Summary

This strain contains 11 protein-level mutations:

  • 3 mutations in Spike protein: E484K, D614G, V1176F
  • 4 mutations in N protein: A119S, 203-204 RG->KR, M234I, G238C
  • 1 mutation in NS9c protein: G50N
  • 1 mutation in NSP5 protein: L205V
  • 1 mutation in NSP7 protein: L71F
  • 1 mutation in NSP12 protein: P323L

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 533 192
HLA-DRB1*01:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 521 192
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 328 123
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 889 335
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTE NTSNQVAVLYQGVNCTE 281 107
HLA-DQA1*01:02/DQB1*06:02 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 677 258
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 243 93
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 227 87
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 130 50
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 403 155
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 136 53
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 228 89
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 176 69
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 181 71
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 150 59
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 167 66
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 200 80
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQD TPGTNTSNQVAVLYQG 276 112
HLA-DRB1*01:01 VAVLYQDVNCTEVPV VAVLYQGVNCTEVPV 347 141
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEV NTSNQVAVLYQGVNCTEV 639 263
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDVN GTNTSNQVAVLYQGVN 413 170
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVN TPGTNTSNQVAVLYQGVN 376 155
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQD ITPGTNTSNQVAVLYQG 339 140
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVA QVAVLYQGVNCTEVPVA 814 340
HLA-DRB1*01:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 867 365
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDV ITPGTNTSNQVAVLYQGV 435 184
HLA-DQA1*01:02/DQB1*06:02 ITPGTNTSNQVAVLYQDVN ITPGTNTSNQVAVLYQGVN 229 97
HLA-DQA1*01:03/DQB1*06:02 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 960 408
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPV NQVAVLYQGVNCTEVPV 799 340
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 176 75
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCT TNTSNQVAVLYQGVNCT 211 90
HLA-DRB1*01:01 VAVLYQDVNCTEVPVAI VAVLYQGVNCTEVPVAI 996 428
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVN TNTSNQVAVLYQGVN 292 126
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNC NTSNQVAVLYQGVNC 417 181
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVP SNQVAVLYQGVNCTEVP 852 370
HLA-DQA1*01:03/DQB1*06:02 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 312 136
HLA-DRB1*01:01 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 699 305
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNC GTNTSNQVAVLYQGVNC 197 86
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVP NTSNQVAVLYQGVNCTEVP 412 180
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVP TSNQVAVLYQGVNCTEVP 908 399
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDV PGTNTSNQVAVLYQGV 450 198
HLA-DRB1*01:01 QVAVLYQDVNCTEVP QVAVLYQGVNCTEVP 285 126
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCT TSNQVAVLYQGVNCT 530 235
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDVN VITPGTNTSNQVAVLYQGVN 189 84
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQDV VITPGTNTSNQVAVLYQGV 270 121
HLA-DRB1*01:01 SNQVAVLYQDVNCTE SNQVAVLYQGVNCTE 450 202
HLA-DQA1*01:03/DQB1*06:02 NTSNQVAVLYQDVNCT NTSNQVAVLYQGVNCT 597 268
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTE TSNQVAVLYQGVNCTE 838 380
HLA-DRB1*01:01 VAVLYQDVNCTEVPVA VAVLYQGVNCTEVPVA 1017 462
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 801 365
HLA-DRB1*10:01 VLYQDVNCTEVPVAI VLYQGVNCTEVPVAI 910 416
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVA SNQVAVLYQGVNCTEVPVA 979 449
HLA-DQA1*01:02/DQB1*06:02 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 365 168
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQDVN PGTNTSNQVAVLYQGVN 447 206
HLA-DQA1*01:02/DQB1*06:02 PGTNTSNQVAVLYQDVNC PGTNTSNQVAVLYQGVNC 425 196
HLA-DQA1*01:03/DQB1*06:02 PGTNTSNQVAVLYQD PGTNTSNQVAVLYQG 471 218
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTE TNTSNQVAVLYQGVNCTE 477 221
HLA-DRB1*01:01 QVAVLYQDVNCTEVPV QVAVLYQGVNCTEVPV 855 397
HLA-DRB1*01:01 NQVAVLYQDVNCTEV NQVAVLYQGVNCTEV 253 118
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPVA TSNQVAVLYQGVNCTEVPVA 488 228
HLA-DQA1*01:02/DQB1*06:02 GTNTSNQVAVLYQDVNCT GTNTSNQVAVLYQGVNCT 436 204
HLA-DQA1*02:01/DQB1*03:01 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DQA1*02:01/DQB1*03:19 AVLYQDVNCTEVPVA AVLYQGVNCTEVPVA 1049 491
HLA-DRB1*01:01 NQVAVLYQDVNCTEVP NQVAVLYQGVNCTEVP 887 416
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAI NQVAVLYQGVNCTEVPVAI 991 467
HLA-DRB1*01:01 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 984 467
HLA-DQA1*01:03/DQB1*06:02 TNTSNQVAVLYQDVNC TNTSNQVAVLYQGVNC 485 231
HLA-DQA1*01:02/DQB1*06:02 TSNQVAVLYQDVNCTEVPV TSNQVAVLYQGVNCTEVPV 641 306
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIH QVAVLYQGVNCTEVPVAIH 1021 488
HLA-DPA1*03:01/DPB1*04:01 GTNTSNQVAVLYQDV GTNTSNQVAVLYQGV 307 635
HLA-DRB1*01:01 SNQVAVLYQDVNCTEV SNQVAVLYQGVNCTEV 850 411
HLA-DRB1*01:01 NTSNQVAVLYQDVNCTEVPV NTSNQVAVLYQGVNCTEVPV 502 243
HLA-DRB1*01:01 SNQVAVLYQDVNCTEVPVAI SNQVAVLYQGVNCTEVPVAI 481 235
HLA-DQA1*01:02/DQB1*06:02 SVITPGTNTSNQVAVLYQDV SVITPGTNTSNQVAVLYQGV 231 113
HLA-DRB1*01:01 NQVAVLYQDVNCTEVPVAIH NQVAVLYQGVNCTEVPVAIH 483 237
HLA-DQA1*01:03/DQB1*06:02 TSNQVAVLYQDVNCTEV TSNQVAVLYQGVNCTEV 936 460
HLA-DQA1*01:03/DQB1*06:02 TPGTNTSNQVAVLYQDV TPGTNTSNQVAVLYQGV 493 243
HLA-DQA1*01:02/DQB1*06:02 TNTSNQVAVLYQDVNCTEV TNTSNQVAVLYQGVNCTEV 298 147
HLA-DQA1*01:02/DQB1*06:02 TPGTNTSNQVAVLYQDVNC TPGTNTSNQVAVLYQGVNC 254 126
HLA-DQA1*01:02/DQB1*06:02 VITPGTNTSNQVAVLYQD VITPGTNTSNQVAVLYQG 681 338
HLA-DRB1*01:01 TNTSNQVAVLYQDVNCTEVP TNTSNQVAVLYQGVNCTEVP 523 260
HLA-DRB1*01:01 QVAVLYQDVNCTEVPVAIHA QVAVLYQGVNCTEVPVAIHA 502 251

V1176F

Reference  ELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ELDKYFKNHTSPDVDLGDISGINASFVNIQKEIDRLNEVAKNLNESLIDLQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:01 ASVVNIQKEIDRLNE ASFVNIQKEIDRLNE 1675 185
HLA-DRB1*11:01 SVVNIQKEIDRLNEV SFVNIQKEIDRLNEV 2234 292
HLA-DRB1*11:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 1315 180
HLA-DRB1*11:01 SGINASVVNIQKEIDRLNEV SGINASFVNIQKEIDRLNEV 1752 241
HLA-DRB1*11:01 GINASVVNIQKEIDRLNEVA GINASFVNIQKEIDRLNEVA 1746 243
HLA-DRB1*11:01 NASVVNIQKEIDRLN NASFVNIQKEIDRLN 1306 184
HLA-DRB1*11:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 1716 244
HLA-DRB1*11:01 INASVVNIQKEIDRLNEVAK INASFVNIQKEIDRLNEVAK 1725 254
HLA-DRB1*11:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 1726 255
HLA-DRB1*11:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 1909 287
HLA-DRB1*11:01 NASVVNIQKEIDRLNEVAKN NASFVNIQKEIDRLNEVAKN 1773 275
HLA-DRB1*11:01 NASVVNIQKEIDRLNEV NASFVNIQKEIDRLNEV 2439 389
HLA-DRB1*11:01 ASVVNIQKEIDRLNEVA ASFVNIQKEIDRLNEVA 2924 467
HLA-DRB1*11:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 1984 321
HLA-DRB1*11:01 NASVVNIQKEIDRLNE NASFVNIQKEIDRLNE 2580 418
HLA-DRB1*11:01 INASVVNIQKEIDRLNE INASFVNIQKEIDRLNE 2256 367
HLA-DRB1*11:01 GINASVVNIQKEIDRLNEV GINASFVNIQKEIDRLNEV 2972 499
HLA-DRB1*11:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 2611 445
HLA-DRB1*11:01 GINASVVNIQKEIDRLN GINASFVNIQKEIDRLN 2146 367
HLA-DRB1*11:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 2360 404
HLA-DRB1*11:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 2882 498
HLA-DRB1*11:01 INASVVNIQKEIDRLN INASFVNIQKEIDRLN 2263 400
HLA-DRB1*11:01 ASVVNIQKEIDRLNEVAKNL ASFVNIQKEIDRLNEVAKNL 1742 350
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQK GDISGINASFVNIQK 1335 275
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKE DISGINASFVNIQKE 1221 272
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEI ISGINASFVNIQKEI 1029 249
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEIDR ISGINASFVNIQKEIDR 1281 311
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKEID DISGINASFVNIQKEID 1196 291
HLA-DPA1*03:01/DPB1*04:01 ISGINASVVNIQKEIDR ISGINASFVNIQKEIDR 1853 451
HLA-DPA1*03:01/DPB1*04:01 DISGINASVVNIQKEID DISGINASFVNIQKEID 1703 432
HLA-DPA1*03:01/DPB1*04:01 ISGINASVVNIQKEID ISGINASFVNIQKEID 1768 455
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQKEI GDISGINASFVNIQKEI 1126 293
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQKEIDR GDISGINASFVNIQKEIDR 971 258
HLA-DPA1*03:01/DPB1*04:01 GDISGINASVVNIQKEIDR GDISGINASFVNIQKEIDR 1449 387
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEID SGINASFVNIQKEID 1547 414
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQKE GDISGINASFVNIQKE 1254 337
HLA-DRB1*10:01 ASVVNIQKEIDRLNE ASFVNIQKEIDRLNE 1044 281
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEID ISGINASFVNIQKEID 1104 301
HLA-DRB1*10:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 966 266
HLA-DPA1*03:01/DPB1*04:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 1334 369
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQKE LGDISGINASFVNIQKE 1177 327
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 1388 387
HLA-DPA1*03:01/DPB1*02:01 DLGDISGINASVVNIQK DLGDISGINASFVNIQK 1206 338
HLA-DPA1*03:01/DPB1*04:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 1473 413
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 861 243
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQ LGDISGINASFVNIQ 1206 341
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKEI DISGINASFVNIQKEI 1003 288
HLA-DRB1*10:01 NASVVNIQKEIDRLN NASFVNIQKEIDRLN 1219 353
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQK LGDISGINASFVNIQK 1088 320
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 1482 439
HLA-DPA1*03:01/DPB1*02:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 621 185
HLA-DPA1*03:01/DPB1*04:01 LGDISGINASVVNIQKEID LGDISGINASFVNIQKEID 1280 386
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQKEID LGDISGINASFVNIQKEID 840 254
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 913 284
HLA-DPA1*03:01/DPB1*02:01 DVDLGDISGINASVVNIQK DVDLGDISGINASFVNIQK 1077 337
HLA-DPA1*03:01/DPB1*02:01 VDLGDISGINASVVNIQKE VDLGDISGINASFVNIQKE 990 310
HLA-DPA1*03:01/DPB1*04:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 912 286
HLA-DPA1*03:01/DPB1*02:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 607 193
HLA-DPA1*04:01/DPB1*04:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 1551 498
HLA-DPA1*03:01/DPB1*04:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 1049 340
HLA-DPA1*03:01/DPB1*02:01 DLGDISGINASVVNIQKEI DLGDISGINASFVNIQKEI 819 266
HLA-DPA1*03:01/DPB1*04:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 923 301
HLA-DPA1*04:01/DPB1*04:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 1478 483
HLA-DPA1*03:01/DPB1*02:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 684 224
HLA-DPA1*03:01/DPB1*02:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 580 192
HLA-DPA1*04:01/DPB1*02:01 DISGINASVVNIQKE DISGINASFVNIQKE 1351 457
HLA-DRB1*10:01 SVVNIQKEIDRLNEV SFVNIQKEIDRLNEV 776 263
HLA-DPA1*03:01/DPB1*02:01 VDLGDISGINASVVNIQ VDLGDISGINASFVNIQ 1345 456
HLA-DPA1*03:01/DPB1*04:01 DLGDISGINASVVNIQKEI DLGDISGINASFVNIQKEI 1343 462
HLA-DPA1*03:01/DPB1*04:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 889 308
HLA-DPA1*04:01/DPB1*02:01 GDISGINASVVNIQK GDISGINASFVNIQK 1408 489
HLA-DPA1*03:01/DPB1*02:01 DLGDISGINASVVNIQ DLGDISGINASFVNIQ 1238 432
HLA-DPA1*03:01/DPB1*02:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 1347 473
HLA-DPA1*01:03/DPB1*01:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 1335 469
HLA-DPA1*03:01/DPB1*02:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 580 204
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 1124 398
HLA-DPA1*03:01/DPB1*02:01 GINASVVNIQKEIDRLN GINASFVNIQKEIDRLN 1393 495
HLA-DRB1*10:01 INASVVNIQKEIDRLNE INASFVNIQKEIDRLNE 1314 472
HLA-DPA1*01:03/DPB1*01:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 1319 478
HLA-DPA1*03:01/DPB1*02:01 DVDLGDISGINASVVNIQKE DVDLGDISGINASFVNIQKE 673 244
HLA-DPA1*03:01/DPB1*04:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 920 334
HLA-DPA1*03:01/DPB1*02:01 VDLGDISGINASVVNIQKEI VDLGDISGINASFVNIQKEI 574 209
HLA-DRB1*10:01 ASVVNIQKEIDRLNEV ASFVNIQKEIDRLNEV 1329 492
HLA-DRB1*10:01 ASVVNIQKEIDRLNEVA ASFVNIQKEIDRLNEVA 1112 417
HLA-DPA1*03:01/DPB1*02:01 PDVDLGDISGINASVVNIQK PDVDLGDISGINASFVNIQK 735 278
HLA-DPA1*03:01/DPB1*02:01 PDVDLGDISGINASVVNIQ PDVDLGDISGINASFVNIQ 1235 469
HLA-DRB1*10:01 NASVVNIQKEIDRLNEV NASFVNIQKEIDRLNEV 1303 498
HLA-DPA1*01:03/DPB1*01:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 1013 393
HLA-DRB1*10:01 INASVVNIQKEIDRLNEVA INASFVNIQKEIDRLNEVA 1071 416
HLA-DRB1*10:01 NASVVNIQKEIDRLNEVAK NASFVNIQKEIDRLNEVAK 1202 471
HLA-DPA1*03:01/DPB1*04:01 SGINASVVNIQKEIDRLNEV SGINASFVNIQKEIDRLNEV 818 325
HLA-DRB1*10:01 INASVVNIQKEIDRLNEVAK INASFVNIQKEIDRLNEVAK 588 234
HLA-DRB1*10:01 ASVVNIQKEIDRLNEVAKN ASFVNIQKEIDRLNEVAKN 1162 464
HLA-DRB1*10:01 SVVNIQKEIDRLNEVAK SFVNIQKEIDRLNEVAK 1151 462
HLA-DRB1*10:01 GINASVVNIQKEIDRLNEV GINASFVNIQKEIDRLNEV 943 388
HLA-DPA1*04:01/DPB1*02:01 ISGINASVVNIQKEI ISGINASFVNIQKEI 1190 490
HLA-DPA1*01:03/DPB1*01:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 926 382
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEIDRL ISGINASFVNIQKEIDRL 909 375
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEID SGINASFVNIQKEID 705 294
HLA-DPA1*01:03/DPB1*01:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 1033 431
HLA-DPA1*03:01/DPB1*04:01 DVDLGDISGINASVVNIQKE DVDLGDISGINASFVNIQKE 1133 473
HLA-DRB1*10:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 872 367
HLA-DPA1*01:03/DPB1*01:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 1128 476
HLA-DRB1*10:01 GINASVVNIQKEIDRLNEVA GINASFVNIQKEIDRLNEVA 502 212
HLA-DPA1*03:01/DPB1*04:01 VDLGDISGINASVVNIQKEI VDLGDISGINASFVNIQKEI 975 414
HLA-DQA1*05:01/DQB1*03:01 SGINASVVNIQKEID SGINASFVNIQKEID 158 372
HLA-DQA1*05:01/DQB1*03:19 SGINASVVNIQKEID SGINASFVNIQKEID 158 372
HLA-DRB1*10:01 SVVNIQKEIDRLNEVA SFVNIQKEIDRLNEVA 1155 491
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 590 251
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 570 244
HLA-DRB1*10:01 NASVVNIQKEIDRLNEVAKN NASFVNIQKEIDRLNEVAKN 614 263
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEIDR ISGINASFVNIQKEIDR 523 225
HLA-DPA1*01:03/DPB1*01:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 871 375
HLA-DPA1*03:01/DPB1*01:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 730 315
HLA-DRB1*10:01 SGINASVVNIQKEIDRLNEV SGINASFVNIQKEIDRLNEV 442 191
HLA-DQA1*05:01/DQB1*03:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 220 509
HLA-DQA1*05:01/DQB1*03:19 GINASVVNIQKEIDR GINASFVNIQKEIDR 220 509
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEIDRLN SGINASFVNIQKEIDRLN 976 422
HLA-DPA1*02:02/DPB1*01:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 1121 491
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 452 198
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEIDR DISGINASFVNIQKEIDR 879 386
HLA-DPA1*03:01/DPB1*01:01 GINASVVNIQKEIDRLNE GINASFVNIQKEIDRLNE 1127 496
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEID DISGINASFVNIQKEID 540 238
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEID ISGINASFVNIQKEID 517 228
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKEIDR GDISGINASFVNIQKEIDR 482 213
HLA-DRB1*10:01 GINASVVNIQKEIDRLN GINASFVNIQKEIDRLN 832 369
HLA-DPA1*03:01/DPB1*01:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 736 327
HLA-DPA1*04:01/DPB1*01:01 INASVVNIQKEIDRL INASFVNIQKEIDRL 800 357
HLA-DRB1*10:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 782 349
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKEID GDISGINASFVNIQKEID 951 426
HLA-DPA1*03:01/DPB1*05:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 701 315
HLA-DPA1*03:01/DPB1*02:01 SGINASVVNIQKEIDRLNEV SGINASFVNIQKEIDRLNEV 524 236
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 448 203
HLA-DPA1*03:01/DPB1*02:01 SPDVDLGDISGINASVVNIQ SPDVDLGDISGINASFVNIQ 874 398
HLA-DPA1*03:01/DPB1*01:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 589 270
HLA-DPA1*04:01/DPB1*01:01 NASVVNIQKEIDRLN NASFVNIQKEIDRLN 937 430
HLA-DPA1*02:02/DPB1*01:01 ISGINASVVNIQKEIDR ISGINASFVNIQKEIDR 963 442
HLA-DPA1*02:02/DPB1*01:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 876 403
HLA-DPA1*02:02/DPB1*01:01 DISGINASVVNIQKEID DISGINASFVNIQKEID 1040 479
HLA-DPA1*03:01/DPB1*01:01 NASVVNIQKEIDRLN NASFVNIQKEIDRLN 918 423
HLA-DPA1*02:02/DPB1*01:01 DISGINASVVNIQKEIDRL DISGINASFVNIQKEIDRL 835 385
HLA-DPA1*03:01/DPB1*05:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 878 408
HLA-DPA1*03:01/DPB1*01:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 542 252
HLA-DPA1*03:01/DPB1*01:01 GINASVVNIQKEIDRLN GINASFVNIQKEIDRLN 562 262
HLA-DPA1*03:01/DPB1*04:01 GINASVVNIQKEIDRLNEVA GINASFVNIQKEIDRLNEVA 772 360
HLA-DPA1*02:02/DPB1*01:01 GDISGINASVVNIQKEIDR GDISGINASFVNIQKEIDR 954 445
HLA-DPA1*03:01/DPB1*05:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 756 354
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKE DISGINASFVNIQKE 698 327
HLA-DPA1*04:01/DPB1*02:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 1003 470
HLA-DPA1*03:01/DPB1*01:01 LGDISGINASVVNIQKEID LGDISGINASFVNIQKEID 473 222
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEI DISGINASFVNIQKEI 521 245
HLA-DQA1*05:01/DQB1*03:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 328 695
HLA-DQA1*05:01/DQB1*03:19 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 328 695
HLA-DQA1*05:01/DQB1*03:01 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 213 451
HLA-DQA1*05:01/DQB1*03:19 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 213 451
HLA-DPA1*02:02/DPB1*01:01 ISGINASVVNIQKEIDRLN ISGINASFVNIQKEIDRLN 806 381
HLA-DPA1*03:01/DPB1*01:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 301 143
HLA-DPA1*04:01/DPB1*02:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 1013 482
HLA-DPA1*02:02/DPB1*01:01 SGINASVVNIQKEIDRLNE SGINASFVNIQKEIDRLNE 878 419
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 311 149
HLA-DPA1*02:02/DPB1*01:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 994 477
HLA-DPA1*02:02/DPB1*01:01 LGDISGINASVVNIQKEIDR LGDISGINASFVNIQKEIDR 657 318
HLA-DPA1*02:02/DPB1*01:01 GDISGINASVVNIQKEIDRL GDISGINASFVNIQKEIDRL 576 279
HLA-DPA1*03:01/DPB1*01:01 NASVVNIQKEIDRLNE NASFVNIQKEIDRLNE 920 446
HLA-DQA1*05:01/DQB1*03:01 ISGINASVVNIQKEI ISGINASFVNIQKEI 113 233
HLA-DQA1*05:01/DQB1*03:19 ISGINASVVNIQKEI ISGINASFVNIQKEI 113 233
HLA-DQA1*01:02/DQB1*06:02 ISGINASVVNIQKEID ISGINASFVNIQKEID 69 142
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKE GDISGINASFVNIQKE 662 322
HLA-DPA1*03:01/DPB1*01:01 INASVVNIQKEIDRLNE INASFVNIQKEIDRLNE 636 310
HLA-DRB1*10:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 597 291
HLA-DPA1*04:01/DPB1*01:01 NASVVNIQKEIDRLNE NASFVNIQKEIDRLNE 851 415
HLA-DQA1*05:01/DQB1*03:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 304 623
HLA-DQA1*05:01/DQB1*03:19 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 304 623
HLA-DPA1*02:02/DPB1*01:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 561 274
HLA-DPA1*03:01/DPB1*01:01 INASVVNIQKEIDRLN INASFVNIQKEIDRLN 601 294
HLA-DQA1*02:01/DQB1*03:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 105 214
HLA-DQA1*02:01/DQB1*03:19 GINASVVNIQKEIDR GINASFVNIQKEIDR 105 214
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQK GDISGINASFVNIQK 825 405
HLA-DRB1*10:01 ASVVNIQKEIDRLNEVAKNL ASFVNIQKEIDRLNEVAKNL 499 245
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEI ISGINASFVNIQKEI 562 276
HLA-DPA1*04:01/DPB1*01:01 GINASVVNIQKEIDRL GINASFVNIQKEIDRL 606 298
HLA-DPA1*04:01/DPB1*01:01 SGINASVVNIQKEIDRL SGINASFVNIQKEIDRL 557 274
HLA-DPA1*04:01/DPB1*01:01 SGINASVVNIQKEID SGINASFVNIQKEID 678 334
HLA-DQA1*06:01/DQB1*03:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 298 604
HLA-DQA1*06:01/DQB1*03:19 GINASVVNIQKEIDR GINASFVNIQKEIDR 298 604
HLA-DPA1*03:01/DPB1*01:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 314 155
HLA-DPA1*04:01/DPB1*01:01 SGINASVVNIQKEIDR SGINASFVNIQKEIDR 565 279
HLA-DPA1*03:01/DPB1*01:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 347 172
HLA-DPA1*03:01/DPB1*05:01 DISGINASVVNIQKEIDRLN DISGINASFVNIQKEIDRLN 595 296
HLA-DPA1*04:01/DPB1*01:01 GINASVVNIQKEIDR GINASFVNIQKEIDR 727 362
HLA-DPA1*03:01/DPB1*01:01 GDISGINASVVNIQKEI GDISGINASFVNIQKEI 562 280
HLA-DPA1*02:02/DPB1*01:01 ISGINASVVNIQKEIDRLNE ISGINASFVNIQKEIDRLNE 574 286
HLA-DPA1*03:01/DPB1*04:01 INASVVNIQKEIDRLNEVAK INASFVNIQKEIDRLNEVAK 752 375
HLA-DPA1*02:02/DPB1*01:01 DLGDISGINASVVNIQKEID DLGDISGINASFVNIQKEID 758 378
HLA-DPA1*03:01/DPB1*01:01 LGDISGINASVVNIQKE LGDISGINASFVNIQKE 665 332
HLA-DQA1*01:02/DQB1*06:02 DISGINASVVNIQKEI DISGINASFVNIQKEI 65 130
HLA-DQA1*05:01/DQB1*03:01 DISGINASVVNIQKE DISGINASFVNIQKE 108 216
HLA-DQA1*05:01/DQB1*03:19 DISGINASVVNIQKE DISGINASFVNIQKE 108 216

