
HLA-DPA1*03:01/DPB1*04:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 1334 369
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQKE LGDISGINASFVNIQKE 1177 327
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 1388 387
HLA-DPA1*03:01/DPB1*02:01 DLGDISGINASVVNIQK DLGDISGINASFVNIQK 1206 338
HLA-DPA1*03:01/DPB1*04:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 1473 413
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 861 243
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQ LGDISGINASFVNIQ 1206 341
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKEI DISGINASFVNIQKEI 1003 288
HLA-DRB1*10:01 NASVVNIQKEIDRLN NASFVNIQKEIDRLN 1219 353
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQK LGDISGINASFVNIQK 1088 320
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 1482 439
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 621 185
HLA-DPA1*03:01/DPB1*04:01 LGDISGINASVVNIQKEID LGDISGINASFVNIQKEID 1280 386
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQKEID LGDISGINASFVNIQKEID 840 254
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 913 284
HLA-DPA1*03:01/DPB1*02:01 DVDLGDISGINASVVNIQK DVDLGDISGINASFVNIQK 1077 337
HLA-DPA1*03:01/DPB1*02:01 VDLGDISGINASVVNIQKE VDLGDISGINASFVNIQKE 990 310
HLA-DPA1*03:01/DPB1*04:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 912 286
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 607 193
HLA-DPA1*04:01/DPB1*04:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 1551 498
HLA-DPA1*03:01/DPB1*04:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 1049 340
HLA-DPA1*03:01/DPB1*02:01 DLGDISGINASVVNIQKEI DLGDISGINASFVNIQKEI 819 266
HLA-DPA1*03:01/DPB1*04:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 923 301
HLA-DPA1*04:01/DPB1*04:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 1478 483
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 684 224
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 580 192
HLA-DPA1*04:01/DPB1*02:01 DISGINASVVNIQKE DISGINASFVNIQKE 1351 457
HLA-DRB1*10:01 SVVNIQKEIDRLNEV SFVNIQKEIDRLNEV 776 263
HLA-DPA1*03:01/DPB1*02:01 VDLGDISGINASVVNIQ VDLGDISGINASFVNIQ 1345 456
HLA-DPA1*03:01/DPB1*04:01 DLGDISGINASVVNIQKEI DLGDISGINASFVNIQKEI 1343 462
HLA-DPA1*03:01/DPB1*04:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 889 308
HLA-DPA1*04:01/DPB1*02:01 GDISGINASVVNIQK GDISGINASFVNIQK 1408 489
HLA-DPA1*03:01/DPB1*02:01 DLGDISGINASVVNIQ DLGDISGINASFVNIQ 1238 432
HLA-DPA1*03:01/DPB1*02:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 1347 473
HLA-DPA1*01:03/DPB1*01:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 1335 469
HLA-DPA1*03:01/DPB1*02:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 580 204
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 1124 398
HLA-DPA1*03:01/DPB1*02:01 GINASVVNIQKEIDRLN GINASFVNIQKEIDRLN 1393 495
HLA-DRB1*10:01 INASVVNIQKEIDRLNE INASFVNIQKEIDRLNE 1314 472
HLA-DPA1*01:03/DPB1*01:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 1319 478
HLA-DPA1*03:01/DPB1*02:01 DVDLGDISGINASVVNIQKE DVDLGDISGINASFVNIQKE 673 244
HLA-DPA1*03:01/DPB1*04:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 920 334
HLA-DPA1*03:01/DPB1*02:01 VDLGDISGINASVVNIQKEI VDLGDISGINASFVNIQKEI 574 209
HLA-DRB1*10:01 ASVVNIQKEIDRLNEV ASFVNIQKEIDRLNEV 1329 492
HLA-DRB1*10:01 ASVVNIQKEIDRLNEVA ASFVNIQKEIDRLNEVA 1112 417
HLA-DPA1*03:01/DPB1*02:01 PDVDLGDISGINASVVNIQK PDVDLGDISGINASFVNIQK 735 278
HLA-DPA1*03:01/DPB1*02:01 PDVDLGDISGINASVVNIQ PDVDLGDISGINASFVNIQ 1235 469
HLA-DRB1*10:01 NASVVNIQKEIDRLNEV NASFVNIQKEIDRLNEV 1303 498
HLA-DPA1*01:03/DPB1*01:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 1013 393
HLA-DRB1*10:01 INASVVNIQKEIDRLNEVA INASFVNIQKEIDRLNEVA 1071 416
HLA-DRB1*10:01 NASVVNIQKEIDRLNEVAK NASFVNIQKEIDRLNEVAK 1202 471
HLA-DPA1*03:01/DPB1*04:01 SGINASVVNIQKEIDRLNEV SGINASFVNIQKEIDRLNEV 818 325
HLA-DRB1*10:01 INASVVNIQKEIDRLNEVAK INASFVNIQKEIDRLNEVAK 588 234
HLA-DRB1*10:01 ASVVNIQKEIDRLNEVAKN ASFVNIQKEIDRLNEVAKN 1162 464
HLA-DRB1*10:01 SVVNIQKEIDRLNEVAK SFVNIQKEIDRLNEVAK 1151 462
HLA-DRB1*10:01 GINASVVNIQKEIDRLNEV GINASFVNIQKEIDRLNEV 943 388
HLA-DPA1*04:01/DPB1*02:01 ISGINASVVNIQKEI ISGINASFVNIQKEI 1190 490
HLA-DPA1*01:03/DPB1*01:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 926 382
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEIDRL ISGINASFVNIQKEIDRL 909 375
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEID SGINASFVNIQKEID 705 294
HLA-DPA1*01:03/DPB1*01:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 1033 431
HLA-DPA1*03:01/DPB1*04:01 DVDLGDISGINASVVNIQKE DVDLGDISGINASFVNIQKE 1133 473
HLA-DRB1*10:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 872 367
HLA-DPA1*01:03/DPB1*01:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 1128 476
HLA-DRB1*10:01 GINASVVNIQKEIDRLNEVA GINASFVNIQKEIDRLNEVA 502 212
HLA-DPA1*03:01/DPB1*04:01 VDLGDISGINASVVNIQKEI VDLGDISGINASFVNIQKEI 975 414
HLA-DQA1*05:01/DQB1*03:01 SGINASVVNIQKEID SGINASFVNIQKEID 158 372
HLA-DQA1*05:01/DQB1*03:19 SGINASVVNIQKEID SGINASFVNIQKEID 158 372
HLA-DRB1*10:01 SVVNIQKEIDRLNEVA SFVNIQKEIDRLNEVA 1155 491
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 590 251
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 570 244
HLA-DRB1*10:01 NASVVNIQKEIDRLNEVAKN NASFVNIQKEIDRLNEVAKN 614 263
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEIDR ISGINASFVNIQKEIDR 523 225
HLA-DPA1*01:03/DPB1*01:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 871 375
HLA-DPA1*03:01/DPB1*01:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 730 315
HLA-DRB1*10:01 SGINASVVNIQKEIDRLNEV SGINASFVNIQKEIDRLNEV 442 191
HLA-DQA1*05:01/DQB1*03:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 220 509
HLA-DQA1*05:01/DQB1*03:19 GINASVVNIQKEIDR GINASFVNIQKEIDR 220 509
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEIDRLN SGINASFVNIQKEIDRLN 976 422
HLA-DPA1*02:02/DPB1*01:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 1121 491
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 452 198
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEIDR DISGINASFVNIQKEIDR 879 386
HLA-DPA1*03:01/DPB1*01:01 GINASVVNIQKEIDRLNE GINASFVNIQKEIDRLNE 1127 496
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEID DISGINASFVNIQKEID 540 238
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEID ISGINASFVNIQKEID 517 228
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKEIDR GDISGINASFVNIQKEIDR 482 213
HLA-DRB1*10:01 GINASVVNIQKEIDRLN GINASFVNIQKEIDRLN 832 369
HLA-DPA1*03:01/DPB1*01:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 736 327
HLA-DPA1*04:01/DPB1*01:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 800 357
HLA-DRB1*10:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 782 349
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKEID GDISGINASFVNIQKEID 951 426
HLA-DPA1*03:01/DPB1*05:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 701 315
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEIDRLNEV SGINASFVNIQKEIDRLNEV 524 236
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 448 203
HLA-DPA1*03:01/DPB1*02:01 SPDVDLGDISGINASVVNIQ SPDVDLGDISGINASFVNIQ 874 398
HLA-DPA1*03:01/DPB1*01:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 589 270
HLA-DPA1*04:01/DPB1*01:01 NASVVNIQKEIDRLN NASFVNIQKEIDRLN 937 430
HLA-DPA1*02:02/DPB1*01:01 ISGINASVVNIQKEIDR ISGINASFVNIQKEIDR 963 442
HLA-DPA1*02:02/DPB1*01:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 876 403
HLA-DPA1*02:02/DPB1*01:01 DISGINASVVNIQKEID DISGINASFVNIQKEID 1040 479
HLA-DPA1*03:01/DPB1*01:01 NASVVNIQKEIDRLN NASFVNIQKEIDRLN 918 423
HLA-DPA1*02:02/DPB1*01:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 835 385
HLA-DPA1*03:01/DPB1*05:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 878 408
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 542 252
HLA-DPA1*03:01/DPB1*01:01 GINASVVNIQKEIDRLN GINASFVNIQKEIDRLN 562 262
HLA-DPA1*03:01/DPB1*04:01 GINASVVNIQKEIDRLNEVA GINASFVNIQKEIDRLNEVA 772 360
HLA-DPA1*02:02/DPB1*01:01 GDISGINASVVNIQKEIDR GDISGINASFVNIQKEIDR 954 445
HLA-DPA1*03:01/DPB1*05:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 756 354
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKE DISGINASFVNIQKE 698 327
HLA-DPA1*04:01/DPB1*02:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 1003 470
HLA-DPA1*03:01/DPB1*01:01 LGDISGINASVVNIQKEID LGDISGINASFVNIQKEID 473 222
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEI DISGINASFVNIQKEI 521 245
HLA-DQA1*05:01/DQB1*03:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 328 695
HLA-DQA1*05:01/DQB1*03:19 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 328 695
HLA-DQA1*05:01/DQB1*03:01 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 213 451
HLA-DQA1*05:01/DQB1*03:19 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 213 451
HLA-DPA1*02:02/DPB1*01:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 806 381
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 301 143
HLA-DPA1*04:01/DPB1*02:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 1013 482
HLA-DPA1*02:02/DPB1*01:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 878 419
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 311 149
HLA-DPA1*02:02/DPB1*01:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 994 477
HLA-DPA1*02:02/DPB1*01:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 657 318
HLA-DPA1*02:02/DPB1*01:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 576 279
HLA-DPA1*03:01/DPB1*01:01 NASVVNIQKEIDRLNE NASFVNIQKEIDRLNE 920 446
HLA-DQA1*05:01/DQB1*03:01 ISGINASVVNIQKEI ISGINASFVNIQKEI 113 233
HLA-DQA1*05:01/DQB1*03:19 ISGINASVVNIQKEI ISGINASFVNIQKEI 113 233
HLA-DQA1*01:02/DQB1*06:02 ISGINASVVNIQKEID ISGINASFVNIQKEID 69 142
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKE GDISGINASFVNIQKE 662 322
HLA-DPA1*03:01/DPB1*01:01 INASVVNIQKEIDRLNE INASFVNIQKEIDRLNE 636 310
HLA-DRB1*10:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 597 291
HLA-DPA1*04:01/DPB1*01:01 NASVVNIQKEIDRLNE NASFVNIQKEIDRLNE 851 415
HLA-DQA1*05:01/DQB1*03:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 304 623
HLA-DQA1*05:01/DQB1*03:19 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 304 623
HLA-DPA1*02:02/DPB1*01:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 561 274
HLA-DPA1*03:01/DPB1*01:01 INASVVNIQKEIDRLN INASFVNIQKEIDRLN 601 294
HLA-DQA1*02:01/DQB1*03:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 105 214
HLA-DQA1*02:01/DQB1*03:19 GINASVVNIQKEIDR GINASFVNIQKEIDR 105 214
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQK GDISGINASFVNIQK 825 405
HLA-DRB1*10:01 ASVVNIQKEIDRLNEVAKNL ASFVNIQKEIDRLNEVAKNL 499 245
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEI ISGINASFVNIQKEI 562 276
HLA-DPA1*04:01/DPB1*01:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 606 298
HLA-DPA1*04:01/DPB1*01:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 557 274
HLA-DPA1*04:01/DPB1*01:01 SGINASVVNIQKEID SGINASFVNIQKEID 678 334
HLA-DQA1*06:01/DQB1*03:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 298 604
HLA-DQA1*06:01/DQB1*03:19 GINASVVNIQKEIDR GINASFVNIQKEIDR 298 604
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 314 155
HLA-DPA1*04:01/DPB1*01:01 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 565 279
HLA-DPA1*03:01/DPB1*01:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 347 172
HLA-DPA1*03:01/DPB1*05:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 595 296
HLA-DPA1*04:01/DPB1*01:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 727 362
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKEI GDISGINASFVNIQKEI 562 280
HLA-DPA1*02:02/DPB1*01:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 574 286
HLA-DPA1*03:01/DPB1*04:01 INASVVNIQKEIDRLNEVAK INASFVNIQKEIDRLNEVAK 752 375
HLA-DPA1*02:02/DPB1*01:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 758 378
HLA-DPA1*03:01/DPB1*01:01 LGDISGINASVVNIQKE LGDISGINASFVNIQKE 665 332
HLA-DQA1*01:02/DQB1*06:02 DISGINASVVNIQKEI DISGINASFVNIQKEI 65 130
HLA-DQA1*05:01/DQB1*03:01 DISGINASVVNIQKE DISGINASFVNIQKE 108 216
HLA-DQA1*05:01/DQB1*03:19 DISGINASVVNIQKE DISGINASFVNIQKE 108 216

