Summary

This strain contains 56 protein-level mutations:

  • 29 mutations in Spike protein: Q52H, G142D, H146Q, Q183E, V213E, G252V, G339H, L368I, S371F, S373P, 375-376 ST->FA, D405N, R408S, N440K, 445-446 VG->PS, F456L, N460K, 477-478 ST->NK, E484A, F486P, F490S, Q498R, N501Y, Y505H, D614G, H655Y, N679K, D796Y, N969K
  • 3 mutations in N protein: P13L, 203-204 RG->KR, S413R
  • 1 mutation in M protein: Q19E
  • 2 mutations in E protein: T9I, T11A
  • 1 mutation in NS3 protein: T223I
  • 1 mutation in NS8 protein: G8stop
  • 2 mutations in NS9b protein: I5T, P10S
  • 1 mutation in NS9c protein: G50N
  • 2 mutations in NSP1 protein: K47R, S135R
  • 1 mutation in NSP2 protein: A510V
  • 3 mutations in NSP3 protein: T24I, G489S, G1001S
  • 4 mutations in NSP4 protein: T327I, A380V, L438F, T492I
  • 1 mutation in NSP5 protein: P132H
  • 1 mutation in NSP9 protein: T35I
  • 1 mutation in NSP12 protein: G671S
  • 2 mutations in NSP13 protein: S36P, R392C
  • 1 mutation in NSP15 protein: T112I

We identified all possible linear viral peptides affected by these mutations. Whenever it was possible, we matched the reference peptide with the mutated one. For example, D -> L mutation transformed SDNGPQNQR to SLNGPQNQR. Cases when it was not meaningful included deletions and insertions at the flanks of the peptide, e.g., HV deletion in NVTWFHAIHV peptide.

Then, we predicted binding affinities between the selected peptides and frequent HLA alleles. Predictions were made with NetMHCpan-4.1 and NetMHCIIpan-4.0. The binding affinities were classifies into three groups:

  1. Tight binding (IC50 affinity ≤ 50 nM)
  2. Moderate binding (50 nM < IC50 affinity ≤ 500 nM)
  3. Weak/no binding (IC50 affinity > 500 nM)

Here we report HLA-peptide interactions whose affinity was altered by at least two folds. Note that mutations with empty set of altered interactions are not showed.

The total number of HLA-peptide interactions affected by the mutations

For each allele we calculated the number of peptides with increased and decreased affinitiy (two or more times). The absolute number of such peptides is showed on the left side of the figure (blue bars — weaker binding, orange bars — stronger).

While absolute numbers are of interest, they do not reflect the initial number of tighly binding peptides for the specific allele. Roughly speaking, if an allele had high number of tight binders, then vanished affinity of several peptides will not affect much the integral ability of peptide presentation. To the contrary, low number of vanished peptides could be important if the particular allele initially had narrow epitope repertoire. To account for this effect, we normalized the absolute numbers of new/vanished tight binders (IC50 affinity ≤ 50 nM) by the total number of tight binders for each allele. To avoid possible divisions by zero, we used + 1 regularization term in all denominators. For example, if some allele had no tight binders in the reference genome, and three new tight binders appeared as a result of the mutation, the relative increase will be 300%. The results are showed in the right part of the figure. Protein-specific plots are listed below.

Summary

Spike protein

Spike

Q52H

Reference  AYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    AYTNSFTRGVYYPDKVFRSSVLHSTHDLFLPFFSNVTWFHAIHVSGTNGTK