N protein

N

203-204 RG->KR

Reference  GGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQ
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    GGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNGGDAALALLLLDRLNQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 225 911
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 225 911
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 421 1456
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARM NSTPGSSKRTSPARM 421 1456
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 497 1707
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 497 1707
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 286 982
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 286 982
HLA-DQA1*06:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 484 1637
HLA-DQA1*06:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 484 1637
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 497 1555
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARM RNSTPGSSKRTSPARM 497 1555
HLA-DQA1*05:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 333 1030
HLA-DQA1*05:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 333 1030
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARM SRNSTPGSSKRTSPARM 309 922
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARM SRNSTPGSSKRTSPARM 309 922
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 328 968
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 328 968
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 484 1359
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 484 1359
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 469 1315
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 469 1315
HLA-DRB1*01:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 1305 473
HLA-DRB1*01:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 1312 479
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 416 1132
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 416 1132
HLA-DQA1*05:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 403 1078
HLA-DQA1*05:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 403 1078
HLA-DQA1*02:01/DQB1*03:01 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 166 429
HLA-DQA1*02:01/DQB1*03:19 TPGSSRGTSPARMAG TPGSSKRTSPARMAG 166 429
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMA STPGSSKRTSPARMA 164 419
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMA STPGSSKRTSPARMA 164 419
HLA-DQA1*02:01/DQB1*03:01 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 254 646
HLA-DQA1*02:01/DQB1*03:19 RNSTPGSSRGTSPARMA RNSTPGSSKRTSPARMA 254 646
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 270 665
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMAG NSTPGSSKRTSPARMAG 270 665
HLA-DQA1*02:01/DQB1*03:01 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 221 530
HLA-DQA1*02:01/DQB1*03:19 STPGSSRGTSPARMAG STPGSSKRTSPARMAG 221 530
HLA-DQA1*02:01/DQB1*03:01 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 215 491
HLA-DQA1*02:01/DQB1*03:19 NSTPGSSRGTSPARMA NSTPGSSKRTSPARMA 215 491
HLA-DQA1*06:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 399 894
HLA-DQA1*06:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 399 894
HLA-DQA1*05:01/DQB1*03:01 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSKRTSPARMAG 458 1019
HLA-DQA1*05:01/DQB1*03:19 SSRNSTPGSSRGTSPARMAG SSRNSTPGSSKRTSPARMAG 458 1019
HLA-DQA1*05:01/DQB1*03:01 SRNSTPGSSRGTSPARMAGN SRNSTPGSSKRTSPARMAGN 387 842
HLA-DQA1*05:01/DQB1*03:19 SRNSTPGSSRGTSPARMAGN SRNSTPGSSKRTSPARMAGN 387 842
HLA-DQA1*06:01/DQB1*03:01 TPGSSRGTSPARMAGN TPGSSKRTSPARMAGN 481 1016
HLA-DQA1*06:01/DQB1*03:19 TPGSSRGTSPARMAGN TPGSSKRTSPARMAGN 481 1016
HLA-DQA1*05:01/DQB1*03:01 STPGSSRGTSPARMAGN STPGSSKRTSPARMAGN 423 888
HLA-DQA1*05:01/DQB1*03:19 STPGSSRGTSPARMAGN STPGSSKRTSPARMAGN 423 888
HLA-DQA1*02:01/DQB1*03:01 SRNSTPGSSRGTSPARMAG SRNSTPGSSKRTSPARMAG 318 665
HLA-DQA1*02:01/DQB1*03:19 SRNSTPGSSRGTSPARMAG SRNSTPGSSKRTSPARMAG 318 665
HLA-DQA1*05:01/DQB1*03:01 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNG 403 835
HLA-DQA1*05:01/DQB1*03:19 RNSTPGSSRGTSPARMAGNG RNSTPGSSKRTSPARMAGNG 403 835
HLA-DQA1*06:01/DQB1*03:01 GSSRGTSPARMAGNG GSSKRTSPARMAGNG 424 867
HLA-DQA1*06:01/DQB1*03:19 GSSRGTSPARMAGNG GSSKRTSPARMAGNG 424 867
HLA-DQA1*05:01/DQB1*03:01 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 258 526
HLA-DQA1*05:01/DQB1*03:19 PGSSRGTSPARMAGN PGSSKRTSPARMAGN 258 526
HLA-DQA1*02:01/DQB1*03:01 RNSSRNSTPGSSRGTSPARM RNSSRNSTPGSSKRTSPARM 299 603
HLA-DQA1*02:01/DQB1*03:19 RNSSRNSTPGSSRGTSPARM RNSSRNSTPGSSKRTSPARM 299 603
HLA-DQA1*02:01/DQB1*03:01 NSSRNSTPGSSRGTSPARM NSSRNSTPGSSKRTSPARM 404 814
HLA-DQA1*02:01/DQB1*03:19 NSSRNSTPGSSRGTSPARM NSSRNSTPGSSKRTSPARM 404 814

M234I

Reference  RMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPR
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    RMAGNGGDAALALLLLDRLNQLESKISGKCQQQQGQTVTKKSAAEASKKPR

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*01:01 MSGKGQQQQGQTVTK ISGKCQQQQGQTVTK 1425 198
HLA-DRB1*01:01 KMSGKGQQQQGQTVT KISGKCQQQQGQTVT 2446 345
HLA-DRB1*01:01 ESKMSGKGQQQQGQTVTKKS ESKISGKCQQQQGQTVTKKS 2100 321
HLA-DRB1*01:01 LESKMSGKGQQQQGQTVTKK LESKISGKCQQQQGQTVTKK 2148 338
HLA-DRB1*01:01 SKMSGKGQQQQGQTVTKKSA SKISGKCQQQQGQTVTKKSA 1966 314
HLA-DRB1*01:01 KMSGKGQQQQGQTVTKKSAA KISGKCQQQQGQTVTKKSAA 1824 315
HLA-DRB1*01:01 MSGKGQQQQGQTVTKKSAAE ISGKCQQQQGQTVTKKSAAE 1879 329
HLA-DRB1*01:01 KMSGKGQQQQGQTVTKK KISGKCQQQQGQTVTKK 2386 441
HLA-DRB1*01:01 MSGKGQQQQGQTVTKKS ISGKCQQQQGQTVTKKS 2383 444
HLA-DRB1*01:01 MSGKGQQQQGQTVTKK ISGKCQQQQGQTVTKK 2385 465
HLA-DRB1*11:04 RLNQLESKMSGKGQQ RLNQLESKISGKCQQ 323 670
HLA-DRB1*11:04 DRLNQLESKMSGKGQ DRLNQLESKISGKCQ 364 732

G238C

Reference  NGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NGGDAALALLLLDRLNQLESKISGKCQQQQGQTVTKKSAAEASKKPRQKRT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*01:01 MSGKGQQQQGQTVTK ISGKCQQQQGQTVTK 1425 198
HLA-DRB1*01:01 KMSGKGQQQQGQTVT KISGKCQQQQGQTVT 2446 345
HLA-DRB1*01:01 GKGQQQQGQTVTKKS GKCQQQQGQTVTKKS 1166 168
HLA-DRB1*01:01 SGKGQQQQGQTVTKK SGKCQQQQGQTVTKK 909 137
HLA-DRB1*01:01 ESKMSGKGQQQQGQTVTKKS ESKISGKCQQQQGQTVTKKS 2100 321
HLA-DRB1*01:01 LESKMSGKGQQQQGQTVTKK LESKISGKCQQQQGQTVTKK 2148 338
HLA-DRB1*01:01 SKMSGKGQQQQGQTVTKKSA SKISGKCQQQQGQTVTKKSA 1966 314
HLA-DRB1*01:01 KGQQQQGQTVTKKSA KCQQQQGQTVTKKSA 1408 225
HLA-DRB1*01:01 KMSGKGQQQQGQTVTKKSAA KISGKCQQQQGQTVTKKSAA 1824 315
HLA-DRB1*01:01 MSGKGQQQQGQTVTKKSAAE ISGKCQQQQGQTVTKKSAAE 1879 329
HLA-DRB1*01:01 KMSGKGQQQQGQTVTKK KISGKCQQQQGQTVTKK 2386 441
HLA-DRB1*01:01 MSGKGQQQQGQTVTKKS ISGKCQQQQGQTVTKKS 2383 444
HLA-DRB1*01:01 SGKGQQQQGQTVTKKSA SGKCQQQQGQTVTKKSA 2410 469
HLA-DRB1*01:01 MSGKGQQQQGQTVTKK ISGKCQQQQGQTVTKK 2385 465
HLA-DRB1*01:01 SGKGQQQQGQTVTKKS SGKCQQQQGQTVTKKS 2446 488
HLA-DRB1*01:01 SGKGQQQQGQTVTKKSAAEA SGKCQQQQGQTVTKKSAAEA 1614 348
HLA-DRB1*01:02 SGKGQQQQGQTVTKK SGKCQQQQGQTVTKK 1641 411
HLA-DRB1*01:01 GKGQQQQGQTVTKKSAAEAS GKCQQQQGQTVTKKSAAEAS 1425 413
HLA-DRB1*11:04 RLNQLESKMSGKGQQ RLNQLESKISGKCQQ 323 670
HLA-DRB1*11:04 DRLNQLESKMSGKGQ DRLNQLESKISGKCQ 364 732