N protein

N

203-204 RG->KR

Reference  GGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQ
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    GGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNGGDAALALLLLDRLNQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 225 911
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 225 911
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 421 1456
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 421 1456
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 497 1707
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 497 1707
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 286 982
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 286 982
HLA-DQA1*06:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 484 1637
HLA-DQA1*06:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 484 1637
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 497 1555
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 497 1555
HLA-DQA1*05:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 333 1030
HLA-DQA1*05:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 333 1030
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARM SRNSTPGSSKRTSPARM 309 922
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARM SRNSTPGSSKRTSPARM 309 922
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 328 968
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 328 968
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 484 1359
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 484 1359
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 469 1315
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 469 1315
HLA-DRB1*01:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 1305 473
HLA-DRB1*01:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 1312 479
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 416 1132
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 416 1132
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 403 1078
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 403 1078
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 166 429
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 166 429
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 164 419
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 164 419
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 254 646
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 254 646
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 270 665
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 270 665
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 221 530
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 221 530
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 215 491
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 215 491
HLA-DQA1*06:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 399 894
HLA-DQA1*06:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 399 894
HLA-DQA1*05:01/DQB1*03:01 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSKRTSPARMAG 458 1019
HLA-DQA1*05:01/DQB1*03:19 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSKRTSPARMAG 458 1019
HLA-DQA1*05:01/DQB1*03:01 SRNSTPGSSRGTSPARMAGN SRNSTPGSSKRTSPARMAGN 387 842
HLA-DQA1*05:01/DQB1*03:19 SRNSTPGSSRGTSPARMAGN SRNSTPGSSKRTSPARMAGN 387 842
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAGN TPGSSKRTSPARMAGN 481 1016
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAGN TPGSSKRTSPARMAGN 481 1016
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAGN STPGSSKRTSPARMAGN 423 888
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAGN STPGSSKRTSPARMAGN 423 888
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARMAG SRNSTPGSSKRTSPARMAG 318 665
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARMAG SRNSTPGSSKRTSPARMAG 318 665
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNG 403 835
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNG 403 835
HLA-DQA1*06:01/DQB1*03:01 GSSRGTSPARMAGNG GSSKRTSPARMAGNG 424 867
HLA-DQA1*06:01/DQB1*03:19 GSSRGTSPARMAGNG GSSKRTSPARMAGNG 424 867
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 258 526
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 258 526
HLA-DQA1*02:01/DQB1*03:01 RNSSRNSTPGSSRGTSPARM RNSSRNSTPGSSKRTSPARM 299 603
HLA-DQA1*02:01/DQB1*03:19 RNSSRNSTPGSSRGTSPARM RNSSRNSTPGSSKRTSPARM 299 603
HLA-DQA1*02:01/DQB1*03:01 NSSRNSTPGSSRGTSPARM NSSRNSTPGSSKRTSPARM 404 814
HLA-DQA1*02:01/DQB1*03:19 NSSRNSTPGSSRGTSPARM NSSRNSTPGSSKRTSPARM 404 814

NS3 protein

NS3

S253P

Reference  VTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
           ||||||||||||||||||||||||| ||||||||||||||||||||||
Mutated    VTFFIYNKIVDEPEEHVQIHTIDGSPGVVNPVMEPIYDEPTTTTSVPL