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:06 TQDLFLPFFSNV THDLFLPFFSNV 107 7111
HLA-B*15:03 TQDLFLPF THDLFLPF 47 840
HLA-B*15:03 RSSVLHSTQ RSSVLHSTH 4588 262
HLA-B*15:03 TQDLFLPFF THDLFLPFF 185 2288
HLA-B*38:01 TQDLFLPFF THDLFLPFF 3671 318
HLA-A*30:02 RSSVLHSTQ RSSVLHSTH 2490 225
HLA-C*12:03 STQDLFLPF STHDLFLPF 279 49
HLA-A*26:01 STQDLFLPF STHDLFLPF 627 122
HLA-A*25:01 STQDLFLPF STHDLFLPF 1873 410
HLA-C*12:02 STQDLFLPF STHDLFLPF 316 79
HLA-C*02:02 STQDLFLPF STHDLFLPF 443 127
HLA-C*02:10 STQDLFLPF STHDLFLPF 443 127
HLA-A*23:01 VLHSTQDLF VLHSTHDLF 752 238
HLA-A*24:02 VLHSTQDLF VLHSTHDLF 1151 374
HLA-C*03:03 STQDLFLPF STHDLFLPF 288 96
HLA-C*03:04 STQDLFLPF STHDLFLPF 288 96
HLA-B*53:01 QDLFLPFFSNVTW HDLFLPFFSNVTW 151 54
HLA-B*15:01 STQDLFLPFF STHDLFLPFF 230 83
HLA-B*35:01 STQDLFLPF STHDLFLPF 317 115
HLA-B*15:01 STQDLFLPF STHDLFLPF 48 18
HLA-B*15:03 STQDLFLPF STHDLFLPF 26 10
HLA-C*03:02 STQDLFLPFF STHDLFLPFF 857 341
HLA-C*03:02 STQDLFLPF STHDLFLPF 24 10
HLA-B*15:03 VLHSTQDLF VLHSTHDLF 48 21
HLA-A*68:02 STQDLFLPFFSNV STHDLFLPFFSNV 227 100
HLA-B*15:01 HSTQDLFLPF HSTHDLFLPF 170 78
HLA-C*16:01 STQDLFLPF STHDLFLPF 40 20

G142D

Reference  LLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    LLIVNNATNVVIKVCEFQFCNDPFLDVYYQKNNKSWMESEFRVYSSANNCT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*03:01 GVYYHKNNK DVYYQKNNK 27 4630
HLA-A*30:01 GVYYHKNNK DVYYQKNNK 51 7391
HLA-A*11:01 GVYYHKNNK DVYYQKNNK 51 2839
HLA-A*03:02 GVYYHKNNK DVYYQKNNK 119 5703
HLA-A*31:01 GVYYHKNNK DVYYQKNNK 375 9562
HLA-A*68:02 FCNDPFLGV FCNDPFLDV 281 3555
HLA-A*68:01 GVYYHKNNK DVYYQKNNK 363 33
HLA-A*02:06 FCNDPFLGV FCNDPFLDV 116 1132
HLA-A*02:11 FCNDPFLGV FCNDPFLDV 87 751
HLA-A*02:06 EFQFCNDPFLGV EFQFCNDPFLDV 87 554
HLA-A*30:02 CNDPFLGVY CNDPFLDVY 310 1959
HLA-A*02:02 FCNDPFLGV FCNDPFLDV 365 2187
HLA-A*02:06 FQFCNDPFLGVY FQFCNDPFLDVY 135 784
HLA-A*30:02 FCNDPFLGVY FCNDPFLDVY 408 1738
HLA-A*02:11 EFQFCNDPFLGV EFQFCNDPFLDV 334 1214
HLA-A*02:02 EFQFCNDPFLGV EFQFCNDPFLDV 477 1725
HLA-A*02:11 FQFCNDPFLGVY FQFCNDPFLDVY 488 1737
HLA-A*02:06 FQFCNDPFLGV FQFCNDPFLDV 7 21
HLA-A*02:11 FQFCNDPFLGV FQFCNDPFLDV 17 49
HLA-A*02:01 FQFCNDPFLGV FQFCNDPFLDV 39 111
HLA-A*30:02 FQFCNDPFLGVY FQFCNDPFLDVY 336 923
HLA-A*02:02 FQFCNDPFLGV FQFCNDPFLDV 45 122
HLA-B*15:01 FQFCNDPFLGVY FQFCNDPFLDVY 28 56