NS9c protein

NS9c

G50N

Reference  AAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           ||||||||||||||||||||||||| |||||||||||||||||||||||
Mutated    AAVKPLLVPHHVVATVQEIQLQAAVNELLLLEWLAMAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*13:02 QLQAAVGELLLLEWLA QLQAAVNELLLLEWLA 1993 489
HLA-DRB1*13:02 QLQAAVGELLLLEWL QLQAAVNELLLLEWL 848 223
HLA-DRB1*13:02 IQLQAAVGELLLLEWL IQLQAAVNELLLLEWL 1066 297
HLA-DRB1*13:02 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 435 139
HLA-DRB1*13:02 IQLQAAVGELLLLEWLA IQLQAAVNELLLLEWLA 1414 466
HLA-DRB1*13:02 QEIQLQAAVGELLLLEWLAM QEIQLQAAVNELLLLEWLAM 887 293
HLA-DRB1*13:02 EIQLQAAVGELLLLEWLAMA EIQLQAAVNELLLLEWLAMA 1063 355
HLA-DRB1*13:02 VQEIQLQAAVGELLLLEWLA VQEIQLQAAVNELLLLEWLA 762 260
HLA-DRB1*13:02 EIQLQAAVGELLLLEW EIQLQAAVNELLLLEW 498 172
HLA-DRB1*13:02 TVQEIQLQAAVGELLLLEWL TVQEIQLQAAVNELLLLEWL 694 242
HLA-DRB1*13:02 ATVQEIQLQAAVGELLLLEW ATVQEIQLQAAVNELLLLEW 654 233
HLA-DRB1*01:01 QLQAAVGELLLLEWL QLQAAVNELLLLEWL 47 130
HLA-DRB1*13:02 EIQLQAAVGELLLLEWLAM EIQLQAAVNELLLLEWLAM 1309 479
HLA-DRB1*13:02 QEIQLQAAVGELLLLE QEIQLQAAVNELLLLE 396 145
HLA-DRB1*13:02 VATVQEIQLQAAVGELLLLE VATVQEIQLQAAVNELLLLE 637 236
HLA-DRB1*13:02 EIQLQAAVGELLLLEWL EIQLQAAVNELLLLEWL 695 259
HLA-DRB1*13:02 QEIQLQAAVGELLLLEWLA QEIQLQAAVNELLLLEWLA 1027 387
HLA-DRB1*13:02 QEIQLQAAVGELLLLEW QEIQLQAAVNELLLLEW 553 211
HLA-DRB1*13:02 VQEIQLQAAVGELLLL VQEIQLQAAVNELLLL 415 160
HLA-DRB1*01:01 EIQLQAAVGELLLLEWL EIQLQAAVNELLLLEWL 51 131
HLA-DRB1*01:01 IQLQAAVGELLLLEWLA IQLQAAVNELLLLEWLA 96 245
HLA-DRB1*13:02 VQEIQLQAAVGELLLLEWL VQEIQLQAAVNELLLLEWL 867 341
HLA-DRB1*13:02 VVATVQEIQLQAAVGELLLL VVATVQEIQLQAAVNELLLL 738 299
HLA-DRB1*13:02 VQEIQLQAAVGELLLLE VQEIQLQAAVNELLLLE 469 191
HLA-DRB1*13:02 EIQLQAAVGELLLLE EIQLQAAVNELLLLE 211 86
HLA-DRB1*13:02 TVQEIQLQAAVGELLLLEW TVQEIQLQAAVNELLLLEW 799 328
HLA-DRB1*13:02 QEIQLQAAVGELLLL QEIQLQAAVNELLLL 210 87
HLA-DRB1*01:01 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 25 60
HLA-DRB1*01:01 QEIQLQAAVGELLLLEW QEIQLQAAVNELLLLEW 45 107
HLA-DRB1*04:01 EIQLQAAVGELLLLE EIQLQAAVNELLLLE 784 332
HLA-DRB1*01:01 EIQLQAAVGELLLLEW EIQLQAAVNELLLLEW 53 123
HLA-DRB1*13:02 ATVQEIQLQAAVGELLLLE ATVQEIQLQAAVNELLLLE 767 331
HLA-DRB1*01:01 IQLQAAVGELLLLEWL IQLQAAVNELLLLEWL 100 231
HLA-DRB1*01:01 VQEIQLQAAVGELLLLE VQEIQLQAAVNELLLLE 43 99
HLA-DRB1*04:04 EIQLQAAVGELLLLEW EIQLQAAVNELLLLEW 780 340
HLA-DRB1*04:04 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 705 308
HLA-DRB1*01:01 QLQAAVGELLLLEWLA QLQAAVNELLLLEWLA 198 452
HLA-DRB1*13:02 TVQEIQLQAAVGELLLL TVQEIQLQAAVNELLLL 525 231
HLA-DRB1*01:01 EIQLQAAVGELLLLE EIQLQAAVNELLLLE 16 36
HLA-DRB1*01:01 QLQAAVGELLLLEWLAM QLQAAVNELLLLEWLAM 185 413
HLA-DQA1*02:01/DQB1*03:01 QLQAAVGELLLLEWL QLQAAVNELLLLEWL 412 919
HLA-DQA1*02:01/DQB1*03:19 QLQAAVGELLLLEWL QLQAAVNELLLLEWL 412 919
HLA-DRB1*01:01 QEIQLQAAVGELLLL QEIQLQAAVNELLLL 18 40
HLA-DRB1*01:01 VQEIQLQAAVGELLL VQEIQLQAAVNELLL 21 45
HLA-DRB1*01:01 QEIQLQAAVGELLLLE QEIQLQAAVNELLLLE 49 105
HLA-DRB1*01:01 ATVQEIQLQAAVGELLL ATVQEIQLQAAVNELLL 71 151
HLA-DRB1*01:01 TVQEIQLQAAVGELLLL TVQEIQLQAAVNELLLL 56 119
HLA-DRB1*13:02 TVQEIQLQAAVGELLL TVQEIQLQAAVNELLL 404 195
HLA-DRB1*04:04 EIQLQAAVGELLLLE EIQLQAAVNELLLLE 408 198
HLA-DRB1*01:01 EIQLQAAVGELLLLEWLAM EIQLQAAVNELLLLEWLAM 154 317
HLA-DRB1*01:01 EIQLQAAVGELLLLEWLA EIQLQAAVNELLLLEWLA 372 758
HLA-DQA1*01:02/DQB1*06:04 TVQEIQLQAAVGELLL TVQEIQLQAAVNELLL 457 225
HLA-DQA1*01:02/DQB1*06:04 EIQLQAAVGELLLLEW EIQLQAAVNELLLLEW 522 258
HLA-DRB1*13:02 VATVQEIQLQAAVGELLLL VATVQEIQLQAAVNELLLL 874 433
HLA-DQA1*01:02/DQB1*06:04 VQEIQLQAAVGELLL VQEIQLQAAVNELLL 512 255
HLA-DRB1*04:01 QEIQLQAAVGELLLL QEIQLQAAVNELLLL 684 341
HLA-DQA1*02:01/DQB1*03:01 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 312 625
HLA-DQA1*02:01/DQB1*03:19 IQLQAAVGELLLLEW IQLQAAVNELLLLEW 312 625

NSP5 protein

NSP5

L205V

Reference  NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NFYGPFVDRQTAQAAGTDTTITVNVVAWLYAAVINGDRWFLNRFTTTLNDF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*13:02 DTTITVNVLAWLYAAV DTTITVNVVAWLYAAV 214 78
HLA-DRB1*13:02 GTDTTITVNVLAWLYA GTDTTITVNVVAWLYA 245 92
HLA-DRB1*13:02 TDTTITVNVLAWLYAA TDTTITVNVVAWLYAA 202 76
HLA-DRB1*13:02 AAGTDTTITVNVLAWLYAA AAGTDTTITVNVVAWLYAA 374 142
HLA-DRB1*13:02 QAAGTDTTITVNVLAWLYA QAAGTDTTITVNVVAWLYA 477 182
HLA-DRB1*13:02 TDTTITVNVLAWLYAAV TDTTITVNVVAWLYAAV 203 78
HLA-DRB1*13:02 TTITVNVLAWLYAAV TTITVNVVAWLYAAV 130 50
HLA-DRB1*13:02 AGTDTTITVNVLAWLYAAV AGTDTTITVNVVAWLYAAV 363 140
HLA-DRB1*13:02 AGTDTTITVNVLAWLY AGTDTTITVNVVAWLY 301 117
HLA-DRB1*13:02 DTTITVNVLAWLYAA DTTITVNVVAWLYAA 90 35
HLA-DRB1*13:02 GTDTTITVNVLAWLYAA GTDTTITVNVVAWLYAA 198 77
HLA-DRB1*13:02 AAGTDTTITVNVLAWLYAAV AAGTDTTITVNVVAWLYAAV 312 122
HLA-DRB1*13:02 QAAGTDTTITVNVLAWLYAA QAAGTDTTITVNVVAWLYAA 320 126
HLA-DRB1*13:02 TDTTITVNVLAWLYA TDTTITVNVVAWLYA 104 41
HLA-DRB1*13:02 AGTDTTITVNVLAWLYA AGTDTTITVNVVAWLYA 244 97
HLA-DRB1*13:02 AQAAGTDTTITVNVLAWLYA AQAAGTDTTITVNVVAWLYA 403 161
HLA-DRB1*13:02 TTITVNVLAWLYAAVI TTITVNVVAWLYAAVI 245 98
HLA-DRB1*13:02 AGTDTTITVNVLAWLYAAVI AGTDTTITVNVVAWLYAAVI 312 125
HLA-DPA1*03:01/DPB1*04:01 AGTDTTITVNVLAWL AGTDTTITVNVVAWL 473 1174
HLA-DRB1*13:02 AGTDTTITVNVLAWLYAA AGTDTTITVNVVAWLYAA 706 289
HLA-DRB1*13:02 GTDTTITVNVLAWLYAAV GTDTTITVNVVAWLYAAV 705 289
HLA-DRB1*13:02 GTDTTITVNVLAWLY GTDTTITVNVVAWLY 124 51
HLA-DRB1*13:02 AAGTDTTITVNVLAWLYA AAGTDTTITVNVVAWLYA 897 370
HLA-DRB1*13:02 GTDTTITVNVLAWLYAAVIN GTDTTITVNVVAWLYAAVIN 312 129
HLA-DRB1*13:02 TDTTITVNVLAWLYAAVING TDTTITVNVVAWLYAAVING 325 135
HLA-DRB1*13:02 AQAAGTDTTITVNVLAWLY AQAAGTDTTITVNVVAWLY 595 248
HLA-DRB1*13:02 GTDTTITVNVLAWLYAAVI GTDTTITVNVVAWLYAAVI 341 143
HLA-DPA1*03:01/DPB1*02:01 AGTDTTITVNVLAWL AGTDTTITVNVVAWL 390 921
HLA-DRB1*13:02 AAGTDTTITVNVLAWLY AAGTDTTITVNVVAWLY 304 129
HLA-DRB1*13:02 TDTTITVNVLAWLYAAVIN TDTTITVNVVAWLYAAVIN 345 148
HLA-DPA1*03:01/DPB1*04:01 GTDTTITVNVLAWLY GTDTTITVNVVAWLY 353 820
HLA-DRB1*13:02 DTTITVNVLAWLYAAVI DTTITVNVVAWLYAAVI 178 78
HLA-DRB1*13:02 DTTITVNVLAWLYAAVING DTTITVNVVAWLYAAVING 364 161
HLA-DRB1*13:02 DTTITVNVLAWLYAAVINGD DTTITVNVVAWLYAAVINGD 310 138
HLA-DRB1*13:02 TDTTITVNVLAWLYAAVI TDTTITVNVVAWLYAAVI 652 292
HLA-DRB1*13:02 TAQAAGTDTTITVNVLAWLY TAQAAGTDTTITVNVVAWLY 486 218
HLA-DRB1*13:02 AAGTDTTITVNVLAWL AAGTDTTITVNVVAWL 358 161
HLA-DRB1*13:02 AGTDTTITVNVLAWL AGTDTTITVNVVAWL 142 64
HLA-DRB1*13:02 TTITVNVLAWLYAAVIN TTITVNVVAWLYAAVIN 225 102
HLA-DRB1*13:02 TITVNVLAWLYAAVI TITVNVVAWLYAAVI 165 77
HLA-DRB1*13:02 TTITVNVLAWLYAAVING TTITVNVVAWLYAAVING 791 370
HLA-DRB1*13:02 TTITVNVLAWLYAAVINGD TTITVNVVAWLYAAVINGD 442 207
HLA-DPA1*03:01/DPB1*04:01 AAGTDTTITVNVLAWLY AAGTDTTITVNVVAWLY 410 874
HLA-DPA1*03:01/DPB1*04:01 AGTDTTITVNVLAWLY AGTDTTITVNVVAWLY 410 871
HLA-DPA1*03:01/DPB1*02:01 GTDTTITVNVLAWLY GTDTTITVNVVAWLY 285 605
HLA-DRB1*13:02 TITVNVLAWLYAAVIN TITVNVVAWLYAAVIN 333 157
HLA-DRB1*13:02 DTTITVNVLAWLYAAVIN DTTITVNVVAWLYAAVIN 658 313
HLA-DRB1*15:02 TDTTITVNVLAWLYAA TDTTITVNVVAWLYAA 665 317
HLA-DPA1*03:01/DPB1*02:01 AAGTDTTITVNVLAWL AAGTDTTITVNVVAWL 499 1042
HLA-DRB1*13:02 QAAGTDTTITVNVLAWL QAAGTDTTITVNVVAWL 388 189
HLA-DRB1*13:02 TITVNVLAWLYAAVING TITVNVVAWLYAAVING 327 163
HLA-DRB1*15:02 DTTITVNVLAWLYAA DTTITVNVVAWLYAA 420 210
HLA-DRB1*15:02 DTTITVNVLAWLYAAV DTTITVNVVAWLYAAV 564 282

NSP7 protein

NSP7

L71F

Reference  TEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ
           ||||||||||||||||||||||||| ||||||||||||
Mutated    TEAFEKMVSLLSVLLSMQGAVDINKFCEEMLDNRATLQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DPA1*03:01/DPB1*02:01 QGAVDINKLCEEMLD QGAVDINKFCEEMLD 1339 474
HLA-DPA1*03:01/DPB1*02:01 MQGAVDINKLCEEML MQGAVDINKFCEEML 1295 484
HLA-DQA1*01:01/DQB1*05:01 LLSMQGAVDINKLCEEMLDN LLSMQGAVDINKFCEEMLDN 1243 486
HLA-DPA1*03:01/DPB1*02:01 GAVDINKLCEEMLDN GAVDINKFCEEMLDN 1067 444
HLA-DPA1*03:01/DPB1*02:01 QGAVDINKLCEEMLDNR QGAVDINKFCEEMLDNR 1104 474
HLA-DPA1*03:01/DPB1*02:01 SMQGAVDINKLCEEMLDNR SMQGAVDINKFCEEMLDNR 1025 462
HLA-DPA1*03:01/DPB1*02:01 AVDINKLCEEMLDNR AVDINKFCEEMLDNR 828 375
HLA-DPA1*03:01/DPB1*02:01 GAVDINKLCEEMLDNR GAVDINKFCEEMLDNR 1020 462
HLA-DPA1*03:01/DPB1*02:01 SMQGAVDINKLCEEMLDNRA SMQGAVDINKFCEEMLDNRA 708 322
HLA-DQA1*01:01/DQB1*05:01 VLLSMQGAVDINKLCEEMLD VLLSMQGAVDINKFCEEMLD 952 434
HLA-DPA1*03:01/DPB1*02:01 QGAVDINKLCEEMLDNRATL QGAVDINKFCEEMLDNRATL 695 317
HLA-DPA1*03:01/DPB1*02:01 MQGAVDINKLCEEMLDNRAT MQGAVDINKFCEEMLDNRAT 713 329
HLA-DPA1*03:01/DPB1*02:01 MQGAVDINKLCEEMLDNRA MQGAVDINKFCEEMLDNRA 932 434
HLA-DPA1*03:01/DPB1*02:01 QGAVDINKLCEEMLDNRAT QGAVDINKFCEEMLDNRAT 948 443
HLA-DQA1*01:01/DQB1*05:01 VLLSMQGAVDINKLCEEML VLLSMQGAVDINKFCEEML 1061 497
HLA-DPA1*03:01/DPB1*02:01 LSMQGAVDINKLCEEMLDNR LSMQGAVDINKFCEEMLDNR 674 321
HLA-DPA1*03:01/DPB1*02:01 GAVDINKLCEEMLDNRATLQ GAVDINKFCEEMLDNRATLQ 711 350