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*01:02/DQB1*06:09 TIDGSSGVVNPVMEP TIDGSPGVVNPVMEP 487 1512
HLA-DQA1*01:02/DQB1*06:09 HTIDGSSGVVNPVMEP HTIDGSPGVVNPVMEP 439 1324
HLA-DQA1*02:01/DQB1*03:01 IDGSSGVVNPVMEPIYD IDGSPGVVNPVMEPIYD 99 280
HLA-DQA1*02:01/DQB1*03:19 IDGSSGVVNPVMEPIYD IDGSPGVVNPVMEPIYD 99 280
HLA-DQA1*01:02/DQB1*06:09 IDGSSGVVNPVMEPI IDGSPGVVNPVMEPI 399 1120
HLA-DQA1*01:02/DQB1*06:09 TIDGSSGVVNPVMEPI TIDGSPGVVNPVMEPI 335 939
HLA-DQA1*01:02/DQB1*06:09 HTIDGSSGVVNPVMEPI HTIDGSPGVVNPVMEPI 429 1187
HLA-DQA1*02:01/DQB1*03:01 TIDGSSGVVNPVMEPIYDE TIDGSPGVVNPVMEPIYDE 99 273
HLA-DQA1*02:01/DQB1*03:19 TIDGSSGVVNPVMEPIYDE TIDGSPGVVNPVMEPIYDE 99 273
HLA-DQA1*02:01/DQB1*03:01 TIDGSSGVVNPVMEPIYDEP TIDGSPGVVNPVMEPIYDEP 75 201
HLA-DQA1*02:01/DQB1*03:19 TIDGSSGVVNPVMEPIYDEP TIDGSPGVVNPVMEPIYDEP 75 201
HLA-DQA1*02:01/DQB1*03:01 IDGSSGVVNPVMEPIYDEP IDGSPGVVNPVMEPIYDEP 148 395
HLA-DQA1*02:01/DQB1*03:19 IDGSSGVVNPVMEPIYDEP IDGSPGVVNPVMEPIYDEP 148 395
HLA-DQA1*01:02/DQB1*06:09 IHTIDGSSGVVNPVME IHTIDGSPGVVNPVME 443 1176
HLA-DQA1*02:01/DQB1*03:01 TIDGSSGVVNPVMEPIY TIDGSPGVVNPVMEPIY 73 193
HLA-DQA1*02:01/DQB1*03:19 TIDGSSGVVNPVMEPIY TIDGSPGVVNPVMEPIY 73 193
HLA-DQA1*02:01/DQB1*03:01 IDGSSGVVNPVMEPIY IDGSPGVVNPVMEPIY 82 215
HLA-DQA1*02:01/DQB1*03:19 IDGSSGVVNPVMEPIY IDGSPGVVNPVMEPIY 82 215
HLA-DQA1*02:01/DQB1*03:01 HTIDGSSGVVNPVMEPIYD HTIDGSPGVVNPVMEPIYD 87 222
HLA-DQA1*02:01/DQB1*03:19 HTIDGSSGVVNPVMEPIYD HTIDGSPGVVNPVMEPIYD 87 222
HLA-DQA1*02:01/DQB1*03:01 HTIDGSSGVVNPVMEPIYDE HTIDGSPGVVNPVMEPIYDE 65 165
HLA-DQA1*02:01/DQB1*03:19 HTIDGSSGVVNPVMEPIYDE HTIDGSPGVVNPVMEPIYDE 65 165
HLA-DQA1*02:01/DQB1*03:01 IDGSSGVVNPVMEPIYDE IDGSPGVVNPVMEPIYDE 311 768
HLA-DQA1*02:01/DQB1*03:19 IDGSSGVVNPVMEPIYDE IDGSPGVVNPVMEPIYDE 311 768
HLA-DQA1*02:01/DQB1*03:01 IDGSSGVVNPVMEPIYDEPT IDGSPGVVNPVMEPIYDEPT 118 290
HLA-DQA1*02:01/DQB1*03:19 IDGSSGVVNPVMEPIYDEPT IDGSPGVVNPVMEPIYDEPT 118 290
HLA-DQA1*02:01/DQB1*03:01 DGSSGVVNPVMEPIY DGSPGVVNPVMEPIY 101 247
HLA-DQA1*02:01/DQB1*03:19 DGSSGVVNPVMEPIY DGSPGVVNPVMEPIY 101 247
HLA-DQA1*02:01/DQB1*03:03 HTIDGSSGVVNPVME HTIDGSPGVVNPVME 339 822
HLA-DQA1*02:01/DQB1*03:01 IDGSSGVVNPVMEPI IDGSPGVVNPVMEPI 57 138
HLA-DQA1*02:01/DQB1*03:19 IDGSSGVVNPVMEPI IDGSPGVVNPVMEPI 57 138
HLA-DQA1*02:01/DQB1*03:01 TIDGSSGVVNPVMEPIYD TIDGSPGVVNPVMEPIYD 210 506
HLA-DQA1*02:01/DQB1*03:19 TIDGSSGVVNPVMEPIYD TIDGSPGVVNPVMEPIYD 210 506
HLA-DQA1*02:01/DQB1*03:01 HTIDGSSGVVNPVMEPI HTIDGSPGVVNPVMEPI 66 159
HLA-DQA1*02:01/DQB1*03:19 HTIDGSSGVVNPVMEPI HTIDGSPGVVNPVMEPI 66 159
HLA-DQA1*01:02/DQB1*06:09 QIHTIDGSSGVVNPVMEPI QIHTIDGSPGVVNPVMEPI 386 927
HLA-DQA1*02:01/DQB1*03:01 DGSSGVVNPVMEPIYD DGSPGVVNPVMEPIYD 161 386
HLA-DQA1*02:01/DQB1*03:19 DGSSGVVNPVMEPIYD DGSPGVVNPVMEPIYD 161 386
HLA-DQA1*02:01/DQB1*03:01 DGSSGVVNPVMEPIYDE DGSPGVVNPVMEPIYDE 198 474
HLA-DQA1*02:01/DQB1*03:19 DGSSGVVNPVMEPIYDE DGSPGVVNPVMEPIYDE 198 474
HLA-DQA1*02:01/DQB1*03:01 TIDGSSGVVNPVMEPI TIDGSPGVVNPVMEPI 61 146
HLA-DQA1*02:01/DQB1*03:19 TIDGSSGVVNPVMEPI TIDGSPGVVNPVMEPI 61 146
HLA-DQA1*01:02/DQB1*06:09 TIDGSSGVVNPVMEPIY TIDGSPGVVNPVMEPIY 421 1000
HLA-DQA1*02:01/DQB1*03:03 HTIDGSSGVVNPVMEP HTIDGSPGVVNPVMEP 413 962
HLA-DQA1*02:01/DQB1*03:01 IHTIDGSSGVVNPVMEPIYD IHTIDGSPGVVNPVMEPIYD 60 139
HLA-DQA1*02:01/DQB1*03:19 IHTIDGSSGVVNPVMEPIYD IHTIDGSPGVVNPVMEPIYD 60 139
HLA-DQA1*02:01/DQB1*03:03 HTIDGSSGVVNPVMEPIYDE HTIDGSPGVVNPVMEPIYDE 440 1017
HLA-DQA1*02:01/DQB1*03:03 TIDGSSGVVNPVMEP TIDGSPGVVNPVMEP 392 906
HLA-DQA1*01:02/DQB1*06:09 IDGSSGVVNPVMEPIY IDGSPGVVNPVMEPIY 348 800
HLA-DQA1*01:02/DQB1*06:09 HTIDGSSGVVNPVMEPIYD HTIDGSPGVVNPVMEPIYD 392 899
HLA-DQA1*01:02/DQB1*06:09 IDGSSGVVNPVMEPIYD IDGSPGVVNPVMEPIYD 468 1073
HLA-DQA1*02:01/DQB1*03:01 IHTIDGSSGVVNPVMEPIY IHTIDGSPGVVNPVMEPIY 80 183
HLA-DQA1*02:01/DQB1*03:19 IHTIDGSSGVVNPVMEPIY IHTIDGSPGVVNPVMEPIY 80 183
HLA-DQA1*01:02/DQB1*06:09 IHTIDGSSGVVNPVMEPIY IHTIDGSPGVVNPVMEPIY 365 828
HLA-DQA1*02:01/DQB1*03:03 IHTIDGSSGVVNPVMEPIYD IHTIDGSPGVVNPVMEPIYD 375 850
HLA-DQA1*02:01/DQB1*03:01 HTIDGSSGVVNPVMEPIY HTIDGSPGVVNPVMEPIY 190 428
HLA-DQA1*02:01/DQB1*03:19 HTIDGSSGVVNPVMEPIY HTIDGSPGVVNPVMEPIY 190 428
HLA-DQA1*02:01/DQB1*03:03 TIDGSSGVVNPVMEPI TIDGSPGVVNPVMEPI 439 976
HLA-DQA1*01:02/DQB1*06:09 VQIHTIDGSSGVVNPVMEP VQIHTIDGSPGVVNPVMEP 455 1010
HLA-DQA1*01:03/DQB1*06:09 IHTIDGSSGVVNPVM IHTIDGSPGVVNPVM 484 1072
HLA-DQA1*01:02/DQB1*06:09 DGSSGVVNPVMEPIY DGSPGVVNPVMEPIY 478 1043
HLA-DQA1*02:01/DQB1*03:01 HTIDGSSGVVNPVMEP HTIDGSPGVVNPVMEP 56 122
HLA-DQA1*02:01/DQB1*03:19 HTIDGSSGVVNPVMEP HTIDGSPGVVNPVMEP 56 122
HLA-DQA1*02:01/DQB1*03:01 QIHTIDGSSGVVNPVMEPIY QIHTIDGSPGVVNPVMEPIY 57 124
HLA-DQA1*02:01/DQB1*03:19 QIHTIDGSSGVVNPVMEPIY QIHTIDGSPGVVNPVMEPIY 57 124
HLA-DQA1*01:02/DQB1*06:09 TIDGSSGVVNPVMEPIYDE TIDGSPGVVNPVMEPIYDE 390 848
HLA-DQA1*02:01/DQB1*03:03 IHTIDGSSGVVNPVM IHTIDGSPGVVNPVM 294 638
HLA-DQA1*02:01/DQB1*03:01 DGSSGVVNPVMEPIYDEPT DGSPGVVNPVMEPIYDEPT 322 698
HLA-DQA1*02:01/DQB1*03:19 DGSSGVVNPVMEPIYDEPT DGSPGVVNPVMEPIYDEPT 322 698
HLA-DQA1*02:01/DQB1*03:03 IHTIDGSSGVVNPVME IHTIDGSPGVVNPVME 326 706
HLA-DQA1*01:02/DQB1*06:09 QIHTIDGSSGVVNPVM QIHTIDGSPGVVNPVM 477 1031
HLA-DQA1*02:01/DQB1*03:01 IHTIDGSSGVVNPVMEP IHTIDGSPGVVNPVMEP 62 134
HLA-DQA1*02:01/DQB1*03:19 IHTIDGSSGVVNPVMEP IHTIDGSPGVVNPVMEP 62 134
HLA-DQA1*02:01/DQB1*03:03 IHTIDGSSGVVNPVMEPIY IHTIDGSPGVVNPVMEPIY 484 1046
HLA-DQA1*02:01/DQB1*03:01 TIDGSSGVVNPVMEP TIDGSPGVVNPVMEP 46 99
HLA-DQA1*02:01/DQB1*03:19 TIDGSSGVVNPVMEP TIDGSPGVVNPVMEP 46 99
HLA-DQA1*02:01/DQB1*03:03 QIHTIDGSSGVVNPVM QIHTIDGSPGVVNPVM 305 654
HLA-DQA1*02:01/DQB1*03:01 QIHTIDGSSGVVNPVME QIHTIDGSPGVVNPVME 60 128
HLA-DQA1*02:01/DQB1*03:19 QIHTIDGSSGVVNPVME QIHTIDGSPGVVNPVME 60 128
HLA-DQA1*01:02/DQB1*06:09 IDGSSGVVNPVMEPIYDEP IDGSPGVVNPVMEPIYDEP 424 903
HLA-DQA1*02:01/DQB1*03:03 QIHTIDGSSGVVNPVMEPIY QIHTIDGSPGVVNPVMEPIY 330 702
HLA-DQA1*02:01/DQB1*03:01 DGSSGVVNPVMEPIYDEPTT DGSPGVVNPVMEPIYDEPTT 247 522
HLA-DQA1*02:01/DQB1*03:19 DGSSGVVNPVMEPIYDEPTT DGSPGVVNPVMEPIYDEPTT 247 522
HLA-DQA1*01:03/DQB1*06:09 HTIDGSSGVVNPVMEPIYDE HTIDGSPGVVNPVMEPIYDE 411 868
HLA-DQA1*02:01/DQB1*03:01 QIHTIDGSSGVVNPVMEPI QIHTIDGSPGVVNPVMEPI 78 164
HLA-DQA1*02:01/DQB1*03:19 QIHTIDGSSGVVNPVMEPI QIHTIDGSPGVVNPVMEPI 78 164
HLA-DQA1*06:01/DQB1*03:01 TIDGSSGVVNPVMEPIYDE TIDGSPGVVNPVMEPIYDE 343 720
HLA-DQA1*06:01/DQB1*03:19 TIDGSSGVVNPVMEPIYDE TIDGSPGVVNPVMEPIYDE 343 720
HLA-DQA1*06:01/DQB1*03:01 IDGSSGVVNPVMEPIY IDGSPGVVNPVMEPIY 252 528
HLA-DQA1*06:01/DQB1*03:19 IDGSSGVVNPVMEPIY IDGSPGVVNPVMEPIY 252 528
HLA-DQA1*01:03/DQB1*06:09 IHTIDGSSGVVNPVMEPIY IHTIDGSPGVVNPVMEPIY 496 1036
HLA-DQA1*02:01/DQB1*03:01 VQIHTIDGSSGVVNPVMEPI VQIHTIDGSPGVVNPVMEPI 57 119
HLA-DQA1*02:01/DQB1*03:19 VQIHTIDGSSGVVNPVMEPI VQIHTIDGSPGVVNPVMEPI 57 119
HLA-DQA1*06:01/DQB1*03:01 TIDGSSGVVNPVMEPIYDEP TIDGSPGVVNPVMEPIYDEP 274 572
HLA-DQA1*06:01/DQB1*03:19 TIDGSSGVVNPVMEPIYDEP TIDGSPGVVNPVMEPIYDEP 274 572
HLA-DQA1*01:03/DQB1*06:09 TIDGSSGVVNPVMEPIYDEP TIDGSPGVVNPVMEPIYDEP 458 954
HLA-DQA1*02:01/DQB1*03:01 IHTIDGSSGVVNPVMEPI IHTIDGSPGVVNPVMEPI 170 354
HLA-DQA1*02:01/DQB1*03:19 IHTIDGSSGVVNPVMEPI IHTIDGSPGVVNPVMEPI 170 354
HLA-DQA1*02:01/DQB1*03:01 VQIHTIDGSSGVVNPVM VQIHTIDGSPGVVNPVM 63 130
HLA-DQA1*02:01/DQB1*03:19 VQIHTIDGSSGVVNPVM VQIHTIDGSPGVVNPVM 63 130
HLA-DQA1*01:02/DQB1*06:09 HVQIHTIDGSSGVVNPVME HVQIHTIDGSPGVVNPVME 464 956
HLA-DQA1*02:01/DQB1*03:01 IHTIDGSSGVVNPVME IHTIDGSPGVVNPVME 51 105
HLA-DQA1*02:01/DQB1*03:19 IHTIDGSSGVVNPVME IHTIDGSPGVVNPVME 51 105
HLA-DQA1*06:01/DQB1*03:01 IDGSSGVVNPVMEPIYDEP IDGSPGVVNPVMEPIYDEP 470 967
HLA-DQA1*06:01/DQB1*03:19 IDGSSGVVNPVMEPIYDEP IDGSPGVVNPVMEPIYDEP 470 967
HLA-DQA1*06:01/DQB1*03:01 IDGSSGVVNPVMEPIYD IDGSPGVVNPVMEPIYD 360 740
HLA-DQA1*06:01/DQB1*03:19 IDGSSGVVNPVMEPIYD IDGSPGVVNPVMEPIYD 360 740
HLA-DQA1*02:01/DQB1*03:03 IHTIDGSSGVVNPVMEP IHTIDGSPGVVNPVMEP 483 986
HLA-DQA1*02:01/DQB1*03:03 QIHTIDGSSGVVNPVMEPI QIHTIDGSPGVVNPVMEPI 437 891
HLA-DQA1*06:01/DQB1*03:01 IDGSSGVVNPVMEPI IDGSPGVVNPVMEPI 184 373
HLA-DQA1*06:01/DQB1*03:19 IDGSSGVVNPVMEPI IDGSPGVVNPVMEPI 184 373
HLA-DQA1*06:01/DQB1*03:01 TIDGSSGVVNPVMEPI TIDGSPGVVNPVMEPI 190 385
HLA-DQA1*06:01/DQB1*03:19 TIDGSSGVVNPVMEPI TIDGSPGVVNPVMEPI 190 385
HLA-DQA1*06:01/DQB1*03:01 HTIDGSSGVVNPVMEPIYD HTIDGSPGVVNPVMEPIYD 305 617
HLA-DQA1*06:01/DQB1*03:19 HTIDGSSGVVNPVMEPIYD HTIDGSPGVVNPVMEPIYD 305 617
HLA-DQA1*01:02/DQB1*06:09 VQIHTIDGSSGVVNPVMEPI VQIHTIDGSPGVVNPVMEPI 314 634
HLA-DQA1*02:01/DQB1*03:01 HVQIHTIDGSSGVVNPVMEP HVQIHTIDGSPGVVNPVMEP 58 117
HLA-DQA1*02:01/DQB1*03:19 HVQIHTIDGSSGVVNPVMEP HVQIHTIDGSPGVVNPVMEP 58 117
HLA-DQA1*02:01/DQB1*03:03 VQIHTIDGSSGVVNPVMEPI VQIHTIDGSPGVVNPVMEPI 304 612
HLA-DQA1*02:01/DQB1*03:01 VQIHTIDGSSGVVNPVMEP VQIHTIDGSPGVVNPVMEP 78 157
HLA-DQA1*02:01/DQB1*03:19 VQIHTIDGSSGVVNPVMEP VQIHTIDGSPGVVNPVMEP 78 157
HLA-DQA1*01:02/DQB1*06:09 DGSSGVVNPVMEPIYD DGSPGVVNPVMEPIYD 457 919
HLA-DQA1*01:02/DQB1*06:09 IHTIDGSSGVVNPVMEPIYD IHTIDGSPGVVNPVMEPIYD 326 654
HLA-DQA1*06:01/DQB1*03:01 TIDGSSGVVNPVMEPIY TIDGSPGVVNPVMEPIY 272 545
HLA-DQA1*06:01/DQB1*03:19 TIDGSSGVVNPVMEPIY TIDGSPGVVNPVMEPIY 272 545
HLA-DQA1*01:02/DQB1*06:01 IDGSSGVVNPVMEPI IDGSPGVVNPVMEPI 298 597
HLA-DQA1*02:01/DQB1*03:01 HTIDGSSGVVNPVME HTIDGSPGVVNPVME 41 82
HLA-DQA1*02:01/DQB1*03:19 HTIDGSSGVVNPVME HTIDGSPGVVNPVME 41 82
HLA-DQA1*01:02/DQB1*06:09 TIDGSSGVVNPVMEPIYDEP TIDGSPGVVNPVMEPIYDEP 352 704