H146Q

Reference  NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NNATNVVIKVCEFQFCNDPFLDVYYQKNNKSWMESEFRVYSSANNCTFEYV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*03:01 GVYYHKNNK DVYYQKNNK 27 4630
HLA-A*30:01 GVYYHKNNK DVYYQKNNK 51 7391
HLA-B*15:01 YHKNNKSWMESEF YQKNNKSWMESEF 15739 226
HLA-B*15:01 YHKNNKSWM YQKNNKSWM 18557 271
HLA-A*11:01 GVYYHKNNK DVYYQKNNK 51 2839
HLA-A*03:02 GVYYHKNNK DVYYQKNNK 119 5703
HLA-A*31:01 GVYYHKNNK DVYYQKNNK 375 9562
HLA-B*15:03 YHKNNKSWM YQKNNKSWM 1065 50
HLA-A*68:01 GVYYHKNNK DVYYQKNNK 363 33
HLA-B*15:03 YHKNNKSWMESEF YQKNNKSWMESEF 1283 143
HLA-A*24:02 YYHKNNKSW YYQKNNKSW 116 58

Q183E

Reference  RVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    RVYSSANNCTFEYVSQPFLMDLEGKEGNFKNLREFVFKNIDGYFKIYSKHT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*31:01 KQGNFKNLR KEGNFKNLR 17 1692
HLA-B*15:03 KQGNFKNLREF KEGNFKNLREF 42 1050
HLA-A*31:01 GKQGNFKNLR GKEGNFKNLR 475 9702
HLA-B*15:03 KQGNFKNLREFVF KEGNFKNLREFVF 323 2837

V213E

Reference  NLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NLREFVFKNIDGYFKIYSKHTPINLERDLPQGFSALEPLVDLPIGINITRF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:02 YSKHTPINLV YSKHTPINLE 199 19799
HLA-B*18:01 LVRDLPQGF LERDLPQGF 22292 292
HLA-C*03:02 LVRDLPQGF LERDLPQGF 259 18781
HLA-A*02:11 KIYSKHTPINLV KIYSKHTPINLE 104 7199
HLA-B*40:02 LVRDLPQGFSAL LERDLPQGFSAL 17495 450
HLA-B*15:01 LVRDLPQGF LERDLPQGF 160 2582
HLA-C*01:02 VRDLPQGFSAL ERDLPQGFSAL 431 4216
HLA-B*42:01 TPINLVRDL TPINLERDL 43 173
HLA-B*42:01 HTPINLVRDL HTPINLERDL 250 983
HLA-B*07:02 TPINLVRDL TPINLERDL 213 783

G252V

Reference  VDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLL
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    VDLPIGINITRFQTLLALHRSYLTPVDSSSGWTAGAAAYYVGYLQPRTFLL

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 ALHRSYLTPG ALHRSYLTPV 4436 4
HLA-A*02:11 LLALHRSYLTPG LLALHRSYLTPV 7838 8
HLA-A*02:11 TLLALHRSYLTPG TLLALHRSYLTPV 8711 10
HLA-A*02:01 LLALHRSYLTPG LLALHRSYLTPV 9878 21
HLA-A*02:01 TLLALHRSYLTPG TLLALHRSYLTPV 10594 23
HLA-A*02:01 ALHRSYLTPG ALHRSYLTPV 6642 16
HLA-A*02:06 LLALHRSYLTPG LLALHRSYLTPV 9207 43
HLA-A*02:11 LALHRSYLTPG LALHRSYLTPV 28444 138
HLA-A*02:02 LLALHRSYLTPG LLALHRSYLTPV 2378 12
HLA-A*02:06 TLLALHRSYLTPG TLLALHRSYLTPV 9182 52
HLA-A*02:06 ALHRSYLTPG ALHRSYLTPV 6087 35
HLA-A*02:06 LALHRSYLTPG LALHRSYLTPV 22059 160
HLA-A*02:02 ALHRSYLTPG ALHRSYLTPV 1151 9
HLA-A*02:02 TLLALHRSYLTPG TLLALHRSYLTPV 7652 69
HLA-A*02:11 ALHRSYLTPGD ALHRSYLTPVD 28201 286
HLA-A*02:11 QTLLALHRSYLTPG QTLLALHRSYLTPV 32560 497
HLA-A*02:06 QTLLALHRSYLTPG QTLLALHRSYLTPV 26144 414
HLA-B*53:01 SYLTPGDSSSGW SYLTPVDSSSGW 3334 494
HLA-B*15:03 LHRSYLTPG LHRSYLTPV 1291 238
HLA-B*53:01 LTPGDSSSGW LTPVDSSSGW 216 40
HLA-B*58:01 LTPGDSSSGW LTPVDSSSGW 180 36
HLA-B*53:01 YLTPGDSSSGW YLTPVDSSSGW 263 57
HLA-B*57:01 LTPGDSSSGW LTPVDSSSGW 482 105
HLA-B*53:01 TPGDSSSGW TPVDSSSGW 134 37
HLA-B*58:01 YLTPGDSSSGW YLTPVDSSSGW 996 302
HLA-A*02:02 YLTPGDSSS YLTPVDSSS 1041 326