NSP12 protein

NSP12

P323L

Reference  CVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    CVNCLDDRCILHCANFNVLFSTVFPLTSFGPLVRKIFVDGVPFVVSTGYHF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-DRB1*11:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 955 43
HLA-DRB1*13:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 955 43
HLA-DRB1*11:02 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 2009 97
HLA-DRB1*13:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 2009 97
HLA-DRB1*11:02 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 654 32
HLA-DRB1*13:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 654 32
HLA-DRB1*11:02 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 2714 141
HLA-DRB1*13:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 2714 141
HLA-DRB1*11:02 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1440 77
HLA-DRB1*13:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1440 77
HLA-DRB1*15:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 2472 145
HLA-DRB1*15:03 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1801 106
HLA-DRB1*15:03 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2121 130
HLA-DRB1*15:03 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1350 83
HLA-DRB1*15:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1187 73
HLA-DRB1*15:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1497 93
HLA-DRB1*11:02 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 4894 308
HLA-DRB1*13:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 4894 308
HLA-DRB1*11:04 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1402 90
HLA-DRB1*16:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1490 96
HLA-DRB1*11:02 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1594 106
HLA-DRB1*13:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1594 106
HLA-DRB1*15:03 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 2741 185
HLA-DRB1*15:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1911 131
HLA-DRB1*11:04 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 2517 173
HLA-DRB1*11:04 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1007 70
HLA-DRB1*11:02 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1607 112
HLA-DRB1*13:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1607 112
HLA-DRB1*16:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1059 74
HLA-DRB1*11:04 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1882 133
HLA-DRB1*15:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1398 104
HLA-DRB1*15:03 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1364 103
HLA-DRB1*16:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1994 152
HLA-DRB1*15:03 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 3214 245
HLA-DRB1*11:04 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 3015 230
HLA-DRB1*04:04 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2558 198
HLA-DRB1*15:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 819 65
HLA-DRB1*04:04 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2330 185
HLA-DRB1*11:02 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 913 73
HLA-DRB1*13:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 913 73
HLA-DRB1*15:03 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1976 158
HLA-DRB1*15:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 4430 355
HLA-DRB1*13:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 4231 342
HLA-DRB1*13:02 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 3413 276
HLA-DRB1*16:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1644 134
HLA-DRB1*11:02 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2545 208
HLA-DRB1*13:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2545 208
HLA-DRB1*15:03 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1682 139
HLA-DRB1*15:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 3238 268
HLA-DRB1*16:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1871 156
HLA-DRB1*11:04 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2203 185
HLA-DRB1*15:03 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 2129 180
HLA-DRB1*15:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1458 125
HLA-DRB1*01:02 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1639 141
HLA-DRB1*15:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 2515 220
HLA-DRB1*16:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 2332 205
HLA-DRB1*11:02 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 656 58
HLA-DRB1*13:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 656 58
HLA-DRB1*11:04 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 2035 182
HLA-DRB1*12:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 3381 305
HLA-DRB1*11:02 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 276 25
HLA-DRB1*13:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 276 25
HLA-DRB1*15:03 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 748 68
HLA-DRB1*04:04 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 4113 374
HLA-DRB1*15:03 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1100 105
HLA-DRB1*15:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1138 110
HLA-DRB1*15:03 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1218 118
HLA-DRB1*01:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1541 150
HLA-DRB1*16:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1246 122
HLA-DRB1*15:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 3046 300
HLA-DRB1*11:02 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 4801 475
HLA-DRB1*13:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 4801 475
HLA-DQA1*01:02/DQB1*05:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1318 131
HLA-DRB1*15:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 2782 277
HLA-DRB1*04:04 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 3920 391
HLA-DRB1*12:02 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 2650 265
HLA-DRB1*16:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1079 108
HLA-DRB1*15:03 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 3932 398
HLA-DQA1*01:02/DQB1*05:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1550 157
HLA-DPA1*03:01/DPB1*02:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 689 70
HLA-DQA1*01:02/DQB1*05:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1867 191
HLA-DRB1*15:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 895 92
HLA-DRB1*15:03 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1401 145
HLA-DRB1*11:02 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1747 181
HLA-DRB1*13:01 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1747 181
HLA-DRB1*12:02 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 4055 421
HLA-DRB1*08:04 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1868 196
HLA-DRB1*15:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 3100 329
HLA-DRB1*04:04 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2707 288
HLA-DRB1*04:04 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1976 213
HLA-DRB1*13:02 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 4598 496
HLA-DRB1*11:02 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 3424 370
HLA-DRB1*13:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 3424 370
HLA-DRB1*12:02 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 3761 407
HLA-DPA1*03:01/DPB1*02:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 364 40
HLA-DRB1*15:03 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1598 176
HLA-DRB1*15:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 4258 469
HLA-DRB1*16:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 581 64
HLA-DRB1*01:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 499 55
HLA-DRB1*11:02 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1941 214
HLA-DRB1*13:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1941 214
HLA-DRB1*15:03 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1684 186
HLA-DRB1*16:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1643 183
HLA-DRB1*15:03 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1884 211
HLA-DPA1*03:01/DPB1*04:02 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1504 171
HLA-DPA1*03:01/DPB1*105:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1504 171
HLA-DQA1*01:03/DQB1*05:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2259 257
HLA-DPA1*03:01/DPB1*02:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 377 43
HLA-DQA1*01:03/DQB1*05:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1905 218
HLA-DRB1*15:03 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 3609 413
HLA-DRB1*15:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1011 116
HLA-DRB1*11:02 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1759 202
HLA-DRB1*13:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1759 202
HLA-DPA1*03:01/DPB1*02:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 391 45
HLA-DQA1*01:02/DQB1*05:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 997 115
HLA-DRB1*08:04 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 3568 412
HLA-DRB1*08:04 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1409 163
HLA-DRB1*11:02 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 517 60
HLA-DRB1*13:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 517 60
HLA-DRB1*15:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1264 147
HLA-DRB1*15:03 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 3420 399
HLA-DQA1*01:02/DQB1*05:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1634 191
HLA-DRB1*15:02 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 4257 498
HLA-DRB1*11:02 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 2042 239
HLA-DRB1*13:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 2042 239
HLA-DRB1*15:02 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 3779 444
HLA-DRB1*15:03 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1676 197
HLA-DQA1*01:03/DQB1*05:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1778 209
HLA-DPA1*03:01/DPB1*04:02 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2382 280
HLA-DPA1*03:01/DPB1*105:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2382 280
HLA-DPA1*03:01/DPB1*04:02 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1546 182
HLA-DPA1*03:01/DPB1*105:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1546 182
HLA-DPA1*03:01/DPB1*02:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 688 81
HLA-DRB1*11:02 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 619 73
HLA-DRB1*13:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 619 73
HLA-DRB1*15:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 482 57
HLA-DRB1*08:04 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 2923 346
HLA-DRB1*15:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1393 165
HLA-DPA1*03:01/DPB1*02:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 865 103
HLA-DRB1*16:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1315 157
HLA-DRB1*16:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2805 335
HLA-DPA1*03:01/DPB1*04:02 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 3018 361
HLA-DPA1*03:01/DPB1*105:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 3018 361
HLA-DRB1*15:01 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1477 177
HLA-DRB1*15:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2712 325
HLA-DRB1*15:03 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1535 184
HLA-DRB1*11:02 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 1001 120
HLA-DRB1*13:01 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 1001 120
HLA-DRB1*15:03 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1768 212
HLA-DPA1*03:01/DPB1*04:02 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1501 180
HLA-DPA1*03:01/DPB1*105:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1501 180
HLA-DRB1*15:03 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 3732 448
HLA-DQA1*01:02/DQB1*05:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1091 131
HLA-DRB1*15:03 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 2005 241
HLA-DPA1*03:01/DPB1*04:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 973 117
HLA-DQA1*01:02/DQB1*05:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1670 201
HLA-DRB1*16:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 3754 452
HLA-DRB1*11:02 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1077 131
HLA-DRB1*13:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1077 131
HLA-DRB1*08:04 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2154 264
HLA-DRB1*08:04 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2723 334
HLA-DPA1*03:01/DPB1*04:02 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1782 219
HLA-DPA1*03:01/DPB1*105:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1782 219
HLA-DRB1*16:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1056 130
HLA-DRB1*15:03 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1071 132
HLA-DPA1*03:01/DPB1*04:02 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 2422 299
HLA-DPA1*03:01/DPB1*105:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 2422 299
HLA-DPA1*02:01/DPB1*05:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2874 355
HLA-DRB1*15:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 774 96
HLA-DRB1*16:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 894 111
HLA-DPA1*03:01/DPB1*04:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 674 84
HLA-DRB1*14:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 2669 333
HLA-DRB1*04:04 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 2325 291
HLA-DRB1*16:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 998 125
HLA-DRB1*11:02 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 447 56
HLA-DRB1*13:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 447 56
HLA-DRB1*14:04 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 2683 337
HLA-DPA1*02:01/DPB1*05:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 3305 416
HLA-DRB1*15:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 857 108
HLA-DRB1*16:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1317 166
HLA-DRB1*15:03 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 3165 399
HLA-DRB1*15:03 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 745 94
HLA-DRB1*15:03 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 989 125
HLA-DRB1*11:04 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 2186 278
HLA-DPA1*02:01/DPB1*05:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 3686 471
HLA-DRB1*16:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1213 155
HLA-DPA1*03:01/DPB1*02:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 367 47
HLA-DPA1*03:01/DPB1*04:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 602 78
HLA-DRB1*15:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1234 160
HLA-DQA1*01:02/DQB1*05:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1116 145
HLA-DRB1*01:02 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 2677 348
HLA-DPA1*03:01/DPB1*04:02 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1400 182
HLA-DPA1*03:01/DPB1*105:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1400 182
HLA-DRB1*10:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 737 96
HLA-DRB1*14:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 3007 392
HLA-DRB1*01:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1071 140
HLA-DPA1*03:01/DPB1*04:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1016 133
HLA-DRB1*15:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1114 146
HLA-DPA1*01:03/DPB1*02:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 742 98
HLA-DRB1*11:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2376 314
HLA-DRB1*16:01 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1485 197
HLA-DRB1*14:04 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2772 368
HLA-DRB1*11:04 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 3669 488
HLA-DPA1*03:01/DPB1*02:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 352 47
HLA-DPA1*03:01/DPB1*04:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1168 156
HLA-DPA1*03:01/DPB1*105:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1168 156
HLA-DPA1*03:01/DPB1*04:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 650 87
HLA-DQA1*01:02/DQB1*05:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 993 133
HLA-DRB1*15:02 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 2258 303
HLA-DRB1*16:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1351 182
HLA-DQA1*01:02/DQB1*05:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1654 223
HLA-DRB1*15:03 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1703 230
HLA-DPA1*03:01/DPB1*02:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 385 52
HLA-DPA1*01:03/DPB1*02:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 783 106
HLA-DRB1*11:02 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 807 110
HLA-DRB1*13:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 807 110
HLA-DQA1*01:02/DQB1*05:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 895 122
HLA-DRB1*07:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 880 120
HLA-DPA1*02:02/DPB1*05:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1892 258
HLA-DRB1*15:02 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2542 347
HLA-DRB1*16:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 2475 338
HLA-DQA1*01:02/DQB1*05:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1273 174
HLA-DRB1*15:03 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 1112 152
HLA-DPA1*03:01/DPB1*04:02 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1279 175
HLA-DPA1*03:01/DPB1*105:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1279 175
HLA-DRB1*15:03 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 906 124
HLA-DRB1*04:04 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 2797 383
HLA-DRB1*16:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 2624 360
HLA-DPA1*03:01/DPB1*04:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1267 174
HLA-DPA1*03:01/DPB1*02:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 363 50
HLA-DRB1*01:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 994 137
HLA-DRB1*11:02 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 660 91
HLA-DRB1*13:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 660 91
HLA-DRB1*15:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 551 76
HLA-DPA1*03:01/DPB1*02:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 304 42
HLA-DRB1*15:01 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 1483 205
HLA-DRB1*16:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 749 104
HLA-DQA1*01:03/DQB1*05:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1421 198
HLA-DPA1*01:03/DPB1*04:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2095 292
HLA-DRB1*11:02 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 1852 259
HLA-DRB1*13:01 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 1852 259
HLA-DRB1*11:02 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 629 88
HLA-DRB1*13:01 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 629 88
HLA-DRB1*15:02 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2916 408
HLA-DRB1*11:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2923 409
HLA-DRB1*15:03 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 864 121
HLA-DRB1*15:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 670 94
HLA-DQA1*01:03/DQB1*05:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1404 197
HLA-DRB1*15:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1261 177
HLA-DRB1*15:01 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 1281 180
HLA-DPA1*02:01/DPB1*05:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2951 415
HLA-DRB1*15:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1102 155
HLA-DRB1*16:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1386 195
HLA-DRB1*15:03 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1008 142
HLA-DRB1*07:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1829 258
HLA-DPA1*02:02/DPB1*05:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1460 206
HLA-DPA1*03:01/DPB1*04:02 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1447 205
HLA-DPA1*03:01/DPB1*105:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1447 205
HLA-DRB1*15:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 705 100
HLA-DPA1*02:01/DPB1*05:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 2752 394
HLA-DPA1*03:01/DPB1*04:02 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1298 186
HLA-DPA1*03:01/DPB1*105:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1298 186
HLA-DRB1*01:02 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 2454 354
HLA-DPA1*02:02/DPB1*05:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1268 183
HLA-DPA1*02:02/DPB1*05:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1545 223
HLA-DQA1*01:02/DQB1*05:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1018 147
HLA-DPA1*03:01/DPB1*04:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 650 94
HLA-DRB1*11:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1773 257
HLA-DRB1*16:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 772 112
HLA-DPA1*01:03/DPB1*02:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 689 100
HLA-DPA1*01:03/DPB1*02:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 646 94
HLA-DRB1*15:01 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 700 102
HLA-DQA1*01:03/DQB1*05:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1310 191
HLA-DRB1*04:02 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 3231 472
HLA-DRB1*15:01 FPPTSFGPLVRKIFVDGV FPLTSFGPLVRKIFVDGV 3306 483
HLA-DPA1*01:03/DPB1*04:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1006 147
HLA-DPA1*01:03/DPB1*02:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1490 218
HLA-DRB1*15:03 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 1195 175
HLA-DPA1*01:03/DPB1*04:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 891 131
HLA-DPA1*01:03/DPB1*05:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 2609 384
HLA-DRB1*13:02 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1934 285
HLA-DPA1*01:03/DPB1*04:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1024 151
HLA-DPA1*03:01/DPB1*02:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 413 61
HLA-DQA1*01:02/DQB1*05:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 907 134
HLA-DPA1*03:01/DPB1*02:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 405 60
HLA-DPA1*03:01/DPB1*04:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 560 83
HLA-DRB1*01:02 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1981 295
HLA-DPA1*01:03/DPB1*04:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 2255 336
HLA-DPA1*02:02/DPB1*05:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1200 179
HLA-DRB1*15:01 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 595 89
HLA-DRB1*11:04 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2391 358
HLA-DQA1*01:03/DQB1*05:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1549 232
HLA-DPA1*03:01/DPB1*02:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 447 67
HLA-DRB1*07:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 825 124
HLA-DRB1*01:02 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1055 159