NS8 protein

NS8

E92K

Reference  SKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SKSPIQYIDIGNYTVSCLPFTINCQKPKLGSLVVRCSFYEDFLEYHDVRVV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:04 LPFTINCQEPKLGSL LPFTINCQKPKLGSL 1051 320
HLA-DRB1*11:04 PFTINCQEPKLGSLV PFTINCQKPKLGSLV 1012 313
HLA-DRB1*11:04 CLPFTINCQEPKLGS CLPFTINCQKPKLGS 1420 453
HLA-DRB1*11:04 FTINCQEPKLGSLVV FTINCQKPKLGSLVV 1164 411
HLA-DRB1*11:02 FTINCQEPKLGSLVV FTINCQKPKLGSLVV 900 383
HLA-DRB1*13:01 FTINCQEPKLGSLVV FTINCQKPKLGSLVV 900 383
HLA-DRB1*11:02 LPFTINCQEPKLGSL LPFTINCQKPKLGSL 756 323
HLA-DRB1*13:01 LPFTINCQEPKLGSL LPFTINCQKPKLGSL 756 323
HLA-DRB1*11:02 PFTINCQEPKLGSLV PFTINCQKPKLGSLV 753 332
HLA-DRB1*13:01 PFTINCQEPKLGSLV PFTINCQKPKLGSLV 753 332
HLA-DRB1*11:02 CLPFTINCQEPKLGS CLPFTINCQKPKLGS 995 439
HLA-DRB1*13:01 CLPFTINCQEPKLGS CLPFTINCQKPKLGS 995 439
HLA-DRB1*01:01 TINCQEPKLGSLVVR TINCQKPKLGSLVVR 493 245
HLA-DRB1*11:04 PFTINCQEPKLGSLVVRCSF PFTINCQKPKLGSLVVRCSF 976 487

NS9b protein

NS9b

Q77E

Reference  LSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK
           ||||||||||||||||||||||||| ||||||||||||||||||||
Mutated    LSLNMARKTLNSLEDKAFQLTPIAVEMTKLATTEELPDEFVVVTVK