G339H

Reference  QTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVAD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    QTSNFRVQPTESIVRFPNITNLCPFHEVFNATRFASVYAWNRKRISNCVAD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*38:01 FGEVFNATRF FHEVFNATRF 16707 192
HLA-B*18:01 GEVFNATRF HEVFNATRF 971 105
HLA-A*68:01 FGEVFNATR FHEVFNATR 338 3072
HLA-A*02:11 NLCPFGEV NLCPFHEV 2369 286
HLA-B*18:01 GEVFNATRFASVY HEVFNATRFASVY 2165 288
HLA-A*02:11 NITNLCPFGEV NITNLCPFHEV 1609 422
HLA-A*68:02 GEVFNATRFA HEVFNATRFA 879 281
HLA-A*02:06 ITNLCPFGEV ITNLCPFHEV 324 104
HLA-A*33:03 PFGEVFNATR PFHEVFNATR 1029 341
HLA-A*30:01 GEVFNATRFASVYA HEVFNATRFASVYA 759 255
HLA-B*15:03 GEVFNATRF HEVFNATRF 359 122
HLA-A*30:01 GEVFNATRFA HEVFNATRFA 748 256
HLA-A*02:11 ITNLCPFGEV ITNLCPFHEV 412 147
HLA-B*15:03 FGEVFNATRF FHEVFNATRF 694 256
HLA-A*02:02 NLCPFGEVFNA NLCPFHEVFNA 182 472
HLA-A*68:02 TNLCPFGEV TNLCPFHEV 963 398
HLA-A*02:01 NLCPFGEVFNA NLCPFHEVFNA 164 354
HLA-B*15:03 GEVFNATRFASVY HEVFNATRFASVY 1058 494