HLA-DPA1*03:01/DPB1*04:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 582 88
HLA-DPA1*02:01/DPB1*05:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 2541 385
HLA-DPA1*03:01/DPB1*04:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 633 96
HLA-DRB1*16:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 2657 403
HLA-DRB1*16:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1371 208
HLA-DQA1*01:03/DQB1*05:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1316 200
HLA-DPA1*01:03/DPB1*05:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2350 359
HLA-DPA1*01:03/DPB1*02:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 458 70
HLA-DRB1*10:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1085 166
HLA-DRB1*11:04 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 633 97
HLA-DRB1*01:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 339 52
HLA-DRB1*15:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 593 91
HLA-DRB1*16:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 553 85
HLA-DRB1*11:02 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 832 128
HLA-DRB1*13:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 832 128
HLA-DQA1*01:03/DQB1*05:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1328 205
HLA-DRB1*07:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1805 279
HLA-DPA1*02:01/DPB1*01:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1752 271
HLA-DRB1*11:02 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 891 138
HLA-DRB1*13:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 891 138
HLA-DPA1*03:01/DPB1*04:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 600 93
HLA-DRB1*01:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 645 100
HLA-DPA1*01:03/DPB1*04:02 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 2527 392
HLA-DPA1*01:03/DPB1*105:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 2527 392
HLA-DRB1*07:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1373 213
HLA-DRB1*16:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 638 99
HLA-DRB1*11:02 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 1846 287
HLA-DRB1*13:01 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 1846 287
HLA-DPA1*03:01/DPB1*04:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 656 102
HLA-DRB1*15:02 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 2890 451
HLA-DRB1*15:03 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 1844 288
HLA-DPA1*01:03/DPB1*04:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 3076 482
HLA-DRB1*11:04 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 784 123
HLA-DPA1*03:01/DPB1*02:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 599 94
HLA-DPA1*03:01/DPB1*04:02 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1357 213
HLA-DPA1*03:01/DPB1*105:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1357 213
HLA-DQA1*01:02/DQB1*05:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 954 150
HLA-DPA1*02:01/DPB1*01:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1074 169
HLA-DRB1*08:04 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 2167 341
HLA-DRB1*11:02 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 203 32
HLA-DRB1*13:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 203 32
HLA-DPA1*02:02/DPB1*05:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2073 327
HLA-DPA1*01:03/DPB1*04:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 671 106
HLA-DRB1*14:04 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 3137 496
HLA-DPA1*01:03/DPB1*05:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 2300 364
HLA-DRB1*15:01 PPTSFGPLVRKIFVDG PLTSFGPLVRKIFVDG 1963 311
HLA-DRB1*15:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 902 143
HLA-DPA1*01:03/DPB1*02:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 624 99
HLA-DPA1*03:01/DPB1*04:02 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1292 205
HLA-DPA1*03:01/DPB1*105:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1292 205
HLA-DQA1*01:02/DQB1*05:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1058 168
HLA-DPA1*01:03/DPB1*04:02 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2906 462
HLA-DPA1*01:03/DPB1*105:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2906 462
HLA-DRB1*16:01 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 635 101
HLA-DPA1*01:03/DPB1*04:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1036 165
HLA-DRB1*15:03 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 992 158
HLA-DPA1*01:03/DPB1*02:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 596 95
HLA-DRB1*14:04 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2612 418
HLA-DPA1*01:03/DPB1*02:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 931 149
HLA-DQA1*01:02/DQB1*05:03 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 2585 414
HLA-DRB1*15:03 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 1939 312
HLA-DRB1*16:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1203 194
HLA-DPA1*03:01/DPB1*04:02 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1808 292
HLA-DPA1*03:01/DPB1*105:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1808 292
HLA-DPA1*01:03/DPB1*02:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 842 136
HLA-DRB1*16:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 773 125
HLA-DPA1*01:03/DPB1*02:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1539 249
HLA-DRB1*16:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 2354 381
HLA-DRB1*16:01 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 753 122
HLA-DRB1*15:02 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 2417 392
HLA-DPA1*01:03/DPB1*05:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1978 321
HLA-DPA1*01:03/DPB1*05:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2737 445
HLA-DQA1*01:02/DQB1*05:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 707 115
HLA-DPA1*01:03/DPB1*04:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1549 252
HLA-DRB1*04:04 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1333 217
HLA-DRB1*04:04 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 2061 336
HLA-DPA1*02:01/DPB1*05:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1931 315
HLA-DRB1*15:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1195 195
HLA-DRB1*11:02 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 753 123
HLA-DRB1*13:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 753 123
HLA-DQA1*01:03/DQB1*05:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1487 243
HLA-DPA1*02:01/DPB1*01:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1137 186
HLA-DPA1*03:01/DPB1*04:02 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1112 182
HLA-DPA1*03:01/DPB1*105:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1112 182
HLA-DRB1*04:04 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 2413 395
HLA-DPA1*01:03/DPB1*04:02 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 3005 493
HLA-DPA1*01:03/DPB1*105:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 3005 493
HLA-DRB1*08:04 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1374 226
HLA-DPA1*02:01/DPB1*01:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1094 180
HLA-DPA1*03:01/DPB1*02:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 316 52
HLA-DPA1*03:01/DPB1*04:02 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1695 279
HLA-DPA1*03:01/DPB1*105:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1695 279
HLA-DPA1*01:03/DPB1*05:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1912 315
HLA-DPA1*01:03/DPB1*04:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2045 337
HLA-DPA1*01:03/DPB1*105:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2045 337
HLA-DQA1*01:02/DQB1*05:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 958 158
HLA-DRB1*11:04 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 2240 370
HLA-DPA1*03:01/DPB1*05:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1755 290
HLA-DPA1*02:02/DPB1*05:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1809 299
HLA-DQA1*01:03/DQB1*05:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1651 273
HLA-DPA1*03:01/DPB1*02:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 471 78
HLA-DPA1*02:01/DPB1*01:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1786 296
HLA-DRB1*11:02 FNVLFSTVFPPTSFGPLVRK FNVLFSTVFPLTSFGPLVRK 1019 169
HLA-DRB1*13:01 FNVLFSTVFPPTSFGPLVRK FNVLFSTVFPLTSFGPLVRK 1019 169
HLA-DQA1*01:03/DQB1*05:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1284 213
HLA-DQA1*01:02/DQB1*05:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 886 147
HLA-DRB1*14:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2885 482
HLA-DQA1*01:02/DQB1*05:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1149 192
HLA-DRB1*01:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 365 61
HLA-DRB1*11:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2949 493
HLA-DPA1*03:01/DPB1*04:02 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1554 260
HLA-DPA1*03:01/DPB1*105:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1554 260
HLA-DPA1*02:01/DPB1*05:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 2254 378
HLA-DPA1*03:01/DPB1*02:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 363 61
HLA-DPA1*02:02/DPB1*05:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 2178 366
HLA-DPA1*01:03/DPB1*02:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 2040 343
HLA-DQA1*01:03/DQB1*05:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 2492 419
HLA-DPA1*03:01/DPB1*05:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1421 239
HLA-DRB1*15:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 654 110
HLA-DPA1*01:03/DPB1*04:02 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 2638 444
HLA-DPA1*01:03/DPB1*105:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 2638 444
HLA-DPA1*01:03/DPB1*04:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1288 217
HLA-DPA1*03:01/DPB1*05:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1404 237
HLA-DPA1*01:03/DPB1*04:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 941 159
HLA-DRB1*04:04 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1721 291
HLA-DRB1*15:03 PPTSFGPLVRKIFVDG PLTSFGPLVRKIFVDG 2513 425
HLA-DQA1*01:03/DQB1*05:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1344 228
HLA-DRB1*07:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 807 137
HLA-DPA1*03:01/DPB1*04:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 536 91
HLA-DPA1*01:03/DPB1*04:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 811 138
HLA-DPA1*03:01/DPB1*04:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1518 259
HLA-DQA1*01:03/DQB1*05:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 2629 449
HLA-DQA1*01:02/DQB1*05:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1162 199
HLA-DRB1*04:04 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 2456 421
HLA-DRB1*11:02 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 500 86
HLA-DRB1*13:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 500 86
HLA-DPA1*02:02/DPB1*05:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1133 195
HLA-DRB1*08:04 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1644 283
HLA-DPA1*03:01/DPB1*04:02 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 726 125
HLA-DPA1*03:01/DPB1*105:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 726 125
HLA-DRB1*15:03 FPPTSFGPLVRKIFVDGVP FPLTSFGPLVRKIFVDGVP 1936 334
HLA-DPA1*03:01/DPB1*04:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 678 117
HLA-DPA1*03:01/DPB1*04:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 614 106
HLA-DRB1*11:04 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 1149 200
HLA-DPA1*03:01/DPB1*02:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 845 148
HLA-DRB1*01:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 598 105
HLA-DPA1*02:01/DPB1*01:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 2184 386
HLA-DRB1*11:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 2782 492
HLA-DRB1*07:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1210 214
HLA-DRB1*04:04 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 2203 390
HLA-DQA1*01:03/DQB1*05:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2015 358
HLA-DPA1*02:01/DPB1*05:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 2053 366
HLA-DRB1*07:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1520 271
HLA-DRB1*11:02 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 813 145
HLA-DRB1*13:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 813 145
HLA-DQA1*01:03/DQB1*05:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1479 264
HLA-DPA1*01:03/DPB1*02:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 711 127
HLA-DPA1*01:03/DPB1*02:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 827 148
HLA-DRB1*10:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 597 107
HLA-DRB1*11:02 FPPTSFGPLVRKIFVDGV FPLTSFGPLVRKIFVDGV 2068 371
HLA-DRB1*13:01 FPPTSFGPLVRKIFVDGV FPLTSFGPLVRKIFVDGV 2068 371
HLA-DRB1*01:02 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1898 341
HLA-DRB1*11:02 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 461 83
HLA-DRB1*13:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 461 83
HLA-DPA1*01:03/DPB1*04:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1238 223
HLA-DRB1*16:01 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 1463 264
HLA-DPA1*02:02/DPB1*05:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1849 334
HLA-DRB1*01:02 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1594 288
HLA-DPA1*01:03/DPB1*04:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1028 186
HLA-DQA1*01:03/DQB1*05:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1010 183
HLA-DPA1*02:02/DPB1*05:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 844 153
HLA-DPA1*03:01/DPB1*04:02 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1334 242
HLA-DPA1*03:01/DPB1*105:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1334 242
HLA-DPA1*02:01/DPB1*01:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 981 178
HLA-DQA1*01:03/DQB1*05:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1453 264
HLA-DRB1*16:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 808 147
HLA-DPA1*03:01/DPB1*01:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 719 131
HLA-DRB1*11:04 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1015 185
HLA-DRB1*01:02 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 2446 448
HLA-DPA1*02:02/DPB1*05:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1627 298
HLA-DRB1*15:02 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1702 312
HLA-DPA1*03:01/DPB1*05:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1118 205
HLA-DRB1*11:02 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 310 57
HLA-DRB1*13:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 310 57
HLA-DPA1*02:02/DPB1*05:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 2065 380
HLA-DRB1*15:03 PPTSFGPLVRKIFVDGV PLTSFGPLVRKIFVDGV 1840 339
HLA-DRB1*10:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 770 142
HLA-DPA1*01:03/DPB1*02:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 882 163
HLA-DPA1*01:03/DPB1*04:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1336 247
HLA-DPA1*03:01/DPB1*02:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 270 50
HLA-DPA1*01:03/DPB1*01:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1224 227
HLA-DRB1*07:01 HCANFNVLFSTVFPP HCANFNVLFSTVFPL 183 34
HLA-DQA1*01:02/DQB1*05:03 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1920 357
HLA-DPA1*03:01/DPB1*05:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1440 268
HLA-DPA1*01:03/DPB1*04:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1823 340
HLA-DPA1*03:01/DPB1*04:02 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 793 148
HLA-DPA1*03:01/DPB1*105:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 793 148
HLA-DRB1*15:02 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 2483 464
HLA-DPA1*04:01/DPB1*02:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 476 89
HLA-DRB1*04:04 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 2549 477
HLA-DQA1*01:03/DQB1*05:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1067 200
HLA-DPA1*03:01/DPB1*04:02 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 829 156
HLA-DPA1*03:01/DPB1*105:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 829 156
HLA-DRB1*15:03 FNVLFSTVFPPTSFGPLVRK FNVLFSTVFPLTSFGPLVRK 1025 193
HLA-DPA1*03:01/DPB1*04:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 700 132
HLA-DPA1*02:02/DPB1*05:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 970 183
HLA-DPA1*01:03/DPB1*02:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1344 254
HLA-DPA1*01:03/DPB1*04:02 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2513 475
HLA-DPA1*01:03/DPB1*105:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2513 475
HLA-DPA1*04:01/DPB1*02:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 904 171
HLA-DPA1*02:01/DPB1*01:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1049 199
HLA-DRB1*01:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 2428 461
HLA-DPA1*02:01/DPB1*01:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1146 218
HLA-DPA1*02:01/DPB1*01:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1167 222
HLA-DPA1*01:03/DPB1*05:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1665 317
HLA-DPA1*02:01/DPB1*05:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1984 378
HLA-DRB1*15:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 656 125
HLA-DPA1*03:01/DPB1*05:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1652 315
HLA-DPA1*02:02/DPB1*05:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 832 159
HLA-DPA1*03:01/DPB1*05:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1357 260
HLA-DPA1*03:01/DPB1*04:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 934 179
HLA-DPA1*02:01/DPB1*01:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1137 218
HLA-DPA1*02:01/DPB1*01:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1189 228
HLA-DPA1*02:02/DPB1*01:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 547 105
HLA-DPA1*03:01/DPB1*04:02 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 922 177
HLA-DPA1*03:01/DPB1*105:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 922 177
HLA-DRB1*01:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 729 140
HLA-DPA1*03:01/DPB1*05:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1746 336
HLA-DRB1*11:02 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 431 83
HLA-DRB1*13:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 431 83
HLA-DRB1*16:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 877 169
HLA-DPA1*03:01/DPB1*04:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 752 145
HLA-DRB1*15:02 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 2217 429
HLA-DPA1*04:01/DPB1*02:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 470 91
HLA-DRB1*11:04 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 1833 355
HLA-DPA1*03:01/DPB1*06:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1982 385
HLA-DRB1*07:01 LHCANFNVLFSTVFPP LHCANFNVLFSTVFPL 504 98
HLA-DPA1*03:01/DPB1*05:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1454 283
HLA-DRB1*08:04 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 708 138
HLA-DPA1*01:03/DPB1*04:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 2019 394
HLA-DPA1*02:01/DPB1*05:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 2018 394
HLA-DPA1*02:01/DPB1*05:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1689 330
HLA-DRB1*15:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 1566 306
HLA-DQA1*01:02/DQB1*05:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 547 107
HLA-DQA1*01:02/DQB1*05:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 669 131
HLA-DPA1*01:03/DPB1*01:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 766 150
HLA-DQA1*01:03/DQB1*05:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 2509 492
HLA-DPA1*01:03/DPB1*04:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 2231 438
HLA-DPA1*01:03/DPB1*04:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1460 287
HLA-DRB1*01:02 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1718 338
HLA-DPA1*03:01/DPB1*04:02 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 742 146
HLA-DPA1*03:01/DPB1*105:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 742 146
HLA-DPA1*02:02/DPB1*01:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 589 116
HLA-DPA1*03:01/DPB1*06:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1919 378
HLA-DPA1*03:01/DPB1*04:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 319 63
HLA-DQA1*01:02/DQB1*05:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 997 197
HLA-DPA1*01:03/DPB1*01:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1561 309
HLA-DQA1*01:02/DQB1*05:03 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 2155 427
HLA-DPA1*03:01/DPB1*01:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 489 97
HLA-DRB1*15:01 FNVLFSTVFPPTSFGPLVRK FNVLFSTVFPLTSFGPLVRK 615 122
HLA-DPA1*03:01/DPB1*05:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1072 213
HLA-DPA1*01:03/DPB1*01:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1288 256
HLA-DPA1*03:01/DPB1*01:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 562 112
HLA-DPA1*04:01/DPB1*04:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1128 225
HLA-DPA1*01:03/DPB1*02:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 937 187
HLA-DPA1*04:01/DPB1*02:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 435 87
HLA-DPA1*03:01/DPB1*01:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 625 125
HLA-DRB1*11:02 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 439 88
HLA-DRB1*13:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 439 88
HLA-DPA1*03:01/DPB1*04:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 448 90
HLA-DPA1*02:01/DPB1*05:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 2023 407
HLA-DPA1*01:03/DPB1*02:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1143 230
HLA-DPA1*03:01/DPB1*04:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 720 145
HLA-DPA1*01:03/DPB1*02:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 561 113
HLA-DPA1*04:01/DPB1*02:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1241 250
HLA-DPA1*04:01/DPB1*02:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 412 83
HLA-DRB1*11:04 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 243 49
HLA-DPA1*01:03/DPB1*01:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 719 145
HLA-DPA1*03:01/DPB1*05:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1195 241
HLA-DPA1*03:01/DPB1*01:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 570 115
HLA-DPA1*01:03/DPB1*05:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1471 297
HLA-DPA1*01:03/DPB1*01:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 801 162
HLA-DRB1*15:01 FPPTSFGPLVRKIFVDGVP FPLTSFGPLVRKIFVDGVP 1393 282
HLA-DRB1*10:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 553 112
HLA-DPA1*04:01/DPB1*02:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 933 189
HLA-DPA1*03:01/DPB1*04:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 330 67
HLA-DQA1*01:03/DQB1*05:03 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 2374 482
HLA-DPA1*03:01/DPB1*06:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2257 459