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:01 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 128 618
HLA-DRB1*11:01 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 242 1111
HLA-DRB1*11:01 LEDKAFQLTPIAVQMTK LEDKAFQLTPIAVEMTK 242 1076
HLA-DRB1*11:01 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 324 1415
HLA-DRB1*11:01 EDKAFQLTPIAVQMTKL EDKAFQLTPIAVEMTKL 221 875
HLA-DRB1*11:01 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 115 455
HLA-DRB1*11:01 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 304 1202
HLA-DRB1*11:01 LEDKAFQLTPIAVQM LEDKAFQLTPIAVEM 360 1420
HLA-DRB1*11:01 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 179 660
HLA-DRB1*11:01 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 247 907
HLA-DRB1*11:01 NSLEDKAFQLTPIAVQMTK NSLEDKAFQLTPIAVEMTK 456 1644
HLA-DRB1*15:01 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 201 694
HLA-DRB1*11:02 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 148 508
HLA-DRB1*13:01 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 148 508
HLA-DRB1*11:01 LEDKAFQLTPIAVQMTKLA LEDKAFQLTPIAVEMTKLA 327 1119
HLA-DRB1*11:01 SLEDKAFQLTPIAVQMTKL SLEDKAFQLTPIAVEMTKL 403 1376
HLA-DRB1*11:02 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 107 365
HLA-DRB1*13:01 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 107 365
HLA-DRB1*11:02 PIAVQMTKLATTEELPD PIAVEMTKLATTEELPD 427 1452
HLA-DRB1*13:01 PIAVQMTKLATTEELPD PIAVEMTKLATTEELPD 427 1452
HLA-DRB1*11:02 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 166 563
HLA-DRB1*13:01 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 166 563
HLA-DRB1*11:02 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 293 992
HLA-DRB1*13:01 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 293 992
HLA-DRB1*11:01 LNSLEDKAFQLTPIAVQMTK LNSLEDKAFQLTPIAVEMTK 238 800
HLA-DRB1*11:01 EDKAFQLTPIAVQMTKLAT EDKAFQLTPIAVEMTKLAT 304 1020
HLA-DRB1*11:02 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 199 666
HLA-DRB1*13:01 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 199 666
HLA-DRB1*15:01 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 118 394
HLA-DRB1*11:02 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 134 447
HLA-DRB1*13:01 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 134 447
HLA-DRB1*11:01 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 165 542
HLA-DRB1*11:02 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 123 402
HLA-DRB1*13:01 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 123 402
HLA-DRB1*15:01 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 209 682
HLA-DRB1*15:01 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 259 845
HLA-DRB1*11:02 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 73 238
HLA-DRB1*13:01 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 73 238
HLA-DRB1*11:02 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 60 195
HLA-DRB1*13:01 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 60 195
HLA-DRB1*11:02 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 133 431
HLA-DRB1*13:01 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 133 431
HLA-DRB1*15:01 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 258 835
HLA-DRB1*11:01 NSLEDKAFQLTPIAVQMTKL NSLEDKAFQLTPIAVEMTKL 214 692
HLA-DRB1*08:04 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 121 390
HLA-DRB1*08:04 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 106 341
HLA-DRB1*11:01 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 162 520
HLA-DRB1*15:01 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 310 995
HLA-DRB1*11:02 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 337 1079
HLA-DRB1*13:01 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 337 1079
HLA-DRB1*11:02 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 227 725
HLA-DRB1*13:01 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 227 725
HLA-DRB1*11:02 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 181 578
HLA-DRB1*13:01 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 181 578
HLA-DRB1*15:01 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 436 1392
HLA-DRB1*15:01 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 320 1020
HLA-DRB1*11:02 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 353 1125
HLA-DRB1*13:01 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 353 1125
HLA-DRB1*11:01 SLEDKAFQLTPIAVQMTKLA SLEDKAFQLTPIAVEMTKLA 181 575
HLA-DRB1*11:02 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 273 865
HLA-DRB1*13:01 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 273 865
HLA-DRB1*04:02 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 149 470
HLA-DRB1*11:01 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 285 895
HLA-DRB1*11:02 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 384 1205
HLA-DRB1*13:01 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 384 1205
HLA-DRB1*11:04 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 207 648
HLA-DRB1*15:01 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 166 519
HLA-DRB1*08:04 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 172 537
HLA-DRB1*11:04 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 167 521
HLA-DRB1*11:02 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 177 552
HLA-DRB1*13:01 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 177 552
HLA-DRB1*15:01 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 201 623
HLA-DRB1*08:04 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 139 430
HLA-DRB1*15:01 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 99 306
HLA-DRB1*11:02 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 223 687
HLA-DRB1*13:01 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 223 687
HLA-DRB1*08:04 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 83 255
HLA-DRB1*04:02 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 153 470
HLA-DRB1*11:02 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 226 693
HLA-DRB1*13:01 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 226 693
HLA-DRB1*11:04 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 349 1070
HLA-DRB1*11:02 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 195 597
HLA-DRB1*13:01 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 195 597
HLA-DRB1*08:04 PIAVQMTKLATTEELPD PIAVEMTKLATTEELPD 271 829
HLA-DRB1*11:02 LTPIAVQMTKLATTEELPD LTPIAVEMTKLATTEELPD 437 1336
HLA-DRB1*13:01 LTPIAVQMTKLATTEELPD LTPIAVEMTKLATTEELPD 437 1336
HLA-DRB1*04:02 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 223 680
HLA-DRB1*04:02 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 346 1054
HLA-DRB1*08:04 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 88 268
HLA-DRB1*04:02 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 270 822
HLA-DRB1*11:02 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 234 711
HLA-DRB1*13:01 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 234 711
HLA-DRB1*11:02 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 277 841
HLA-DRB1*13:01 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 277 841
HLA-DRB1*15:01 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 144 437
HLA-DRB1*11:02 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 213 646
HLA-DRB1*13:01 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 213 646
HLA-DRB1*11:02 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 63 191
HLA-DRB1*13:01 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 63 191
HLA-DRB1*08:04 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 161 488
HLA-DRB1*11:04 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 166 502
HLA-DRB1*04:02 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 317 957
HLA-DRB1*11:04 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 116 350
HLA-DRB1*04:02 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 445 1341
HLA-DRB1*11:01 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 150 452
HLA-DRB1*08:04 TPIAVQMTKLATTEELPDE TPIAVEMTKLATTEELPDE 327 983
HLA-DRB1*15:01 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 260 781
HLA-DRB1*08:04 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 77 231
HLA-DRB1*04:02 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 314 942
HLA-DRB1*08:02 SLEDKAFQLTPIAVQMT SLEDKAFQLTPIAVEMT 328 982
HLA-DRB1*08:04 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 113 338
HLA-DRB1*11:02 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 183 547
HLA-DRB1*13:01 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 183 547
HLA-DRB1*11:02 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 267 798
HLA-DRB1*13:01 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 267 798
HLA-DRB1*11:04 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 140 418
HLA-DRB1*08:04 DKAFQLTPIAVQMTKLAT DKAFQLTPIAVEMTKLAT 384 1145
HLA-DRB1*11:01 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 300 891
HLA-DQA1*01:03/DQB1*06:02 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 95 282
HLA-DRB1*08:04 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 118 350
HLA-DRB1*08:02 LEDKAFQLTPIAVQMTKL LEDKAFQLTPIAVEMTKL 440 1304
HLA-DRB1*08:04 KAFQLTPIAVQMTKLATT KAFQLTPIAVEMTKLATT 347 1028
HLA-DRB1*11:04 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 123 364
HLA-DRB1*08:02 LEDKAFQLTPIAVQMT LEDKAFQLTPIAVEMT 376 1112
HLA-DRB1*11:02 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 231 681
HLA-DRB1*13:01 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 231 681
HLA-DRB1*04:02 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 322 949