L368I

Reference  NATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NATRFASVYAWNRKRISNCVADYSVIYNFAPFFAFKCYGVSPTKLNDLCFT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*32:01 VLYNSASFS VIYNFAPFF 22186 48
HLA-A*23:01 LYNSASFS IYNFAPFF 22508 99
HLA-A*24:02 LYNSASFS IYNFAPFF 25164 136
HLA-A*23:01 VLYNSASFS VIYNFAPFF 32767 178
HLA-A*29:02 VLYNSASFS VIYNFAPFF 10439 76
HLA-C*03:02 VLYNSASFS VIYNFAPFF 13004 100
HLA-B*15:03 VLYNSASFS VIYNFAPFF 3280 27
HLA-A*26:01 SVLYNSASFS SVIYNFAPFF 21993 202
HLA-C*14:02 LYNSASFS IYNFAPFF 5693 80
HLA-C*05:01 VADYSVLYNS VADYSVIYNF 11802 172
HLA-A*32:01 SVLYNSASFS SVIYNFAPFF 14340 227
HLA-A*29:02 SVLYNSASFS SVIYNFAPFF 16185 274
HLA-B*15:01 SVLYNSASFS SVIYNFAPFF 2838 50
HLA-A*26:01 SVLYNSASF SVIYNFAPF 1313 24
HLA-A*23:01 SVLYNSASFS SVIYNFAPFF 24524 498
HLA-C*03:02 SVLYNSASFS SVIYNFAPFF 8888 192
HLA-A*68:02 SVLYNSASFST SVIYNFAPFFA 14147 319
HLA-B*58:01 VADYSVLYNS VADYSVIYNF 6124 141
HLA-C*16:01 VLYNSASFS VIYNFAPFF 18639 432
HLA-B*15:03 SVLYNSASFS SVIYNFAPFF 2850 68
HLA-A*23:01 DYSVLYNSASFS DYSVIYNFAPFF 14260 341
HLA-C*03:02 VADYSVLYNS VADYSVIYNF 20606 498
HLA-A*68:02 VLYNSASFST VIYNFAPFFA 11417 297
HLA-A*25:01 SVLYNSASF SVIYNFAPF 2252 59
HLA-C*12:03 VLYNSASFS VIYNFAPFF 12383 333
HLA-C*14:02 VLYNSASFS VIYNFAPFF 11085 360
HLA-A*68:02 SVLYNSASF SVIYNFAPF 6927 241
HLA-B*15:01 VLYNSASFS VIYNFAPFF 8189 317
HLA-B*57:01 VADYSVLYNS VADYSVIYNF 11273 446
HLA-B*58:01 YSVLYNSASFS YSVIYNFAPFF 6920 277
HLA-A*02:06 SVLYNSASF SVIYNFAPF 2112 98
HLA-A*02:06 SVLYNSASFST SVIYNFAPFFA 4097 193
HLA-A*68:01 SVLYNSASF SVIYNFAPF 6337 311
HLA-B*15:01 VLYNSASFSTF VIYNFAPFFAF 50 951
HLA-B*40:02 ADYSVLYNS ADYSVIYNF 4645 272
HLA-B*15:03 YSVLYNSASFS YSVIYNFAPFF 3170 196
HLA-A*11:01 LYNSASFSTFK IYNFAPFFAFK 43 681
HLA-A*26:01 YSVLYNSASF YSVIYNFAPF 1544 107
HLA-A*02:06 VLYNSASFST VIYNFAPFFA 710 58
HLA-A*30:01 LYNSASFST IYNFAPFFA 3467 316
HLA-C*03:02 YSVLYNSASFS YSVIYNFAPFF 2405 260
HLA-A*02:11 SVLYNSASFST SVIYNFAPFFA 3830 425
HLA-A*33:03 SVLYNSASFSTFK SVIYNFAPFFAFK 2778 320
HLA-C*12:02 SVLYNSASF SVIYNFAPF 507 63
HLA-A*25:01 YSVLYNSASF YSVIYNFAPF 2498 338
HLA-A*23:01 SVLYNSASF SVIYNFAPF 990 145
HLA-A*30:02 VLYNSASFS VIYNFAPFF 2919 448
HLA-A*02:06 YSVLYNSASF YSVIYNFAPF 2478 397
HLA-B*15:03 VLYNSASFSTF VIYNFAPFFAF 38 235
HLA-A*29:02 LYNSASFSTF IYNFAPFFAF 387 63
HLA-A*29:02 SVLYNSASF SVIYNFAPF 1130 186
HLA-C*12:03 SVLYNSASF SVIYNFAPF 748 127
HLA-A*29:02 SNCVADYSVLY SNCVADYSVIY 83 483
HLA-A*31:01 SVLYNSASFSTFK SVIYNFAPFFAFK 857 150