HLA-DPA1*02:02/DPB1*05:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 858 175
HLA-DPA1*04:01/DPB1*02:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 528 108
HLA-DQA1*01:03/DQB1*05:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1470 302
HLA-DPA1*04:01/DPB1*05:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1273 262
HLA-DPA1*01:03/DPB1*04:02 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1797 370
HLA-DPA1*01:03/DPB1*105:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1797 370
HLA-DPA1*03:01/DPB1*01:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 767 158
HLA-DRB1*10:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1558 321
HLA-DPA1*03:01/DPB1*02:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 165 34
HLA-DPA1*02:02/DPB1*01:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 551 114
HLA-DPA1*01:03/DPB1*04:02 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1962 406
HLA-DPA1*01:03/DPB1*105:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1962 406
HLA-DPA1*01:03/DPB1*01:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 748 155
HLA-DRB1*07:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1114 231
HLA-DPA1*03:01/DPB1*01:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 487 101
HLA-DRB1*04:04 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1858 386
HLA-DPA1*02:02/DPB1*05:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 746 155
HLA-DPA1*02:02/DPB1*01:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 625 130
HLA-DQA1*01:02/DQB1*05:03 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 2089 435
HLA-DPA1*03:01/DPB1*01:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 898 187
HLA-DQA1*01:03/DQB1*05:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 763 159
HLA-DPA1*01:03/DPB1*04:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 857 179
HLA-DRB1*11:02 PPTSFGPLVRKIFVDG PLTSFGPLVRKIFVDG 1067 223
HLA-DRB1*13:01 PPTSFGPLVRKIFVDG PLTSFGPLVRKIFVDG 1067 223
HLA-DPA1*03:01/DPB1*06:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1866 390
HLA-DPA1*04:01/DPB1*04:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1253 262
HLA-DPA1*01:03/DPB1*01:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 746 156
HLA-DPA1*01:03/DPB1*04:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1018 213
HLA-DRB1*10:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 353 74
HLA-DPA1*01:03/DPB1*05:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1369 287
HLA-DPA1*02:01/DPB1*05:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 2008 421
HLA-DPA1*04:01/DPB1*05:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1091 229
HLA-DPA1*01:03/DPB1*01:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 738 155
HLA-DRB1*10:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 623 131
HLA-DPA1*01:03/DPB1*04:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 584 123
HLA-DPA1*02:01/DPB1*05:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1908 402
HLA-DPA1*03:01/DPB1*04:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 503 106
HLA-DPA1*03:01/DPB1*05:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1744 368
HLA-DPA1*02:02/DPB1*01:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 559 118
HLA-DRB1*01:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 2272 480
HLA-DPA1*03:01/DPB1*02:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 965 204
HLA-DPA1*02:02/DPB1*04:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1130 239
HLA-DPA1*01:03/DPB1*05:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1432 303
HLA-DPA1*02:02/DPB1*04:02 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2323 492
HLA-DPA1*02:02/DPB1*105:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2323 492
HLA-DPA1*02:02/DPB1*02:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1074 228
HLA-DPA1*04:01/DPB1*02:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 395 84
HLA-DPA1*04:01/DPB1*05:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1199 255
HLA-DPA1*02:02/DPB1*01:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 536 114
HLA-DRB1*04:04 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 2058 438
HLA-DPA1*04:01/DPB1*05:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1630 347
HLA-DPA1*03:01/DPB1*04:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 338 72
HLA-DRB1*16:01 FPPTSFGPLVRKIFVDGVP FPLTSFGPLVRKIFVDGVP 1596 340
HLA-DPA1*01:03/DPB1*01:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1905 406
HLA-DPA1*04:01/DPB1*04:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1781 380
HLA-DRB1*01:02 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 712 152
HLA-DPA1*04:01/DPB1*02:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 411 88
HLA-DRB1*15:02 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1680 360
HLA-DRB1*07:01 ILHCANFNVLFSTVFPP ILHCANFNVLFSTVFPL 387 83
HLA-DPA1*01:03/DPB1*01:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 774 166
HLA-DPA1*04:01/DPB1*05:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1364 293
HLA-DPA1*02:02/DPB1*04:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1321 284
HLA-DQA1*01:02/DQB1*05:03 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1952 420
HLA-DPA1*02:01/DPB1*01:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1035 223
HLA-DPA1*03:01/DPB1*06:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 2121 457
HLA-DPA1*02:02/DPB1*05:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 891 192
HLA-DRB1*07:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1122 242
HLA-DPA1*02:02/DPB1*02:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1222 264
HLA-DPA1*04:01/DPB1*04:02 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1424 308
HLA-DPA1*04:01/DPB1*105:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1424 308
HLA-DPA1*02:02/DPB1*11:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1687 365
HLA-DPA1*02:01/DPB1*05:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 2157 467
HLA-DRB1*07:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 660 143
HLA-DQA1*01:02/DQB1*05:03 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1688 366
HLA-DRB1*13:02 HCANFNVLFSTVFPP HCANFNVLFSTVFPL 724 157
HLA-DPA1*01:03/DPB1*04:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 728 158
HLA-DPA1*02:02/DPB1*11:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1823 396
HLA-DPA1*01:03/DPB1*01:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 676 147
HLA-DPA1*04:01/DPB1*04:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 584 127
HLA-DQA1*01:02/DQB1*05:01 PPTSFGPLVRKIFVDG PLTSFGPLVRKIFVDG 1310 285
HLA-DPA1*03:01/DPB1*02:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 363 79
HLA-DQA1*01:03/DQB1*05:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1416 309
HLA-DPA1*03:01/DPB1*05:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 916 200
HLA-DPA1*02:02/DPB1*02:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1215 266
HLA-DPA1*03:01/DPB1*06:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1797 394
HLA-DRB1*12:02 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1354 297
HLA-DRB1*04:04 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 2014 442
HLA-DRB1*07:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 1482 326
HLA-DRB1*15:01 PPTSFGPLVRKIFVDGV PLTSFGPLVRKIFVDGV 1259 277
HLA-DPA1*04:01/DPB1*02:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 559 123
HLA-DPA1*04:01/DPB1*05:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1204 265
HLA-DPA1*03:01/DPB1*02:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 753 166
HLA-DRB1*11:04 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 635 140
HLA-DPA1*04:01/DPB1*04:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 517 114
HLA-DRB1*15:02 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1794 396
HLA-DPA1*04:01/DPB1*04:02 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1425 315
HLA-DPA1*04:01/DPB1*105:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1425 315
HLA-DRB1*11:02 PPTSFGPLVRKIFVDGV PLTSFGPLVRKIFVDGV 787 174
HLA-DRB1*13:01 PPTSFGPLVRKIFVDGV PLTSFGPLVRKIFVDGV 787 174
HLA-DPA1*02:02/DPB1*04:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1274 282
HLA-DPA1*03:01/DPB1*06:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1757 389
HLA-DPA1*04:01/DPB1*01:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 772 171
HLA-DPA1*03:01/DPB1*02:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 176 39
HLA-DRB1*11:04 FNVLFSTVFPPTSFGPLVRK FNVLFSTVFPLTSFGPLVRK 1200 266
HLA-DPA1*02:02/DPB1*05:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1222 271
HLA-DRB1*11:02 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 446 99
HLA-DRB1*13:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 446 99
HLA-DRB1*08:04 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 973 216
HLA-DRB1*08:04 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1067 237
HLA-DPA1*04:01/DPB1*05:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1479 329
HLA-DPA1*04:01/DPB1*04:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 926 206
HLA-DRB1*15:02 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 2232 497
HLA-DPA1*03:01/DPB1*02:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 247 55
HLA-DPA1*04:01/DPB1*04:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 601 134
HLA-DPA1*03:01/DPB1*06:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 2231 498
HLA-DQA1*01:02/DQB1*05:03 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 2046 457
HLA-DPA1*02:02/DPB1*05:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1083 242
HLA-DRB1*04:04 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1301 291
HLA-DPA1*04:01/DPB1*02:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 304 68
HLA-DPA1*03:01/DPB1*04:02 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1631 365
HLA-DPA1*03:01/DPB1*105:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1631 365
HLA-DPA1*04:01/DPB1*01:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 513 115
HLA-DPA1*02:02/DPB1*85:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 2224 499
HLA-DPA1*02:02/DPB1*05:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 909 204
HLA-DPA1*01:03/DPB1*05:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1479 332
HLA-DQA1*01:02/DQB1*05:03 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2016 453
HLA-DPA1*02:02/DPB1*02:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 933 210
HLA-DPA1*01:03/DPB1*02:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 355 80
HLA-DPA1*04:01/DPB1*04:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1193 269
HLA-DPA1*04:01/DPB1*105:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1193 269
HLA-DRB1*11:04 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1418 320
HLA-DPA1*03:01/DPB1*04:02 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 948 214
HLA-DPA1*03:01/DPB1*105:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 948 214
HLA-DPA1*03:01/DPB1*01:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 496 112
HLA-DPA1*02:02/DPB1*11:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1726 390
HLA-DPA1*03:01/DPB1*01:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 588 133
HLA-DPA1*02:01/DPB1*01:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1127 255
HLA-DQA1*01:03/DQB1*05:03 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 2155 488
HLA-DPA1*01:03/DPB1*05:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1538 349
HLA-DPA1*04:01/DPB1*01:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 568 129
HLA-DRB1*08:04 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 2196 499
HLA-DPA1*02:01/DPB1*01:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1130 257
HLA-DQA1*01:02/DQB1*05:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 1497 341
HLA-DPA1*03:01/DPB1*04:02 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1923 439
HLA-DPA1*03:01/DPB1*105:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1923 439
HLA-DQA1*01:03/DQB1*05:03 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1944 444
HLA-DPA1*02:01/DPB1*01:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1291 295
HLA-DRB1*14:04 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1803 412
HLA-DRB1*08:04 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1815 415
HLA-DRB1*12:02 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1633 374
HLA-DPA1*04:01/DPB1*01:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 515 118
HLA-DQA1*01:03/DQB1*06:09 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1893 434
HLA-DPA1*02:01/DPB1*05:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1077 247
HLA-DPA1*03:01/DPB1*05:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 863 198
HLA-DRB1*11:04 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1493 343
HLA-DPA1*02:02/DPB1*13:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1805 415
HLA-DPA1*01:03/DPB1*02:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 2044 470
HLA-DPA1*04:01/DPB1*02:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 474 109
HLA-DPA1*04:01/DPB1*04:02 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1548 356
HLA-DPA1*04:01/DPB1*105:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1548 356
HLA-DPA1*04:01/DPB1*04:02 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1439 331
HLA-DPA1*04:01/DPB1*105:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1439 331
HLA-DPA1*01:03/DPB1*04:02 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 2145 494
HLA-DPA1*01:03/DPB1*105:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 2145 494
HLA-DPA1*04:01/DPB1*02:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 534 123
HLA-DPA1*02:02/DPB1*11:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1639 378
HLA-DPA1*01:03/DPB1*01:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 789 182
HLA-DPA1*02:02/DPB1*04:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1108 256
HLA-DPA1*01:03/DPB1*04:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 623 144
HLA-DQA1*01:03/DQB1*06:09 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1596 369
HLA-DPA1*04:01/DPB1*04:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 592 137
HLA-DRB1*07:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1456 337
HLA-DPA1*01:03/DPB1*05:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1443 334
HLA-DPA1*04:01/DPB1*05:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 920 213
HLA-DPA1*02:01/DPB1*04:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1973 457
HLA-DRB1*07:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1558 361
HLA-DPA1*04:01/DPB1*01:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 500 116
HLA-DRB1*11:04 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 418 97
HLA-DQA1*01:02/DQB1*05:03 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1990 462
HLA-DRB1*15:03 FPPTSFGPLVRKIFVDGVPF FPLTSFGPLVRKIFVDGVPF 969 225
HLA-DPA1*02:02/DPB1*85:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 2140 497
HLA-DPA1*02:02/DPB1*05:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 1614 375
HLA-DRB1*01:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 2060 479
HLA-DPA1*01:03/DPB1*01:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 790 184
HLA-DPA1*02:01/DPB1*05:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1124 262
HLA-DPA1*01:03/DPB1*02:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 536 125
HLA-DPA1*02:02/DPB1*01:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 694 162
HLA-DPA1*04:01/DPB1*02:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 719 168
HLA-DPA1*04:01/DPB1*06:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1677 392
HLA-DPA1*02:02/DPB1*05:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 975 228
HLA-DPA1*04:01/DPB1*04:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 427 100
HLA-DRB1*07:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1304 306
HLA-DPA1*04:01/DPB1*04:02 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1551 364
HLA-DPA1*04:01/DPB1*105:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1551 364
HLA-DPA1*02:02/DPB1*02:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1733 407
HLA-DQA1*01:02/DQB1*05:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 813 191
HLA-DPA1*04:01/DPB1*05:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 983 231
HLA-DPA1*03:01/DPB1*01:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1019 240
HLA-DPA1*02:01/DPB1*02:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1677 395
HLA-DRB1*16:01 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 1333 314
HLA-DPA1*03:01/DPB1*05:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 970 229
HLA-DPA1*02:02/DPB1*04:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1006 238
HLA-DPA1*04:01/DPB1*02:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 819 194
HLA-DPA1*02:01/DPB1*01:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1410 334
HLA-DPA1*01:03/DPB1*01:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 688 163
HLA-DPA1*03:01/DPB1*04:02 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 636 151
HLA-DPA1*03:01/DPB1*105:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 636 151
HLA-DPA1*02:02/DPB1*05:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 884 210
HLA-DPA1*04:01/DPB1*04:02 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1431 340
HLA-DPA1*04:01/DPB1*105:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1431 340
HLA-DPA1*04:01/DPB1*01:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 471 112
HLA-DPA1*03:01/DPB1*01:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 513 122
HLA-DPA1*02:02/DPB1*02:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 992 236
HLA-DPA1*03:01/DPB1*05:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 937 223
HLA-DPA1*02:02/DPB1*06:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1692 403
HLA-DPA1*01:03/DPB1*04:02 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1900 453
HLA-DPA1*01:03/DPB1*105:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1900 453
HLA-DPA1*02:02/DPB1*11:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1740 415
HLA-DRB1*01:02 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1308 312
HLA-DPA1*01:03/DPB1*05:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1383 330
HLA-DPA1*03:01/DPB1*01:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 419 100
HLA-DPA1*04:01/DPB1*02:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 561 134
HLA-DPA1*04:01/DPB1*04:02 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1281 306
HLA-DPA1*04:01/DPB1*105:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1281 306
HLA-DPA1*04:01/DPB1*02:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 360 86
HLA-DPA1*04:01/DPB1*04:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 548 131
HLA-DPA1*02:02/DPB1*11:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1910 457
HLA-DQA1*01:03/DQB1*06:09 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1474 353
HLA-DRB1*16:01 FNVLFSTVFPPTSFGPLVRK FNVLFSTVFPLTSFGPLVRK 676 162
HLA-DRB1*01:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 463 111
HLA-DPA1*04:01/DPB1*04:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 488 117
HLA-DRB1*08:04 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1154 277
HLA-DRB1*10:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 708 170
HLA-DRB1*01:02 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1348 324
HLA-DPA1*03:01/DPB1*04:02 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 524 126
HLA-DPA1*03:01/DPB1*105:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 524 126
HLA-DPA1*03:01/DPB1*01:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 482 116
HLA-DPA1*01:03/DPB1*05:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1246 300
HLA-DRB1*07:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1395 336
HLA-DPA1*01:03/DPB1*01:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 913 220
HLA-DPA1*03:01/DPB1*01:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 390 94
HLA-DRB1*11:02 FPPTSFGPLVRKIFVDGVP FPLTSFGPLVRKIFVDGVP 921 222
HLA-DRB1*13:01 FPPTSFGPLVRKIFVDGVP FPLTSFGPLVRKIFVDGVP 921 222
HLA-DPA1*03:01/DPB1*05:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 539 130
HLA-DPA1*01:03/DPB1*01:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 808 195
HLA-DPA1*04:01/DPB1*01:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 787 190
HLA-DPA1*01:03/DPB1*04:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1356 328
HLA-DPA1*02:02/DPB1*05:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1041 252
HLA-DPA1*04:01/DPB1*01:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 950 230
HLA-DPA1*01:03/DPB1*05:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1548 375
HLA-DPA1*02:02/DPB1*04:02 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2006 486
HLA-DPA1*02:02/DPB1*105:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 2006 486
HLA-DRB1*10:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1761 427
HLA-DPA1*04:01/DPB1*04:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 800 194
HLA-DPA1*01:03/DPB1*02:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 837 203
HLA-DPA1*01:03/DPB1*05:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1942 471
HLA-DPA1*03:01/DPB1*05:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 878 213
HLA-DPA1*02:01/DPB1*05:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1978 480
HLA-DPA1*02:02/DPB1*04:01 FSTVFPPTSFGPLVRKIF FSTVFPLTSFGPLVRKIF 1872 455
HLA-DPA1*01:03/DPB1*05:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1250 304
HLA-DPA1*03:01/DPB1*06:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1828 445
HLA-DPA1*01:03/DPB1*01:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1021 249
HLA-DQA1*01:03/DQB1*05:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1618 395
HLA-DRB1*07:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1286 314
HLA-DRB1*11:04 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 356 87
HLA-DPA1*02:02/DPB1*04:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 957 234
HLA-DPA1*02:02/DPB1*01:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 515 126
HLA-DPA1*03:01/DPB1*01:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 429 105
HLA-DPA1*02:02/DPB1*02:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1070 262
HLA-DRB1*14:01 HCANFNVLFSTVFPP HCANFNVLFSTVFPL 759 186
HLA-DRB1*10:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1530 375
HLA-DQA1*01:03/DQB1*05:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 771 189
HLA-DPA1*04:01/DPB1*05:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 1660 407
HLA-DPA1*02:01/DPB1*02:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1435 352
HLA-DPA1*03:01/DPB1*01:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 493 121
HLA-DQA1*01:02/DQB1*05:03 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1996 491
HLA-DPA1*04:01/DPB1*01:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 443 109
HLA-DPA1*04:01/DPB1*01:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 638 157
HLA-DRB1*01:02 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1445 356
HLA-DPA1*02:01/DPB1*04:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1836 453
HLA-DPA1*02:01/DPB1*05:01 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1624 401
HLA-DPA1*03:01/DPB1*04:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1381 341
HLA-DRB1*15:01 FNVLFSTVFPPTSFGPLVR FNVLFSTVFPLTSFGPLVR 1227 303