HLA-DRB1*08:04 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 207 609
HLA-DRB1*11:04 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 183 537
HLA-DRB1*11:04 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 115 337
HLA-DRB1*08:04 LTPIAVQMTKLATTEELPD LTPIAVEMTKLATTEELPD 249 728
HLA-DRB1*04:02 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 285 833
HLA-DRB1*08:04 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 113 330
HLA-DRB1*15:01 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 401 1168
HLA-DRB1*11:04 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 181 527
HLA-DRB1*15:01 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 169 492
HLA-DRB1*08:02 NSLEDKAFQLTPIAVQMTK NSLEDKAFQLTPIAVEMTK 281 818
HLA-DRB1*04:02 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 337 981
HLA-DRB1*15:01 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 215 625
HLA-DRB1*04:02 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 366 1063
HLA-DRB1*15:01 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 395 1147
HLA-DRB1*08:04 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 145 421
HLA-DRB1*08:04 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 133 386
HLA-DRB1*15:01 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 233 676
HLA-DRB1*15:01 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 94 272
HLA-DRB1*11:02 IAVQMTKLATTEELP IAVEMTKLATTEELP 338 978
HLA-DRB1*13:01 IAVQMTKLATTEELP IAVEMTKLATTEELP 338 978
HLA-DRB1*11:04 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 165 477
HLA-DRB1*15:01 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 213 615
HLA-DRB1*04:02 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 406 1172
HLA-DRB1*08:04 EDKAFQLTPIAVQMTKLA EDKAFQLTPIAVEMTKLA 498 1436
HLA-DRB1*11:04 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 206 593
HLA-DRB1*08:02 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 222 638
HLA-DRB1*04:02 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 358 1026
HLA-DRB1*08:04 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 219 627
HLA-DRB1*11:01 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 309 884
HLA-DRB1*11:02 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 79 226
HLA-DRB1*13:01 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 79 226
HLA-DRB1*08:02 DKAFQLTPIAVQMTKLAT DKAFQLTPIAVEMTKLAT 285 815
HLA-DRB1*04:02 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 164 468
HLA-DRB1*11:01 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 245 699
HLA-DQA1*01:03/DQB1*06:02 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 122 348
HLA-DRB1*08:04 PIAVQMTKLATTEELP PIAVEMTKLATTEELP 326 929
HLA-DQA1*01:03/DQB1*06:02 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 113 322
HLA-DRB1*11:02 EDKAFQLTPIAVQMTKLAT EDKAFQLTPIAVEMTKLAT 259 737
HLA-DRB1*13:01 EDKAFQLTPIAVQMTKLAT EDKAFQLTPIAVEMTKLAT 259 737
HLA-DRB1*11:01 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 273 776
HLA-DRB1*15:01 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 290 824
HLA-DRB1*08:04 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 143 406
HLA-DRB1*08:04 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 189 536
HLA-DRB1*15:01 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 309 875
HLA-DRB1*08:02 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 196 555
HLA-DRB1*08:02 LEDKAFQLTPIAVQM LEDKAFQLTPIAVEM 328 928
HLA-DRB1*08:04 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 151 427
HLA-DRB1*04:02 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 498 1408
HLA-DRB1*11:04 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 493 1393
HLA-DRB1*11:04 LEDKAFQLTPIAVQMTK LEDKAFQLTPIAVEMTK 339 957
HLA-DRB1*04:02 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 425 1199
HLA-DRB1*11:04 PIAVQMTKLATTEELPD PIAVEMTKLATTEELPD 351 990
HLA-DRB1*11:04 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 61 172
HLA-DRB1*08:04 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 171 482
HLA-DRB1*08:04 EDKAFQLTPIAVQMTKLAT EDKAFQLTPIAVEMTKLAT 169 476
HLA-DRB1*11:04 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 58 163
HLA-DRB1*08:02 LEDKAFQLTPIAVQMTK LEDKAFQLTPIAVEMTK 174 489
HLA-DRB1*08:04 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 146 410
HLA-DRB1*01:01 PIAVQMTKLATTEELP PIAVEMTKLATTEELP 228 640
HLA-DQA1*01:03/DQB1*06:02 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 119 334
HLA-DQA1*01:03/DQB1*06:02 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 124 348
HLA-DRB1*04:02 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 319 895
HLA-DRB1*04:02 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 322 903
HLA-DRB1*11:04 EDKAFQLTPIAVQMTKLAT EDKAFQLTPIAVEMTKLAT 282 790
HLA-DQA1*01:03/DQB1*06:02 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 120 336
HLA-DRB1*04:02 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 222 621
HLA-DRB1*11:04 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 256 716
HLA-DRB1*11:02 AFQLTPIAVQMTKLATTEEL AFQLTPIAVEMTKLATTEEL 158 441
HLA-DRB1*13:01 AFQLTPIAVQMTKLATTEEL AFQLTPIAVEMTKLATTEEL 158 441
HLA-DRB1*01:01 PIAVQMTKLATTEELPD PIAVEMTKLATTEELPD 198 552
HLA-DRB1*11:01 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 150 418
HLA-DRB1*11:01 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 288 802
HLA-DRB1*08:02 EDKAFQLTPIAVQMTKLA EDKAFQLTPIAVEMTKLA 325 904
HLA-DRB1*15:01 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 269 748
HLA-DQA1*01:03/DQB1*06:02 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 141 392
HLA-DRB1*11:04 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 267 742
HLA-DRB1*04:02 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 418 1159
HLA-DRB1*04:02 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 447 1239
HLA-DRB1*11:04 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 131 363
HLA-DQA1*01:03/DQB1*06:02 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 109 302
HLA-DRB1*11:01 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 126 349
HLA-DRB1*08:04 FQLTPIAVQMTKLATTEE FQLTPIAVEMTKLATTEE 440 1218
HLA-DRB1*11:04 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 160 442
HLA-DRB1*11:04 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 205 566
HLA-DRB1*04:02 AFQLTPIAVQMTKLATTEEL AFQLTPIAVEMTKLATTEEL 360 993
HLA-DRB1*11:01 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 165 455
HLA-DRB1*08:04 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 98 270
HLA-DRB1*08:04 AFQLTPIAVQMTKLATTE AFQLTPIAVEMTKLATTE 384 1057
HLA-DRB1*11:04 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 175 481
HLA-DRB1*08:04 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 62 170
HLA-DQA1*01:03/DQB1*06:02 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 142 389
HLA-DRB1*15:03 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 328 898
HLA-DRB1*11:01 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 335 917
HLA-DRB1*11:04 EDKAFQLTPIAVQMTKL EDKAFQLTPIAVEMTKL 262 717
HLA-DRB1*15:03 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 258 705
HLA-DRB1*08:04 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 132 360
HLA-DRB1*11:02 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 139 379
HLA-DRB1*13:01 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 139 379
HLA-DRB1*11:01 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 293 798
HLA-DRB1*08:04 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 83 226
HLA-DRB1*08:04 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 72 196
HLA-DQA1*01:03/DQB1*06:02 EDKAFQLTPIAVQMTKL EDKAFQLTPIAVEMTKL 146 397
HLA-DRB1*15:01 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 172 467
HLA-DQA1*01:03/DQB1*06:02 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 182 494
HLA-DRB1*08:02 KAFQLTPIAVQMTKLATT KAFQLTPIAVEMTKLATT 279 757
HLA-DRB1*11:04 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 361 979
HLA-DRB1*11:04 PIAVQMTKLATTEELP PIAVEMTKLATTEELP 441 1193
HLA-DRB1*11:04 LEDKAFQLTPIAVQMTKLA LEDKAFQLTPIAVEMTKLA 373 1009
HLA-DRB1*11:04 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 88 238
HLA-DRB1*15:01 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 257 695
HLA-DRB1*11:04 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 108 292
HLA-DRB1*08:04 LEDKAFQLTPIAVQMTK LEDKAFQLTPIAVEMTK 290 784
HLA-DRB1*01:01 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 118 319
HLA-DRB1*11:04 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 91 246
HLA-DRB1*08:04 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 74 200
HLA-DRB1*04:02 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 483 1305
HLA-DRB1*11:01 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 194 524
HLA-DRB1*15:03 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 415 1114
HLA-DRB1*08:04 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 85 228
HLA-DRB1*11:01 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 152 407
HLA-DRB1*08:04 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 139 372
HLA-DRB1*01:01 TPIAVQMTKLATTEELPDE TPIAVEMTKLATTEELPDE 225 602
HLA-DRB1*11:04 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 104 278
HLA-DRB1*15:03 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 263 703
HLA-DRB1*08:04 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 110 294
HLA-DRB1*08:04 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 112 299
HLA-DRB1*15:01 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 269 718
HLA-DRB1*08:02 LNSLEDKAFQLTPIAVQMTK LNSLEDKAFQLTPIAVEMTK 160 427
HLA-DRB1*11:04 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 299 797