HLA-A*02:01 VLYNSASFST VIYNFAPFFA 243 43
HLA-A*29:02 NCVADYSVLY NCVADYSVIY 57 320
HLA-A*29:02 ISNCVADYSVLY ISNCVADYSVIY 116 625
HLA-A*03:01 VLYNSASFSTFKC VIYNFAPFFAFKC 312 1619
HLA-A*29:02 RISNCVADYSVLY RISNCVADYSVIY 249 1271
HLA-C*02:02 SVLYNSASF SVIYNFAPF 1090 218
HLA-C*02:10 SVLYNSASF SVIYNFAPF 1090 218
HLA-A*01:01 CVADYSVLY CVADYSVIY 76 367
HLA-A*24:02 SVLYNSASF SVIYNFAPF 1977 410
HLA-A*03:01 LYNSASFSTFK IYNFAPFFAFK 295 1419
HLA-A*01:01 VADYSVLY VADYSVIY 339 1549
HLA-B*15:01 SVLYNSASF SVIYNFAPF 52 12
HLA-B*35:01 SVLYNSASF SVIYNFAPF 153 36
HLA-A*02:02 VLYNSASFST VIYNFAPFFA 202 49
HLA-A*31:01 VLYNSASFSTFK VIYNFAPFFAFK 565 139
HLA-A*11:01 CVADYSVLY CVADYSVIY 169 673
HLA-A*68:01 CVADYSVLY CVADYSVIY 78 304
HLA-A*03:01 VLYNSASFSTFK VIYNFAPFFAFK 7 27
HLA-A*02:11 VLYNSASFST VIYNFAPFFA 77 20
HLA-A*68:01 NCVADYSVLY NCVADYSVIY 267 1017
HLA-A*03:02 LYNSASFSTFK IYNFAPFFAFK 202 760
HLA-A*68:02 CVADYSVLYNSA CVADYSVIYNFA 1306 349
HLA-A*31:01 LYNSASFSTFK IYNFAPFFAFK 299 81
HLA-B*15:01 YSVLYNSASFSTF YSVIYNFAPFFAF 164 604
HLA-A*29:02 YSVLYNSASF YSVIYNFAPF 1696 462
HLA-A*30:02 VLYNSASFSTFKCY VIYNFAPFFAFKCY 272 973
HLA-B*15:01 LYNSASFSTF IYNFAPFFAF 468 1565
HLA-C*03:02 SVLYNSASF SVIYNFAPF 29 9
HLA-A*23:01 YSVLYNSASF YSVIYNFAPF 1120 364
HLA-B*27:05 KRISNCVADYSVLY KRISNCVADYSVIY 358 1096
HLA-A*26:01 NCVADYSVLY NCVADYSVIY 183 556
HLA-A*29:02 CVADYSVLY CVADYSVIY 6 18
HLA-C*03:02 YSVLYNSASFSTF YSVIYNFAPFFAF 113 331
HLA-A*26:01 CVADYSVLY CVADYSVIY 33 95
HLA-A*29:02 LYNSASFSTFKCY IYNFAPFFAFKCY 297 105
HLA-A*68:01 VLYNSASFSTFK VIYNFAPFFAFK 257 91
HLA-A*03:02 VLYNSASFSTFK VIYNFAPFFAFK 13 36
HLA-C*14:02 SVLYNSASF SVIYNFAPF 152 56
HLA-B*15:03 VLYNSASF VIYNFAPF 34 92
HLA-B*58:01 YSVLYNSASFSTF YSVIYNFAPFFAF 429 1153
HLA-A*01:01 ISNCVADYSVLY ISNCVADYSVIY 123 327
HLA-C*03:03 SVLYNSASF SVIYNFAPF 114 45
HLA-C*03:04 SVLYNSASF SVIYNFAPF 114 45
HLA-A*02:11 VLYNSASFS VIYNFAPFF 258 645
HLA-A*23:01 DYSVLYNSASF DYSVIYNFAPF 1039 424
HLA-A*33:03 LYNSASFSTFK IYNFAPFFAFK 1158 476
HLA-B*35:01 YSVLYNSASF YSVIYNFAPF 328 136
HLA-A*30:02 SVLYNSASF SVIYNFAPF 1057 444
HLA-A*23:01 SVLYNSASFSTF SVIYNFAPFFAF 656 277
HLA-B*15:01 VLYNSASF VIYNFAPF 224 518
HLA-A*30:02 SNCVADYSVLY SNCVADYSVIY 427 982
HLA-A*30:02 CVADYSVLY CVADYSVIY 72 159
HLA-C*14:02 LYNSASFSTF IYNFAPFFAF 20 43
HLA-A*68:01 YSVLYNSASFSTFK YSVIYNFAPFFAFK 144 67
HLA-A*30:02 KRISNCVADYSVLY KRISNCVADYSVIY 456 969
HLA-A*30:02 RISNCVADYSVLY RISNCVADYSVIY 81 170
HLA-A*68:01 SVLYNSASFSTFK SVIYNFAPFFAFK 41 20
HLA-A*03:01 SVLYNSASFSTFK SVIYNFAPFFAFK 47 96