HLA-DPA1*02:02/DPB1*05:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 1562 386
HLA-DPA1*02:02/DPB1*05:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 526 130
HLA-DPA1*02:01/DPB1*01:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 809 200
HLA-DPA1*04:01/DPB1*06:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1634 404
HLA-DPA1*02:02/DPB1*01:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 723 179
HLA-DPA1*02:02/DPB1*05:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 561 139
HLA-DPA1*04:01/DPB1*04:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 710 176
HLA-DPA1*04:01/DPB1*06:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1839 456
HLA-DPA1*02:02/DPB1*05:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 846 210
HLA-DRB1*01:02 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1760 437
HLA-DPA1*03:01/DPB1*01:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 451 112
HLA-DPA1*02:02/DPB1*13:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1687 419
HLA-DRB1*15:02 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1344 334
HLA-DPA1*03:01/DPB1*02:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 169 42
HLA-DRB1*14:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1597 397
HLA-DRB1*07:01 HCANFNVLFSTVFPPTS HCANFNVLFSTVFPLTS 209 52
HLA-DPA1*02:01/DPB1*01:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 892 222
HLA-DPA1*04:01/DPB1*01:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 486 121
HLA-DPA1*04:01/DPB1*05:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1010 252
HLA-DPA1*04:01/DPB1*11:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1679 419
HLA-DPA1*04:01/DPB1*04:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 765 191
HLA-DPA1*01:03/DPB1*01:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 941 235
HLA-DPA1*03:01/DPB1*05:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 941 235
HLA-DPA1*02:01/DPB1*05:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 969 242
HLA-DPA1*03:01/DPB1*04:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 276 69
HLA-DPA1*01:03/DPB1*04:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 620 155
HLA-DPA1*02:02/DPB1*04:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1251 313
HLA-DQA1*01:03/DQB1*05:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 915 229
HLA-DRB1*07:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1766 442
HLA-DPA1*04:01/DPB1*05:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1469 368
HLA-DRB1*13:02 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 1990 499
HLA-DRB1*15:01 ANFNVLFSTVFPPTS ANFNVLFSTVFPLTS 287 72
HLA-DRB1*11:04 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 653 164
HLA-DPA1*02:02/DPB1*04:02 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1913 481
HLA-DPA1*02:02/DPB1*105:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1913 481
HLA-DPA1*04:01/DPB1*04:02 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1515 381
HLA-DPA1*04:01/DPB1*105:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1515 381
HLA-DPA1*02:01/DPB1*05:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1160 292
HLA-DRB1*07:01 CANFNVLFSTVFPPT CANFNVLFSTVFPLT 107 27
HLA-DPA1*04:01/DPB1*04:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1295 327
HLA-DQA1*01:03/DQB1*05:03 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1808 457
HLA-DQA1*01:02/DQB1*05:03 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1649 417
HLA-DPA1*04:01/DPB1*01:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 517 131
HLA-DPA1*02:02/DPB1*01:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 442 112
HLA-DPA1*02:02/DPB1*11:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1519 385
HLA-DPA1*02:02/DPB1*01:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 599 152
HLA-DPA1*03:01/DPB1*05:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 642 163
HLA-DRB1*01:02 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1725 438
HLA-DPA1*02:02/DPB1*11:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1630 414
HLA-DPA1*02:02/DPB1*02:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 925 235
HLA-DPA1*03:01/DPB1*06:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1948 495
HLA-DPA1*02:01/DPB1*02:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1578 401
HLA-DPA1*01:03/DPB1*04:02 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1314 334
HLA-DPA1*01:03/DPB1*105:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1314 334
HLA-DRB1*10:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1963 499
HLA-DPA1*02:01/DPB1*01:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1361 346
HLA-DRB1*11:04 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 679 173
HLA-DRB1*11:04 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 435 111
HLA-DQA1*01:03/DQB1*06:09 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1352 345
HLA-DPA1*01:03/DPB1*05:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 1598 408
HLA-DRB1*15:02 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1946 497
HLA-DPA1*01:03/DPB1*01:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 759 194
HLA-DPA1*02:02/DPB1*01:01 TVFPPTSFGPLVRKIFVD TVFPLTSFGPLVRKIFVD 880 225
HLA-DRB1*16:01 PPTSFGPLVRKIFVDG PLTSFGPLVRKIFVDG 1736 444
HLA-DRB1*15:02 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1770 453
HLA-DPA1*02:02/DPB1*13:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1768 453
HLA-DPA1*02:01/DPB1*02:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1635 419
HLA-DPA1*02:02/DPB1*06:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1677 430
HLA-DPA1*03:01/DPB1*01:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 612 157
HLA-DPA1*02:02/DPB1*05:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 1309 336
HLA-DPA1*04:01/DPB1*06:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1455 374
HLA-DPA1*03:01/DPB1*04:02 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 531 137
HLA-DPA1*03:01/DPB1*105:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 531 137
HLA-DRB1*11:04 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1453 375
HLA-DQA1*01:03/DQB1*05:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 1902 491
HLA-DPA1*03:01/DPB1*04:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 515 133
HLA-DPA1*03:01/DPB1*01:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 565 146
HLA-DRB1*01:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 545 141
HLA-DPA1*02:02/DPB1*04:02 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1819 471
HLA-DPA1*02:02/DPB1*105:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1819 471
HLA-DRB1*07:01 CANFNVLFSTVFPPTS CANFNVLFSTVFPLTS 251 65
HLA-DPA1*02:02/DPB1*06:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1506 390
HLA-DPA1*03:01/DPB1*05:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 641 166
HLA-DRB1*01:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 390 101
HLA-DPA1*02:01/DPB1*02:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1656 429
HLA-DPA1*02:02/DPB1*13:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1814 470
HLA-DRB1*01:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 687 178
HLA-DPA1*03:01/DPB1*05:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 790 205
HLA-DPA1*04:01/DPB1*05:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1842 478
HLA-DPA1*02:01/DPB1*01:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1514 393
HLA-DPA1*02:01/DPB1*01:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 574 149
HLA-DPA1*01:03/DPB1*05:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1747 454
HLA-DPA1*02:02/DPB1*04:01 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1112 289
HLA-DPA1*02:02/DPB1*02:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1054 274
HLA-DRB1*14:04 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1015 264
HLA-DRB1*16:01 FPPTSFGPLVRKIFVDGVPF FPLTSFGPLVRKIFVDGVPF 861 224
HLA-DQA1*01:03/DQB1*06:09 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1451 378
HLA-DPA1*03:01/DPB1*06:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1500 391
HLA-DPA1*03:01/DPB1*05:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 817 213
HLA-DPA1*03:01/DPB1*05:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 552 144
HLA-DRB1*08:04 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1514 395
HLA-DPA1*02:02/DPB1*06:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1510 394
HLA-DRB1*01:02 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1437 375
HLA-DPA1*03:01/DPB1*06:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1892 494
HLA-DPA1*02:02/DPB1*04:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1632 427
HLA-DPA1*02:01/DPB1*02:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1589 416
HLA-DPA1*01:03/DPB1*02:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 397 104
HLA-DPA1*02:01/DPB1*02:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1679 440
HLA-DPA1*01:03/DPB1*05:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1357 356
HLA-DRB1*07:01 LHCANFNVLFSTVFPPT LHCANFNVLFSTVFPLT 263 69
HLA-DRB1*11:04 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 586 154
HLA-DPA1*01:03/DPB1*01:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 559 147
HLA-DPA1*03:01/DPB1*04:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 277 73
HLA-DPA1*04:01/DPB1*11:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1569 414
HLA-DRB1*13:02 CANFNVLFSTVFPPT CANFNVLFSTVFPLT 443 117
HLA-DRB1*01:02 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1866 493
HLA-DPA1*03:01/DPB1*05:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1294 342
HLA-DRB1*12:02 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 620 164
HLA-DRB1*01:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 567 150
HLA-DPA1*01:03/DPB1*05:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 782 207
HLA-DPA1*03:01/DPB1*05:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 861 228
HLA-DPA1*04:01/DPB1*01:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1140 302
HLA-DPA1*04:01/DPB1*04:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1117 296
HLA-DRB1*15:01 HCANFNVLFSTVFPPTS HCANFNVLFSTVFPLTS 664 176
HLA-DPA1*02:02/DPB1*06:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1563 415
HLA-DPA1*02:02/DPB1*06:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1438 382
HLA-DPA1*03:01/DPB1*06:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1723 458
HLA-DPA1*04:01/DPB1*04:02 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1376 366
HLA-DPA1*04:01/DPB1*105:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1376 366
HLA-DPA1*04:01/DPB1*04:02 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 969 258
HLA-DPA1*04:01/DPB1*105:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 969 258
HLA-DRB1*07:01 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1066 284
HLA-DPA1*04:01/DPB1*05:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 818 218
HLA-DPA1*03:01/DPB1*01:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 521 139
HLA-DPA1*04:01/DPB1*05:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 873 233
HLA-DPA1*04:01/DPB1*01:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 471 126
HLA-DRB1*08:04 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1420 380
HLA-DRB1*07:01 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 822 220
HLA-DPA1*02:02/DPB1*02:01 STVFPPTSFGPLVRKIFV STVFPLTSFGPLVRKIFV 1651 442
HLA-DPA1*03:01/DPB1*04:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 769 206
HLA-DPA1*04:01/DPB1*02:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 347 93
HLA-DRB1*01:02 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1364 366
HLA-DPA1*02:02/DPB1*13:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1617 434
HLA-DPA1*04:01/DPB1*02:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 570 153
HLA-DPA1*02:02/DPB1*05:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 532 143
HLA-DPA1*04:01/DPB1*06:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1644 442
HLA-DPA1*02:02/DPB1*04:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1086 292
HLA-DPA1*02:02/DPB1*01:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1082 291
HLA-DRB1*15:01 NVLFSTVFPPTSFGPLV NVLFSTVFPLTSFGPLV 1293 348
HLA-DRB1*13:02 ANFNVLFSTVFPPTS ANFNVLFSTVFPLTS 334 90
HLA-DPA1*02:02/DPB1*05:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1012 273
HLA-DRB1*13:02 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 1727 466
HLA-DPA1*03:01/DPB1*01:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 515 139
HLA-DRB1*15:01 CANFNVLFSTVFPPTS CANFNVLFSTVFPLTS 873 236
HLA-DPA1*02:02/DPB1*06:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1457 394
HLA-DPA1*02:02/DPB1*04:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 850 230
HLA-DRB1*14:01 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 1585 429
HLA-DPA1*04:01/DPB1*05:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 955 259
HLA-DRB1*01:02 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1128 306
HLA-DPA1*01:03/DPB1*02:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 350 95
HLA-DRB1*07:01 ANFNVLFSTVFPPTS ANFNVLFSTVFPLTS 81 22
HLA-DRB1*01:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 239 65
HLA-DPA1*04:01/DPB1*04:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 602 164
HLA-DPA1*02:02/DPB1*01:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 466 127
HLA-DPA1*04:01/DPB1*06:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1475 402
HLA-DPA1*04:01/DPB1*04:02 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1289 352
HLA-DPA1*04:01/DPB1*105:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1289 352
HLA-DQA1*01:02/DQB1*05:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 443 121
HLA-DRB1*04:04 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1277 349
HLA-DPA1*04:01/DPB1*01:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 490 134
HLA-DQA1*01:02/DQB1*05:03 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1755 480
HLA-DPA1*03:01/DPB1*04:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 223 61
HLA-DQA1*01:03/DQB1*05:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 537 147
HLA-DPA1*02:02/DPB1*01:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 485 133
HLA-DPA1*01:03/DPB1*04:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 536 147
HLA-DPA1*04:01/DPB1*04:02 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1801 494
HLA-DPA1*04:01/DPB1*105:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1801 494
HLA-DRB1*01:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 550 151
HLA-DPA1*01:03/DPB1*02:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 375 103
HLA-DRB1*16:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 1587 436
HLA-DPA1*01:03/DPB1*02:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1667 458
HLA-DPA1*01:03/DPB1*01:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 626 172
HLA-DPA1*03:01/DPB1*02:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 251 69
HLA-DRB1*15:01 CANFNVLFSTVFPPT CANFNVLFSTVFPLT 400 110
HLA-DPA1*02:01/DPB1*05:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 1185 326
HLA-DRB1*01:02 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 1104 304
HLA-DRB1*08:04 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1179 325
HLA-DRB1*15:03 FNVLFSTVFPPTSFGPLVR FNVLFSTVFPLTSFGPLVR 1741 480
HLA-DPA1*04:01/DPB1*05:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 914 252
HLA-DPA1*02:02/DPB1*02:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 928 256
HLA-DRB1*14:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 844 233
HLA-DQA1*01:03/DQB1*05:03 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1467 405
HLA-DRB1*08:04 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1520 420
HLA-DRB1*15:02 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 1703 471
HLA-DPA1*02:02/DPB1*01:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 611 169
HLA-DPA1*04:01/DPB1*04:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 719 199
HLA-DPA1*04:01/DPB1*04:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 354 98
HLA-DRB1*16:01 PPTSFGPLVRKIFVDGV PLTSFGPLVRKIFVDGV 1563 433
HLA-DPA1*02:01/DPB1*02:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1692 469
HLA-DPA1*04:01/DPB1*05:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1352 375
HLA-DPA1*02:02/DPB1*04:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1121 311
HLA-DRB1*07:01 HCANFNVLFSTVFPPT HCANFNVLFSTVFPLT 306 85
HLA-DRB1*07:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 935 260
HLA-DPA1*04:01/DPB1*02:01 VFPPTSFGPLVRKIFVDG VFPLTSFGPLVRKIFVDG 1208 336
HLA-DPA1*02:02/DPB1*13:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 1526 425
HLA-DPA1*02:01/DPB1*01:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 603 168
HLA-DPA1*04:01/DPB1*05:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 935 261
HLA-DQA1*01:03/DQB1*06:09 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1393 389
HLA-DPA1*03:01/DPB1*04:02 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 1006 281
HLA-DPA1*03:01/DPB1*105:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 1006 281
HLA-DPA1*03:01/DPB1*05:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 372 104
HLA-DPA1*01:03/DPB1*05:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 801 224
HLA-DPA1*04:01/DPB1*04:02 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1466 410
HLA-DPA1*04:01/DPB1*105:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1466 410
HLA-DRB1*07:01 NVLFSTVFPPTSFGPLV NVLFSTVFPLTSFGPLV 522 146
HLA-DRB1*10:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 525 147
HLA-DPA1*03:01/DPB1*06:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1053 295
HLA-DPA1*04:01/DPB1*02:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 264 74
HLA-DRB1*01:02 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 1537 431
HLA-DPA1*03:01/DPB1*04:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1137 319
HLA-DPA1*01:03/DPB1*11:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1659 466
HLA-DRB1*01:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 744 209
HLA-DRB1*11:04 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 548 154
HLA-DRB1*11:04 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 644 181
HLA-DPA1*04:01/DPB1*04:02 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1080 304
HLA-DPA1*04:01/DPB1*105:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1080 304
HLA-DPA1*04:01/DPB1*01:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 515 145
HLA-DPA1*04:01/DPB1*04:02 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 987 278
HLA-DPA1*04:01/DPB1*105:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 987 278
HLA-DPA1*02:02/DPB1*04:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1416 399
HLA-DPA1*04:01/DPB1*01:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 514 145
HLA-DPA1*02:02/DPB1*02:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1074 303
HLA-DPA1*01:03/DPB1*05:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1517 428
HLA-DPA1*04:01/DPB1*06:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1494 422
HLA-DRB1*11:04 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 460 130
HLA-DPA1*02:01/DPB1*01:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 651 184
HLA-DQA1*01:02/DQB1*05:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 350 99
HLA-DRB1*14:01 CANFNVLFSTVFPPT CANFNVLFSTVFPLT 473 134
HLA-DRB1*01:02 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 653 185
HLA-DPA1*02:01/DPB1*04:01 STVFPPTSFGPLVRK STVFPLTSFGPLVRK 1546 438
HLA-DPA1*02:02/DPB1*05:01 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 800 227
HLA-DPA1*02:02/DPB1*11:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1536 436
HLA-DPA1*03:01/DPB1*06:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1179 335
HLA-DRB1*01:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 774 220
HLA-DPA1*04:01/DPB1*05:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1006 286
HLA-DRB1*01:02 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1741 495
HLA-DPA1*02:02/DPB1*02:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 1361 387
HLA-DPA1*02:02/DPB1*13:01 TVFPPTSFGPLVRKI TVFPLTSFGPLVRKI 1716 488
HLA-DPA1*04:01/DPB1*04:02 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1730 492
HLA-DPA1*04:01/DPB1*105:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1730 492
HLA-DPA1*02:02/DPB1*02:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 913 260
HLA-DPA1*03:01/DPB1*04:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1369 390
HLA-DPA1*04:01/DPB1*11:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1428 407
HLA-DPA1*04:01/DPB1*11:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 1575 449
HLA-DPA1*02:02/DPB1*01:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 740 211
HLA-DRB1*07:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 824 235
HLA-DPA1*02:02/DPB1*05:01 PPTSFGPLVRKIFVDG PLTSFGPLVRKIFVDG 1562 446
HLA-DPA1*02:02/DPB1*02:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 957 274
HLA-DPA1*04:01/DPB1*04:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1005 288
HLA-DPA1*01:03/DPB1*01:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1455 417
HLA-DPA1*04:01/DPB1*01:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 572 164
HLA-DPA1*02:02/DPB1*04:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1423 408
HLA-DRB1*01:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 558 160
HLA-DRB1*15:01 NFNVLFSTVFPPTSF NFNVLFSTVFPLTSF 272 78
HLA-DPA1*02:02/DPB1*02:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 711 204
HLA-DRB1*10:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 735 211
HLA-DPA1*04:01/DPB1*04:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 501 144
HLA-DPA1*02:01/DPB1*05:01 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 807 232
HLA-DRB1*14:01 NVLFSTVFPPTSFGP NVLFSTVFPLTSFGP 751 216
HLA-DPA1*02:02/DPB1*05:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 443 128
HLA-DPA1*02:01/DPB1*04:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1442 417
HLA-DPA1*02:02/DPB1*02:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1143 331
HLA-DPA1*03:01/DPB1*02:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 145 42
HLA-DQA1*01:02/DQB1*05:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 497 144
HLA-DQA1*01:03/DQB1*06:09 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1470 426
HLA-DRB1*08:04 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1321 383
HLA-DPA1*02:01/DPB1*01:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 976 283
HLA-DQA1*01:03/DQB1*05:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 469 136
HLA-DRB1*10:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 393 114
HLA-DRB1*11:04 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 386 112
HLA-DPA1*04:01/DPB1*06:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1618 470
HLA-DPA1*03:01/DPB1*02:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 1277 371
HLA-DPA1*02:02/DPB1*04:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1183 344
HLA-DPA1*02:02/DPB1*02:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1076 313
HLA-DPA1*04:01/DPB1*04:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 584 170
HLA-DRB1*08:04 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 848 247
HLA-DRB1*08:04 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 868 253
HLA-DRB1*14:04 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 1200 350
HLA-DQA1*01:03/DQB1*06:09 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1219 356