HLA-DRB1*11:01 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 324 863
HLA-DRB1*08:02 SLEDKAFQLTPIAVQMTKL SLEDKAFQLTPIAVEMTKL 239 636
HLA-DRB1*11:01 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 282 750
HLA-DQA1*01:03/DQB1*06:02 LEDKAFQLTPIAVQMTK LEDKAFQLTPIAVEMTK 184 488
HLA-DRB1*11:04 LTPIAVQMTKLATTEELPD LTPIAVEMTKLATTEELPD 356 944
HLA-DRB1*08:04 EDKAFQLTPIAVQMTKL EDKAFQLTPIAVEMTKL 214 567
HLA-DRB1*04:02 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 376 996
HLA-DRB1*08:04 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 353 935
HLA-DRB1*11:02 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 142 376
HLA-DRB1*13:01 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 142 376
HLA-DQA1*01:03/DQB1*06:02 LEDKAFQLTPIAVQMTKLA LEDKAFQLTPIAVEMTKLA 159 421
HLA-DQA1*01:03/DQB1*06:02 DKAFQLTPIAVQMTKLAT DKAFQLTPIAVEMTKLAT 296 783
HLA-DQA1*01:03/DQB1*06:02 EDKAFQLTPIAVQMTKLAT EDKAFQLTPIAVEMTKLAT 159 420
HLA-DRB1*11:01 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 223 589
HLA-DRB1*08:04 PIAVQMTKLATTEELPDEFV PIAVEMTKLATTEELPDEFV 337 889
HLA-DRB1*15:03 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 395 1041
HLA-DRB1*08:04 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 93 245
HLA-DRB1*11:01 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 495 1302
HLA-DRB1*08:04 IAVQMTKLATTEELP IAVEMTKLATTEELP 335 881
HLA-DRB1*11:01 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 397 1043
HLA-DRB1*11:04 IAVQMTKLATTEELP IAVEMTKLATTEELP 281 737
HLA-DRB1*15:01 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 119 312
HLA-DRB1*11:02 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 153 401
HLA-DRB1*13:01 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 153 401
HLA-DRB1*11:04 PIAVQMTKLATTEELPDEFV PIAVEMTKLATTEELPDEFV 479 1255
HLA-DRB1*01:01 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 71 186
HLA-DRB1*11:04 TPIAVQMTKLATTEELPDE TPIAVEMTKLATTEELPDE 480 1257
HLA-DRB1*11:04 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 227 594
HLA-DRB1*08:02 PIAVQMTKLATTEELPD PIAVEMTKLATTEELPD 353 923
HLA-DRB1*08:04 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 163 426
HLA-DRB1*04:02 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 446 1164
HLA-DRB1*15:01 AFQLTPIAVQMTKLATTEEL AFQLTPIAVEMTKLATTEEL 151 393
HLA-DRB1*11:02 LEDKAFQLTPIAVQMTKLA LEDKAFQLTPIAVEMTKLA 313 814
HLA-DRB1*13:01 LEDKAFQLTPIAVQMTKLA LEDKAFQLTPIAVEMTKLA 313 814
HLA-DRB1*08:04 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 264 686
HLA-DQA1*04:01/DQB1*04:02 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 1009 389
HLA-DRB1*08:04 AFQLTPIAVQMTKLATTEEL AFQLTPIAVEMTKLATTEEL 96 249
HLA-DQA1*04:01/DQB1*04:02 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 1086 419
HLA-DRB1*08:04 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 61 158
HLA-DRB1*15:03 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 402 1041
HLA-DRB1*04:02 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 399 1033
HLA-DQA1*01:03/DQB1*06:02 SLEDKAFQLTPIAVQMTKL SLEDKAFQLTPIAVEMTKL 198 512
HLA-DRB1*08:04 LEDKAFQLTPIAVQMTKLA LEDKAFQLTPIAVEMTKLA 229 592
HLA-DRB1*01:01 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 136 351
HLA-DRB1*01:01 PIAVQMTKLATTEELPDEF PIAVEMTKLATTEELPDEF 400 1032
HLA-DQA1*01:03/DQB1*06:02 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 140 361
HLA-DRB1*11:04 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 71 183
HLA-DQA1*01:03/DQB1*06:02 EDKAFQLTPIAVQMTKLA EDKAFQLTPIAVEMTKLA 302 777
HLA-DRB1*11:01 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 137 352
HLA-DRB1*11:02 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 174 447
HLA-DRB1*13:01 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 174 447
HLA-DRB1*11:04 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 175 449
HLA-DRB1*11:04 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 207 531
HLA-DQA1*04:01/DQB1*04:02 LEDKAFQLTPIAVQMT LEDKAFQLTPIAVEMT 941 367
HLA-DQA1*01:03/DQB1*06:02 NSLEDKAFQLTPIAVQMTK NSLEDKAFQLTPIAVEMTK 247 633
HLA-DRB1*11:01 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 424 1085
HLA-DRB1*11:01 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 441 1127
HLA-DRB1*11:01 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 473 1208
HLA-DRB1*15:01 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 143 365
HLA-DRB1*01:01 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 68 173
HLA-DRB1*15:03 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 482 1222
HLA-DRB1*01:01 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 58 147
HLA-DRB1*08:02 EDKAFQLTPIAVQMTKL EDKAFQLTPIAVEMTKL 148 375
HLA-DRB1*11:01 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 240 608
HLA-DRB1*01:01 IAVQMTKLATTEELPDE IAVEMTKLATTEELPDE 434 1098
HLA-DRB1*15:01 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 144 364
HLA-DQA1*01:03/DQB1*06:02 KAFQLTPIAVQMTKLATT KAFQLTPIAVEMTKLATT 271 685
HLA-DRB1*11:02 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 445 1124
HLA-DRB1*13:01 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 445 1124
HLA-DRB1*08:02 TLNSLEDKAFQLTPIAVQMT TLNSLEDKAFQLTPIAVEMT 327 825
HLA-DRB1*08:02 NSLEDKAFQLTPIAVQMTKL NSLEDKAFQLTPIAVEMTKL 140 353
HLA-DQA1*01:03/DQB1*06:02 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 118 297
HLA-DRB1*01:01 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 60 151
HLA-DRB1*15:01 EDKAFQLTPIAVQMTKLAT EDKAFQLTPIAVEMTKLAT 316 795
HLA-DRB1*01:01 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 123 309
HLA-DRB1*08:04 SLEDKAFQLTPIAVQMTKLA SLEDKAFQLTPIAVEMTKLA 149 374
HLA-DRB1*11:04 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 255 640
HLA-DRB1*11:04 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 154 386
HLA-DRB1*01:01 IAVQMTKLATTEELP IAVEMTKLATTEELP 143 358
HLA-DRB1*01:01 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 86 215
HLA-DRB1*08:04 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 118 295
HLA-DRB1*11:01 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 362 905
HLA-DRB1*08:02 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 171 427
HLA-DQA1*01:03/DQB1*06:02 LEDKAFQLTPIAVQMTKL LEDKAFQLTPIAVEMTKL 372 928
HLA-DRB1*08:02 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 234 583
HLA-DRB1*11:04 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 229 570
HLA-DRB1*11:04 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 137 340
HLA-DQA1*01:03/DQB1*06:02 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 229 567
HLA-DRB1*11:04 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 120 296
HLA-DRB1*01:01 LTPIAVQMTKLATTEELPD LTPIAVEMTKLATTEELPD 147 362
HLA-DRB1*01:01 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 37 91
HLA-DRB1*11:01 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 302 741
HLA-DRB1*08:04 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 371 909
HLA-DRB1*11:02 LEDKAFQLTPIAVQMTK LEDKAFQLTPIAVEMTK 468 1146
HLA-DRB1*13:01 LEDKAFQLTPIAVQMTK LEDKAFQLTPIAVEMTK 468 1146
HLA-DRB1*11:02 EDKAFQLTPIAVQMTKL EDKAFQLTPIAVEMTKL 348 851
HLA-DRB1*13:01 EDKAFQLTPIAVQMTKL EDKAFQLTPIAVEMTKL 348 851
HLA-DRB1*08:02 EDKAFQLTPIAVQMTKLAT EDKAFQLTPIAVEMTKLAT 158 386
HLA-DRB1*11:02 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 134 327
HLA-DRB1*13:01 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 134 327
HLA-DRB1*08:04 NSLEDKAFQLTPIAVQMTK NSLEDKAFQLTPIAVEMTK 484 1181
HLA-DRB1*15:01 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 157 383
HLA-DRB1*11:01 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 196 477
HLA-DRB1*11:04 SLEDKAFQLTPIAVQMTKLA SLEDKAFQLTPIAVEMTKLA 233 567
HLA-DQA1*05:01/DQB1*02:01 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 1068 439
HLA-DQA1*05:01/DQB1*02:02 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 1068 439
HLA-DRB1*08:02 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 216 524
HLA-DRB1*11:02 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 188 456
HLA-DRB1*13:01 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 188 456
HLA-DRB1*08:02 AFQLTPIAVQMTKLATTE AFQLTPIAVEMTKLATTE 352 852
HLA-DRB1*08:02 FQLTPIAVQMTKLATTEE FQLTPIAVEMTKLATTEE 427 1033
HLA-DRB1*15:03 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 499 1206
HLA-DRB1*08:02 PIAVQMTKLATTEELP PIAVEMTKLATTEELP 388 937
HLA-DRB1*11:01 AFQLTPIAVQMTKLATTEEL AFQLTPIAVEMTKLATTEEL 205 495
HLA-DRB1*08:02 LEDKAFQLTPIAVQMTKLA LEDKAFQLTPIAVEMTKLA 182 439
HLA-DRB1*01:01 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 51 123
HLA-DRB1*08:02 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 166 400
HLA-DRB1*04:04 PIAVQMTKLATTEELPD PIAVEMTKLATTEELPD 162 390
HLA-DRB1*15:01 EDKAFQLTPIAVQMTKL EDKAFQLTPIAVEMTKL 392 942
HLA-DRB1*11:01 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 167 401
HLA-DRB1*04:01 LEDKAFQLTPIAVQM LEDKAFQLTPIAVEM 133 319
HLA-DRB1*01:01 AFQLTPIAVQMTKLATTE AFQLTPIAVEMTKLATTE 256 614
HLA-DQA1*04:01/DQB1*04:02 SLEDKAFQLTPIAVQM SLEDKAFQLTPIAVEM 1011 422
HLA-DRB1*08:02 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 126 301
HLA-DRB1*08:02 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 121 289
HLA-DRB1*11:04 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 122 291
HLA-DRB1*08:02 DKAFQLTPIAVQMTKLATT DKAFQLTPIAVEMTKLATT 148 352
HLA-DRB1*08:02 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 146 347
HLA-DRB1*08:02 KAFQLTPIAVQMTKLAT KAFQLTPIAVEMTKLAT 96 228
HLA-DRB1*11:04 AFQLTPIAVQMTKLATTEEL AFQLTPIAVEMTKLATTEEL 136 323
HLA-DRB1*01:01 FQLTPIAVQMTKLATTEE FQLTPIAVEMTKLATTEE 313 742
HLA-DQA1*01:03/DQB1*06:02 SLEDKAFQLTPIAVQMTK SLEDKAFQLTPIAVEMTK 471 1115
HLA-DRB1*08:02 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 96 227