HLA-DPA1*02:01/DPB1*01:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 568 166
HLA-DRB1*15:02 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 1672 489
HLA-DRB1*14:04 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1634 478
HLA-DRB1*15:02 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 1039 304
HLA-DPA1*02:02/DPB1*06:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1482 434
HLA-DPA1*04:01/DPB1*01:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 618 181
HLA-DPA1*02:01/DPB1*02:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1616 474
HLA-DRB1*04:04 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 958 281
HLA-DPA1*01:03/DPB1*02:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 586 172
HLA-DPA1*04:01/DPB1*04:02 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1049 308
HLA-DPA1*04:01/DPB1*105:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1049 308
HLA-DPA1*02:01/DPB1*02:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1127 331
HLA-DRB1*15:01 NVLFSTVFPPTSFGP NVLFSTVFPLTSFGP 674 198
HLA-DPA1*04:01/DPB1*17:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1673 492
HLA-DRB1*11:04 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 374 110
HLA-DPA1*01:03/DPB1*04:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 527 155
HLA-DRB1*14:04 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1465 431
HLA-DRB1*15:01 NFNVLFSTVFPPTSFGPLVR NFNVLFSTVFPLTSFGPLVR 571 168
HLA-DQA1*01:03/DQB1*05:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 855 252
HLA-DPA1*04:01/DPB1*02:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 536 158
HLA-DRB1*01:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 400 118
HLA-DPA1*03:01/DPB1*04:02 NVLFSTVFPPTSFGPLVR NVLFSTVFPLTSFGPLVR 376 111
HLA-DPA1*03:01/DPB1*105:01 NVLFSTVFPPTSFGPLVR NVLFSTVFPLTSFGPLVR 376 111
HLA-DRB1*14:01 ANFNVLFSTVFPPTS ANFNVLFSTVFPLTS 386 114
HLA-DQA1*01:03/DQB1*05:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 660 195
HLA-DPA1*03:01/DPB1*05:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 968 286
HLA-DPA1*02:02/DPB1*01:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 544 161
HLA-DRB1*15:01 NVLFSTVFPPTSFGPL NVLFSTVFPLTSFGPL 1664 493
HLA-DPA1*02:02/DPB1*85:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1522 451
HLA-DPA1*04:01/DPB1*04:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 388 115
HLA-DPA1*02:02/DPB1*04:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1059 314
HLA-DPA1*04:01/DPB1*02:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 300 89
HLA-DQA1*01:03/DQB1*06:09 FSTVFPPTSFGPLVR FSTVFPLTSFGPLVR 1257 373
HLA-DPA1*04:01/DPB1*04:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 384 114
HLA-DPA1*03:01/DPB1*05:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1054 313
HLA-DPA1*04:01/DPB1*02:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1414 420
HLA-DRB1*13:02 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1390 413
HLA-DPA1*02:02/DPB1*06:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1437 427
HLA-DPA1*03:01/DPB1*01:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 804 239
HLA-DRB1*10:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 612 182
HLA-DPA1*04:01/DPB1*01:01 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 622 185
HLA-DQA1*01:02/DQB1*05:01 FPPTSFGPLVRKIFVDGV FPLTSFGPLVRKIFVDGV 766 228
HLA-DPA1*03:01/DPB1*02:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 141 42
HLA-DRB1*15:02 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1430 426
HLA-DPA1*04:01/DPB1*05:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 536 160
HLA-DPA1*01:03/DPB1*01:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 996 298
HLA-DPA1*03:01/DPB1*02:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 374 112
HLA-DRB1*15:01 FPPTSFGPLVRKIFVDGVPF FPLTSFGPLVRKIFVDGVPF 591 177
HLA-DPA1*02:02/DPB1*13:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1649 494
HLA-DPA1*04:01/DPB1*02:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 237 71
HLA-DRB1*14:04 HCANFNVLFSTVFPP HCANFNVLFSTVFPL 584 175
HLA-DPA1*04:01/DPB1*11:01 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1429 429
HLA-DPA1*04:01/DPB1*13:01 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1592 478
HLA-DQA1*01:03/DQB1*05:03 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1320 397
HLA-DRB1*14:01 CANFNVLFSTVFPPTS CANFNVLFSTVFPLTS 1044 314
HLA-DPA1*02:02/DPB1*05:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 535 161
HLA-DRB1*01:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 671 202
HLA-DPA1*02:02/DPB1*11:01 VFPPTSFGPLVRKIF VFPLTSFGPLVRKIF 1594 480
HLA-DPA1*03:01/DPB1*02:01 FPPTSFGPLVRKIFVDGV FPLTSFGPLVRKIFVDGV 989 298
HLA-DPA1*04:01/DPB1*06:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1420 428
HLA-DRB1*13:02 CANFNVLFSTVFPPTS CANFNVLFSTVFPLTS 859 259
HLA-DRB1*14:04 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 1498 452
HLA-DRB1*15:03 PTSFGPLVRKIFVDG LTSFGPLVRKIFVDG 1487 449
HLA-DQA1*01:02/DQB1*05:03 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1251 378
HLA-DRB1*08:04 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 549 166
HLA-DPA1*03:01/DPB1*05:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 843 255
HLA-DPA1*04:01/DPB1*05:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 707 214
HLA-DRB1*07:01 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 733 222
HLA-DRB1*07:01 NVLFSTVFPPTSFGPL NVLFSTVFPLTSFGPL 604 183
HLA-DRB1*07:01 NVLFSTVFPPTSFGP NVLFSTVFPLTSFGP 198 60
HLA-DQA1*01:03/DQB1*06:09 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1580 479
HLA-DPA1*04:01/DPB1*11:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1110 337
HLA-DRB1*12:02 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 856 260
HLA-DPA1*04:01/DPB1*04:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 434 132
HLA-DPA1*02:02/DPB1*02:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 709 216
HLA-DQA1*01:03/DQB1*06:09 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1285 392
HLA-DPA1*02:02/DPB1*02:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1160 354
HLA-DPA1*04:01/DPB1*05:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 697 213
HLA-DPA1*04:01/DPB1*05:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 589 180
HLA-DPA1*04:01/DPB1*01:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 350 107
HLA-DRB1*01:02 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1223 374
HLA-DPA1*04:01/DPB1*13:01 STVFPPTSFGPLVRKI STVFPLTSFGPLVRKI 1626 498
HLA-DPA1*04:01/DPB1*11:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1603 491
HLA-DPA1*04:01/DPB1*85:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1622 497
HLA-DQA1*01:03/DQB1*06:09 FSTVFPPTSFGPLVRKI FSTVFPLTSFGPLVRKI 1178 361
HLA-DPA1*02:02/DPB1*17:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1494 458
HLA-DQA1*01:02/DQB1*05:03 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1555 477
HLA-DPA1*04:01/DPB1*17:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1435 441
HLA-DPA1*02:02/DPB1*11:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1493 459
HLA-DRB1*11:04 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 374 115
HLA-DRB1*14:04 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1368 421
HLA-DPA1*04:01/DPB1*11:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1588 489
HLA-DRB1*15:03 NFNVLFSTVFPPTSFGPLVR NFNVLFSTVFPLTSFGPLVR 973 300
HLA-DRB1*10:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 619 191
HLA-DPA1*04:01/DPB1*14:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1322 408
HLA-DRB1*07:01 LHCANFNVLFSTVFPPTS LHCANFNVLFSTVFPLTS 881 272
HLA-DQA1*01:03/DQB1*06:09 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1499 463
HLA-DRB1*01:02 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 1018 315
HLA-DRB1*10:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 801 248
HLA-DPA1*04:01/DPB1*06:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1001 310
HLA-DPA1*01:03/DPB1*02:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 977 303
HLA-DPA1*04:01/DPB1*11:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1350 419
HLA-DPA1*02:02/DPB1*01:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 322 100
HLA-DRB1*11:04 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 367 114
HLA-DRB1*10:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 869 270
HLA-DRB1*15:02 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 968 301
HLA-DRB1*08:04 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 871 271
HLA-DPA1*02:01/DPB1*01:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1570 489
HLA-DRB1*12:02 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 921 287
HLA-DPA1*02:02/DPB1*01:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 876 273
HLA-DPA1*03:01/DPB1*01:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 689 215
HLA-DRB1*13:02 HCANFNVLFSTVFPPTS HCANFNVLFSTVFPLTS 839 262
HLA-DPA1*04:01/DPB1*04:02 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 733 229
HLA-DPA1*04:01/DPB1*105:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 733 229
HLA-DQA1*01:03/DQB1*06:09 FSTVFPPTSFGPLVRK FSTVFPLTSFGPLVRK 1285 402
HLA-DQA1*01:03/DQB1*06:09 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1125 352
HLA-DPA1*01:03/DPB1*05:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 600 188
HLA-DPA1*02:02/DPB1*04:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 887 278
HLA-DPA1*02:02/DPB1*01:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 354 111
HLA-DPA1*04:01/DPB1*06:01 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1438 451
HLA-DPA1*03:01/DPB1*04:01 NVLFSTVFPPTSFGPLVR NVLFSTVFPLTSFGPLVR 153 48
HLA-DPA1*04:01/DPB1*04:02 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 1045 328
HLA-DPA1*04:01/DPB1*105:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 1045 328
HLA-DRB1*14:04 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1255 394
HLA-DRB1*10:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 544 171
HLA-DRB1*04:04 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 1412 444
HLA-DPA1*03:01/DPB1*05:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 477 150
HLA-DPA1*02:02/DPB1*85:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1376 433
HLA-DQA1*01:02/DQB1*05:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 467 147
HLA-DPA1*02:01/DPB1*02:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1467 462
HLA-DPA1*04:01/DPB1*11:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1548 488
HLA-DPA1*03:01/DPB1*02:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 666 210
HLA-DPA1*02:02/DPB1*05:01 PPTSFGPLVRKIFVDGV PLTSFGPLVRKIFVDGV 1157 366
HLA-DRB1*14:01 HCANFNVLFSTVFPPTS HCANFNVLFSTVFPLTS 783 248
HLA-DPA1*01:03/DPB1*01:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1439 456
HLA-DPA1*01:03/DPB1*05:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 737 234
HLA-DRB1*14:01 HCANFNVLFSTVFPPT HCANFNVLFSTVFPLT 1209 384
HLA-DPA1*02:02/DPB1*01:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 409 130
HLA-DRB1*11:02 FPPTSFGPLVRKIFVDGVPF FPLTSFGPLVRKIFVDGVPF 440 140
HLA-DRB1*13:01 FPPTSFGPLVRKIFVDGVPF FPLTSFGPLVRKIFVDGVPF 440 140
HLA-DPA1*02:02/DPB1*11:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1096 349
HLA-DPA1*02:02/DPB1*05:01 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 405 129
HLA-DPA1*03:01/DPB1*01:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 229 73
HLA-DPA1*01:03/DPB1*01:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 414 132
HLA-DRB1*04:04 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 922 294
HLA-DRB1*07:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 677 216
HLA-DPA1*04:01/DPB1*01:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 260 83
HLA-DPA1*02:02/DPB1*02:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 742 237
HLA-DRB1*15:01 HCANFNVLFSTVFPP HCANFNVLFSTVFPL 654 209
HLA-DRB1*15:01 NFNVLFSTVFPPTSFGP NFNVLFSTVFPLTSFGP 610 195
HLA-DRB1*07:01 CILHCANFNVLFSTVFPP CILHCANFNVLFSTVFPL 1285 411
HLA-DPA1*02:02/DPB1*01:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 381 122
HLA-DPA1*02:02/DPB1*04:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 1377 441
HLA-DRB1*10:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 493 158
HLA-DPA1*02:02/DPB1*04:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 989 317
HLA-DPA1*04:01/DPB1*06:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 1403 450
HLA-DPA1*04:01/DPB1*11:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 932 299
HLA-DPA1*04:01/DPB1*01:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 408 131
HLA-DRB1*14:04 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 1183 380
HLA-DPA1*03:01/DPB1*05:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 718 231
HLA-DPA1*02:02/DPB1*05:01 FPPTSFGPLVRKIFVDGVP FPLTSFGPLVRKIFVDGVP 1128 363
HLA-DPA1*02:02/DPB1*01:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 820 264
HLA-DRB1*11:01 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 1267 408
HLA-DRB1*14:01 TVFPPTSFGPLVRKIFV TVFPLTSFGPLVRKIFV 1121 361
HLA-DRB1*14:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1419 457
HLA-DPA1*01:03/DPB1*01:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 385 124
HLA-DPA1*04:01/DPB1*01:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 298 96
HLA-DRB1*08:04 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1344 433
HLA-DRB1*12:02 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 1166 376
HLA-DPA1*02:02/DPB1*04:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 950 307
HLA-DRB1*07:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 631 204
HLA-DRB1*01:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 340 110
HLA-DRB1*01:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 494 160
HLA-DRB1*08:04 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 753 244
HLA-DPA1*04:01/DPB1*05:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 777 252
HLA-DPA1*02:02/DPB1*11:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1239 402
HLA-DPA1*04:01/DPB1*02:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 977 317
HLA-DPA1*04:01/DPB1*05:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 1211 393
HLA-DQA1*05:01/DQB1*04:02 LHCANFNVLFSTVFPPTSFG LHCANFNVLFSTVFPLTSFG 391 1204
HLA-DRB1*11:01 TVFPPTSFGPLVRKIF TVFPLTSFGPLVRKIF 902 293
HLA-DPA1*02:02/DPB1*13:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1179 383
HLA-DPA1*03:01/DPB1*06:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1166 379
HLA-DRB1*10:01 LFSTVFPPTSFGPLVRKI LFSTVFPLTSFGPLVRKI 772 251
HLA-DPA1*03:01/DPB1*04:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 575 187
HLA-DPA1*02:02/DPB1*01:01 STVFPPTSFGPLVRKIFVD STVFPLTSFGPLVRKIFVD 455 148
HLA-DPA1*02:02/DPB1*01:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 347 113
HLA-DRB1*15:01 LHCANFNVLFSTVFPPT LHCANFNVLFSTVFPLT 801 261
HLA-DPA1*03:01/DPB1*06:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 982 320
HLA-DRB1*12:02 VFPPTSFGPLVRKIFV VFPLTSFGPLVRKIFV 1031 336
HLA-DPA1*03:01/DPB1*05:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 1423 464
HLA-DPA1*03:01/DPB1*01:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 325 106
HLA-DPA1*02:02/DPB1*04:02 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1353 442
HLA-DPA1*02:02/DPB1*105:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1353 442
HLA-DRB1*14:04 VFPPTSFGPLVRKIFVD VFPLTSFGPLVRKIFVD 1472 481
HLA-DPA1*01:03/DPB1*01:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1091 358
HLA-DPA1*03:01/DPB1*01:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 222 73
HLA-DRB1*08:04 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 967 318
HLA-DRB1*15:01 NFNVLFSTVFPPTSFG NFNVLFSTVFPLTSFG 778 256
HLA-DRB1*11:01 STVFPPTSFGPLVRKIF STVFPLTSFGPLVRKIF 729 240
HLA-DPA1*02:02/DPB1*13:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1315 433
HLA-DRB1*13:02 HCANFNVLFSTVFPPT HCANFNVLFSTVFPLT 929 306
HLA-DRB1*15:01 CANFNVLFSTVFPPTSF CANFNVLFSTVFPLTSF 516 170
HLA-DPA1*03:01/DPB1*11:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1453 479
HLA-DRB1*10:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 779 257
HLA-DRB1*14:04 NVLFSTVFPPTSFGP NVLFSTVFPLTSFGP 612 202
HLA-DPA1*03:01/DPB1*01:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 239 79
HLA-DPA1*04:01/DPB1*06:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 850 281
HLA-DPA1*02:02/DPB1*04:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 853 282
HLA-DRB1*15:01 PTSFGPLVRKIFVDG LTSFGPLVRKIFVDG 1116 369
HLA-DRB1*07:01 ILHCANFNVLFSTVFPPTS ILHCANFNVLFSTVFPLTS 381 126
HLA-DPA1*03:01/DPB1*06:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 967 320
HLA-DPA1*03:01/DPB1*11:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1106 366
HLA-DPA1*02:02/DPB1*04:02 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1494 495
HLA-DPA1*02:02/DPB1*105:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1494 495
HLA-DPA1*04:01/DPB1*02:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 359 119
HLA-DPA1*02:02/DPB1*05:01 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 763 253
HLA-DPA1*02:01/DPB1*01:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 612 203
HLA-DPA1*04:01/DPB1*04:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 705 234
HLA-DPA1*02:02/DPB1*13:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1196 397
HLA-DRB1*08:04 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 765 254
HLA-DPA1*04:01/DPB1*02:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 274 91
HLA-DPA1*04:01/DPB1*05:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1141 379
HLA-DPA1*02:02/DPB1*06:01 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1426 474
HLA-DPA1*02:02/DPB1*05:01 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 403 134
HLA-DPA1*02:01/DPB1*01:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 459 153
HLA-DPA1*02:02/DPB1*01:01 TVFPPTSFGPLVRKIFVDG TVFPLTSFGPLVRKIFVDG 549 183
HLA-DPA1*04:01/DPB1*05:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 951 317
HLA-DPA1*04:01/DPB1*04:02 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 962 321
HLA-DPA1*04:01/DPB1*105:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 962 321
HLA-DPA1*02:01/DPB1*05:01 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 701 234
HLA-DPA1*01:03/DPB1*01:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 617 206
HLA-DPA1*02:02/DPB1*11:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 1207 403
HLA-DRB1*14:04 CANFNVLFSTVFPPT CANFNVLFSTVFPLT 383 128
HLA-DPA1*02:02/DPB1*09:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1337 447
HLA-DPA1*04:01/DPB1*17:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1118 374
HLA-DRB1*14:01 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 1231 412
HLA-DPA1*02:02/DPB1*04:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 1081 362
HLA-DPA1*02:01/DPB1*02:01 VLFSTVFPPTSFGPLVRK VLFSTVFPLTSFGPLVRK 1296 434
HLA-DRB1*15:01 HCANFNVLFSTVFPPT HCANFNVLFSTVFPLT 1018 341
HLA-DRB1*14:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1252 420
HLA-DPA1*03:01/DPB1*01:01 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 780 262
HLA-DRB1*13:02 NVLFSTVFPPTSFGP NVLFSTVFPLTSFGP 749 252
HLA-DQA1*01:02/DQB1*05:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 264 89
HLA-DRB1*11:04 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 157 53
HLA-DRB1*11:04 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 361 122
HLA-DPA1*04:01/DPB1*85:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1328 449
HLA-DPA1*02:01/DPB1*05:01 NVLFSTVFPPTSFGPLVRK NVLFSTVFPLTSFGPLVRK 1192 404
HLA-DRB1*07:01 NVLFSTVFPPTSFGPLVRKI NVLFSTVFPLTSFGPLVRKI 475 161
HLA-DPA1*02:02/DPB1*02:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 740 251
HLA-DRB1*07:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 604 205
HLA-DPA1*03:01/DPB1*06:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 948 322
HLA-DPA1*04:01/DPB1*06:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1014 345
HLA-DRB1*11:04 FPPTSFGPLVRKIFVDGV FPLTSFGPLVRKIFVDGV 1458 497
HLA-DPA1*04:01/DPB1*01:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 261 89
HLA-DRB1*15:01 ANFNVLFSTVFPPTSFG ANFNVLFSTVFPLTSFG 519 177
HLA-DPA1*04:01/DPB1*01:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 774 264
HLA-DPA1*01:03/DPB1*05:01 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 812 277
HLA-DPA1*04:01/DPB1*06:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1049 358
HLA-DPA1*04:01/DPB1*05:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1028 351
HLA-DPA1*03:01/DPB1*01:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 205 70
HLA-DPA1*04:01/DPB1*14:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1086 371
HLA-DPA1*01:03/DPB1*11:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1082 370
HLA-DRB1*11:04 FPPTSFGPLVRKIFVDGVP FPLTSFGPLVRKIFVDGVP 689 236
HLA-DRB1*13:02 LHCANFNVLFSTVFPP LHCANFNVLFSTVFPL 892 306
HLA-DPA1*02:02/DPB1*17:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1198 411
HLA-DRB1*12:02 FPPTSFGPLVRKIFVDG FPLTSFGPLVRKIFVDG 1017 349
HLA-DPA1*03:01/DPB1*04:02 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 271 93
HLA-DPA1*03:01/DPB1*105:01 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 271 93
HLA-DPA1*02:01/DPB1*02:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 1226 421
HLA-DPA1*03:01/DPB1*11:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1193 410
HLA-DPA1*02:02/DPB1*02:01 FPPTSFGPLVRKIFV FPLTSFGPLVRKIFV 1195 411
HLA-DPA1*02:02/DPB1*85:01 LFSTVFPPTSFGPLVRKIFV LFSTVFPLTSFGPLVRKIFV 1055 363
HLA-DPA1*03:01/DPB1*02:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 276 95
HLA-DPA1*02:02/DPB1*11:01 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1205 415
HLA-DQA1*01:03/DQB1*06:09 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1080 372
HLA-DPA1*03:01/DPB1*05:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 470 162
HLA-DPA1*04:01/DPB1*14:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1206 416
HLA-DRB1*14:04 NVLFSTVFPPTSFGPLV NVLFSTVFPLTSFGPLV 1177 406
HLA-DRB1*07:01 VLFSTVFPPTSFGPLVRKIF VLFSTVFPLTSFGPLVRKIF 571 197
HLA-DPA1*04:01/DPB1*04:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 1243 429
HLA-DRB1*01:02 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 1151 398
HLA-DRB1*07:01 PPTSFGPLVRKIFVD PLTSFGPLVRKIFVD 1067 369
HLA-DQA1*01:03/DQB1*05:01 VFPPTSFGPLVRKIFVDGVP VFPLTSFGPLVRKIFVDGVP 373 129
HLA-DPA1*03:01/DPB1*13:01 FSTVFPPTSFGPLVRKIFVD FSTVFPLTSFGPLVRKIFVD 1275 441
HLA-DPA1*01:03/DPB1*05:01 VLFSTVFPPTSFGPLVRKI VLFSTVFPLTSFGPLVRKI 815 282
HLA-DQA1*01:02/DQB1*05:01 VFPPTSFGPLVRKIFVDGV VFPLTSFGPLVRKIFVDGV 361 125
HLA-DPA1*04:01/DPB1*03:01 STVFPPTSFGPLVRKIFVDG STVFPLTSFGPLVRKIFVDG 1418 491
HLA-DPA1*03:01/DPB1*11:01 LFSTVFPPTSFGPLVR LFSTVFPLTSFGPLVR 1005 348
HLA-DQA1*01:02/DQB1*05:03 LFSTVFPPTSFGPLVRKIF LFSTVFPLTSFGPLVRKIF 1301 451
HLA-DPA1*04:01/DPB1*01:01 FPPTSFGPLVRKIFVD FPLTSFGPLVRKIFVD 833 289
HLA-DPA1*04:01/DPB1*02:01 LFSTVFPPTSFGPLV LFSTVFPLTSFGPLV 242 84
HLA-DRB1*12:02 FSTVFPPTSFGPLVRKIFV FSTVFPLTSFGPLVRKIFV 1279 444
HLA-DPA1*04:01/DPB1*04:02 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1103 383
HLA-DPA1*04:01/DPB1*105:01 TVFPPTSFGPLVRKIFVDGV TVFPLTSFGPLVRKIFVDGV 1103 383
HLA-DRB1*14:01 LHCANFNVLFSTVFPPT LHCANFNVLFSTVFPLT 881 306
HLA-DPA1*04:01/DPB1*14:01 LFSTVFPPTSFGPLVRK LFSTVFPLTSFGPLVRK 1410 490
HLA-DPA1*03:01/DPB1*04:02 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 210 73
HLA-DPA1*03:01/DPB1*105:01 VLFSTVFPPTSFGPLVR VLFSTVFPLTSFGPLVR 210 73
HLA-DPA1*02:01/DPB1*02:01