HLA-DRB1*08:02 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 267 631
HLA-DQA1*01:03/DQB1*06:02 LEDKAFQLTPIAVQMT LEDKAFQLTPIAVEMT 304 718
HLA-DRB1*08:02 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 172 406
HLA-DRB1*01:01 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 50 118
HLA-DQA1*05:01/DQB1*02:01 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 1050 445
HLA-DQA1*05:01/DQB1*02:02 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 1050 445
HLA-DRB1*08:04 SLEDKAFQLTPIAVQMTKL SLEDKAFQLTPIAVEMTKL 372 876
HLA-DRB1*11:02 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 347 816
HLA-DRB1*13:01 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 347 816
HLA-DRB1*08:02 DKAFQLTPIAVQMTKLA DKAFQLTPIAVEMTKLA 112 263
HLA-DQA1*05:01/DQB1*02:01 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 1067 455
HLA-DQA1*05:01/DQB1*02:02 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 1067 455
HLA-DRB1*01:01 KAFQLTPIAVQMTKLATT KAFQLTPIAVEMTKLATT 221 518
HLA-DQA1*01:03/DQB1*06:02 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 138 323
HLA-DRB1*04:04 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 50 117
HLA-DRB1*08:02 TPIAVQMTKLATTEELPDE TPIAVEMTKLATTEELPDE 402 940
HLA-DRB1*08:04 LNSLEDKAFQLTPIAVQMTK LNSLEDKAFQLTPIAVEMTK 284 664
HLA-DRB1*01:01 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 45 105
HLA-DRB1*01:01 QLTPIAVQMTKLATTEEL QLTPIAVEMTKLATTEEL 457 1065
HLA-DRB1*11:02 SLEDKAFQLTPIAVQMTKLA SLEDKAFQLTPIAVEMTKLA 212 494
HLA-DRB1*13:01 SLEDKAFQLTPIAVQMTKLA SLEDKAFQLTPIAVEMTKLA 212 494
HLA-DRB1*04:01 SLEDKAFQLTPIAVQMTK SLEDKAFQLTPIAVEMTK 447 1041
HLA-DRB1*16:01 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 298 693
HLA-DRB1*01:01 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 87 202
HLA-DRB1*08:02 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 199 462
HLA-DRB1*04:01 EDKAFQLTPIAVQMT EDKAFQLTPIAVEMT 103 239
HLA-DRB1*04:01 LEDKAFQLTPIAVQMT LEDKAFQLTPIAVEMT 241 559
HLA-DRB1*04:04 PIAVQMTKLATTEELPDEFV PIAVEMTKLATTEELPDEFV 264 612
HLA-DRB1*15:01 LEDKAFQLTPIAVQMTKLA LEDKAFQLTPIAVEMTKLA 382 880
HLA-DRB1*04:04 PIAVQMTKLATTEELP PIAVEMTKLATTEELP 178 410
HLA-DRB1*08:02 PIAVQMTKLATTEELPDEFV PIAVEMTKLATTEELPDEFV 372 856
HLA-DRB1*01:01 PIAVQMTKLATTEELPDEFV PIAVEMTKLATTEELPDEFV 223 513
HLA-DQA1*01:03/DQB1*06:02 SLEDKAFQLTPIAVQMT SLEDKAFQLTPIAVEMT 320 736
HLA-DRB1*04:04 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 84 193
HLA-DRB1*08:02 LTPIAVQMTKLATTEELPD LTPIAVEMTKLATTEELPD 296 680
HLA-DRB1*15:01 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 310 711
HLA-DRB1*15:01 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 176 403
HLA-DRB1*01:01 DKAFQLTPIAVQMTKLAT DKAFQLTPIAVEMTKLAT 249 569
HLA-DRB1*04:01 EDKAFQLTPIAVQMTK EDKAFQLTPIAVEMTK 152 347
HLA-DRB1*01:01 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 39 89
HLA-DQA1*01:03/DQB1*06:02 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 136 310
HLA-DRB1*11:04 LNSLEDKAFQLTPIAVQMTK LNSLEDKAFQLTPIAVEMTK 407 927
HLA-DRB1*08:04 NSLEDKAFQLTPIAVQMTKL NSLEDKAFQLTPIAVEMTKL 235 535
HLA-DQA1*01:03/DQB1*06:02 LNSLEDKAFQLTPIAVQMTK LNSLEDKAFQLTPIAVEMTK 164 373
HLA-DRB1*08:02 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 175 398
HLA-DRB1*04:01 LEDKAFQLTPIAVQMTKL LEDKAFQLTPIAVEMTKL 388 880
HLA-DRB1*08:02 SLEDKAFQLTPIAVQMTKLA SLEDKAFQLTPIAVEMTKLA 112 254
HLA-DQA1*05:01/DQB1*02:01 LEDKAFQLTPIAVQMT LEDKAFQLTPIAVEMT 927 409
HLA-DQA1*05:01/DQB1*02:02 LEDKAFQLTPIAVQMT LEDKAFQLTPIAVEMT 927 409
HLA-DRB1*10:01 PIAVQMTKLATTEELPD PIAVEMTKLATTEELPD 144 326
HLA-DRB1*15:01 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 205 464
HLA-DRB1*16:01 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 489 1106
HLA-DRB1*01:02 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 283 640
HLA-DRB1*04:04 LTPIAVQMTKLATTEELPD LTPIAVEMTKLATTEELPD 100 226
HLA-DRB1*04:04 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 74 167
HLA-DRB1*01:01 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 117 264
HLA-DRB1*08:02 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 90 203
HLA-DRB1*08:02 KAFQLTPIAVQMTKLATTE KAFQLTPIAVEMTKLATTE 150 338
HLA-DRB1*04:04 TPIAVQMTKLATTEELPDEF TPIAVEMTKLATTEELPDEF 119 268
HLA-DQA1*01:03/DQB1*06:02 SLEDKAFQLTPIAVQMTKLA SLEDKAFQLTPIAVEMTKLA 110 247
HLA-DQA1*01:03/DQB1*06:02 LEDKAFQLTPIAVQMTKLAT LEDKAFQLTPIAVEMTKLAT 110 247
HLA-DQA1*01:03/DQB1*06:02 NSLEDKAFQLTPIAVQMTKL NSLEDKAFQLTPIAVEMTKL 137 307
HLA-DRB1*04:04 PIAVQMTKLATTEELPDEF PIAVEMTKLATTEELPDEF 366 820
HLA-DQA1*03:01/DQB1*03:02 LEDKAFQLTPIAVQMT LEDKAFQLTPIAVEMT 1075 480
HLA-DRB1*08:02 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 249 557
HLA-DRB1*04:04 LTPIAVQMTKLATTEE LTPIAVEMTKLATTEE 60 134
HLA-DRB1*04:04 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 43 96
HLA-DRB1*01:01 EDKAFQLTPIAVQMTKLA EDKAFQLTPIAVEMTKLA 269 600
HLA-DQA1*01:03/DQB1*06:02 AFQLTPIAVQMTKLATTE AFQLTPIAVEMTKLATTE 285 635
HLA-DRB1*16:01 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 337 750
HLA-DQA1*01:03/DQB1*06:02 EDKAFQLTPIAVQMTKLATT EDKAFQLTPIAVEMTKLATT 99 220
HLA-DRB1*08:02 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 147 326
HLA-DRB1*16:01 FQLTPIAVQMTKLAT FQLTPIAVEMTKLAT 277 614
HLA-DQA1*04:01/DQB1*04:02 NSLEDKAFQLTPIAVQ NSLEDKAFQLTPIAVE 1037 468
HLA-DRB1*11:04 NSLEDKAFQLTPIAVQMTKL NSLEDKAFQLTPIAVEMTKL 340 753
HLA-DRB1*04:04 TPIAVQMTKLATTEELPDE TPIAVEMTKLATTEELPDE 168 372
HLA-DRB1*04:04 QLTPIAVQMTKLATTEELP QLTPIAVEMTKLATTEELP 82 181
HLA-DRB1*01:02 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 240 529
HLA-DRB1*15:03 AFQLTPIAVQMTKLATTEEL AFQLTPIAVEMTKLATTEEL 464 1022
HLA-DRB1*01:01 LTPIAVQMTKLATTE LTPIAVEMTKLATTE 25 55
HLA-DRB1*08:02 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 130 286
HLA-DQA1*01:03/DQB1*06:02 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 151 332
HLA-DRB1*08:02 PIAVQMTKLATTEEL PIAVEMTKLATTEEL 228 501
HLA-DRB1*01:02 LTPIAVQMTKLATTEELPD LTPIAVEMTKLATTEELPD 362 795
HLA-DRB1*04:01 SLEDKAFQLTPIAVQMT SLEDKAFQLTPIAVEMT 210 460
HLA-DRB1*04:04 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 97 212
HLA-DRB1*01:02 QLTPIAVQMTKLATTEE QLTPIAVEMTKLATTEE 148 323
HLA-DQA1*01:03/DQB1*06:02 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 138 301
HLA-DRB1*04:04 LTPIAVQMTKLATTEELP LTPIAVEMTKLATTEELP 271 590
HLA-DRB1*08:02 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 86 187
HLA-DRB1*01:01 AFQLTPIAVQMTKLATTEE AFQLTPIAVEMTKLATTEE 69 150
HLA-DRB1*04:04 QLTPIAVQMTKLATTEEL QLTPIAVEMTKLATTEEL 225 487
HLA-DRB1*01:02 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 223 482
HLA-DRB1*04:01 SLEDKAFQLTPIAVQM SLEDKAFQLTPIAVEM 342 739
HLA-DRB1*04:04 QLTPIAVQMTKLATTE QLTPIAVEMTKLATTE 52 112
HLA-DRB1*10:01 TPIAVQMTKLATTEELP TPIAVEMTKLATTEELP 100 215
HLA-DRB1*04:04 FQLTPIAVQMTKLATTEE FQLTPIAVEMTKLATTEE 177 380
HLA-DRB1*08:02 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 124 266
HLA-DRB1*08:02 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 106 227
HLA-DRB1*10:01 PIAVQMTKLATTEELP PIAVEMTKLATTEELP 157 336
HLA-DRB1*08:02 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 210 449
HLA-DRB1*08:02 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 129 275
HLA-DRB1*01:02 LTPIAVQMTKLATTEELPDE LTPIAVEMTKLATTEELPDE 316 673
HLA-DRB1*04:04 DKAFQLTPIAVQMTKLAT DKAFQLTPIAVEMTKLAT 171 364
HLA-DRB1*01:01 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 87 185
HLA-DRB1*15:03 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 405 861
HLA-DRB1*04:04 KAFQLTPIAVQMTKLATT KAFQLTPIAVEMTKLATT 143 304
HLA-DRB1*01:02 LTPIAVQMTKLATTEEL LTPIAVEMTKLATTEEL 183 389
HLA-DRB1*16:01 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 426 905
HLA-DQA1*01:03/DQB1*06:03 AFQLTPIAVQMTKLAT AFQLTPIAVEMTKLAT 448 951
HLA-DQA1*01:03/DQB1*06:02 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 182 386
HLA-DRB1*01:02 FQLTPIAVQMTKLATTEELP FQLTPIAVEMTKLATTEELP 184 390
HLA-DQA1*01:03/DQB1*06:03 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA 410 869
HLA-DRB1*01:02 AFQLTPIAVQMTKLA AFQLTPIAVEMTKLA 67 142
HLA-DRB1*04:04 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 60 127
HLA-DRB1*01:02 AFQLTPIAVQMTKLATT AFQLTPIAVEMTKLATT 120 254
HLA-DRB1*04:04 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 43 91
HLA-DRB1*04:01 DKAFQLTPIAVQMTKL DKAFQLTPIAVEMTKL 139 294
HLA-DRB1*04:01 LEDKAFQLTPIAVQMTK LEDKAFQLTPIAVEMTK 131 277
HLA-DRB1*04:01 NSLEDKAFQLTPIAVQM NSLEDKAFQLTPIAVEM 299 632
HLA-DRB1*10:01 TPIAVQMTKLATTEEL TPIAVEMTKLATTEEL 116 245
HLA-DRB1*04:01 EDKAFQLTPIAVQMTKLA EDKAFQLTPIAVEMTKLA 337 711
HLA-DQA1*01:03/DQB1*06:02 FQLTPIAVQMTKLATTEE FQLTPIAVEMTKLATTEE 330 695
HLA-DRB1*08:02 TPIAVQMTKLATTEE TPIAVEMTKLATTEE 161 339
HLA-DQA1*01:03/DQB1*06:02 DKAFQLTPIAVQMTKLATTE DKAFQLTPIAVEMTKLATTE 97 204
HLA-DRB1*01:01 QLTPIAVQMTKLATTEELPD QLTPIAVEMTKLATTEELPD 69 145
HLA-DRB1*15:03 KAFQLTPIAVQMTKL KAFQLTPIAVEMTKL 410 861
HLA-DRB1*04:01 DKAFQLTPIAVQMTK DKAFQLTPIAVEMTK 71 149
HLA-DRB1*08:02 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 92 193
HLA-DQA1*01:03/DQB1*06:02 FQLTPIAVQMTKLATTEEL FQLTPIAVEMTKLATTEEL 181 379
HLA-DRB1*10:01 TPIAVQMTKLATTEELPD TPIAVEMTKLATTEELPD 484 1013
HLA-DQA1*01:03/DQB1*06:02 LNSLEDKAFQLTPIAVQMT LNSLEDKAFQLTPIAVEMT 487 1018
HLA-DRB1*01:02 FQLTPIAVQMTKLATTE FQLTPIAVEMTKLATTE 122 255
HLA-DRB1*08:02 FQLTPIAVQMTKLATT FQLTPIAVEMTKLATT 147 307
HLA-DRB1*15:03 KAFQLTPIAVQMTKLATTEE KAFQLTPIAVEMTKLATTEE 410 856
HLA-DRB1*12:02 QLTPIAVQMTKLATT QLTPIAVEMTKLATT 453 945
HLA-DRB1*04:01 NSLEDKAFQLTPIAVQMTK NSLEDKAFQLTPIAVEMTK 192 400
HLA-DRB1*10:01 PIAVQMTKLATTEELPDEF PIAVEMTKLATTEELPDEF 260 540
HLA-DRB1*01:01 KAFQLTPIAVQMTKLA KAFQLTPIAVEMTKLA