S371F

Reference  RFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVY
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    RFASVYAWNRKRISNCVADYSVIYNFAPFFAFKCYGVSPTKLNDLCFTNVY

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*32:01 VLYNSASFS VIYNFAPFF 22186 48
HLA-A*23:01 LYNSASFS IYNFAPFF 22508 99
HLA-A*24:02 LYNSASFS IYNFAPFF 25164 136
HLA-A*23:01 VLYNSASFS VIYNFAPFF 32767 178
HLA-A*29:02 VLYNSASFS VIYNFAPFF 10439 76
HLA-C*03:02 VLYNSASFS VIYNFAPFF 13004 100
HLA-B*15:03 VLYNSASFS VIYNFAPFF 3280 27
HLA-A*26:01 SVLYNSASFS SVIYNFAPFF 21993 202
HLA-C*14:02 LYNSASFS IYNFAPFF 5693 80
HLA-C*05:01 VADYSVLYNS VADYSVIYNF 11802 172
HLA-A*32:01 SVLYNSASFS SVIYNFAPFF 14340 227
HLA-A*29:02 SVLYNSASFS SVIYNFAPFF 16185 274
HLA-B*15:01 SVLYNSASFS SVIYNFAPFF 2838 50
HLA-A*26:01 SVLYNSASF SVIYNFAPF 1313 24
HLA-A*23:01 SVLYNSASFS SVIYNFAPFF 24524 498
HLA-C*03:02 SVLYNSASFS SVIYNFAPFF 8888 192
HLA-A*68:02 SVLYNSASFST SVIYNFAPFFA 14147 319
HLA-B*58:01 VADYSVLYNS VADYSVIYNF 6124 141
HLA-C*16:01 VLYNSASFS VIYNFAPFF 18639 432
HLA-B*15:03 SVLYNSASFS SVIYNFAPFF 2850 68
HLA-A*23:01 DYSVLYNSASFS DYSVIYNFAPFF 14260 341
HLA-C*03:02 VADYSVLYNS VADYSVIYNF 20606 498
HLA-A*01:01 NSASFSTFKCY NFAPFFAFKCY 328 13051
HLA-A*68:02 VLYNSASFST VIYNFAPFFA 11417 297
HLA-A*25:01 SVLYNSASF SVIYNFAPF 2252 59
HLA-C*12:03 VLYNSASFS VIYNFAPFF 12383 333
HLA-C*16:01 NSASFSTF NFAPFFAF 243 8562
HLA-C*14:02 VLYNSASFS VIYNFAPFF 11085 360
HLA-A*23:01 NSASFSTF NFAPFFAF 12240 424
HLA-A*68:02 SVLYNSASF SVIYNFAPF 6927 241
HLA-A*29:02 YNSASFSTF YNFAPFFAF 1671 60
HLA-B*15:01 VLYNSASFS VIYNFAPFF 8189 317
HLA-B*57:01 VADYSVLYNS VADYSVIYNF 11273 446
HLA-B*58:01 YSVLYNSASFS YSVIYNFAPFF 6920 277
HLA-A*68:02 NSASFSTFKCYGV NFAPFFAFKCYGV 48 1043
HLA-A*02:06 SVLYNSASF SVIYNFAPF 2112 98
HLA-A*02:06 SVLYNSASFST SVIYNFAPFFA 4097 193
HLA-C*14:02 NSASFSTF NFAPFFAF 2544 120
HLA-A*68:01 SVLYNSASF SVIYNFAPF 6337 311
HLA-B*15:01 VLYNSASFSTF VIYNFAPFFAF 50 951
HLA-A*30:02 SASFSTFKCY FAPFFAFKCY 71 1241
HLA-B*40:02 ADYSVLYNS ADYSVIYNF 4645 272
HLA-B*15:03 YSVLYNSASFS YSVIYNFAPFF 3170 196
HLA-A*11:01 LYNSASFSTFK IYNFAPFFAFK 43 681
HLA-A*32:01 YNSASFSTF YNFAPFFAF 4333 294
HLA-A*33:03 YNSASFSTFK YNFAPFFAFK 823 57
HLA-A*26:01 YSVLYNSASF YSVIYNFAPF 1544 107
HLA-B*18:01 YNSASFSTF YNFAPFFAF 3495 284
HLA-A*02:06 VLYNSASFST VIYNFAPFFA 710 58
HLA-A*33:03 NSASFSTFK NFAPFFAFK 181 16
HLA-A*30:01 LYNSASFST IYNFAPFFA 3467 316
HLA-A*11:01 NSASFSTFK NFAPFFAFK 9 94
HLA-A*29:02 NSASFSTFKCY NFAPFFAFKCY 662 64
HLA-A*29:02 YNSASFSTFKCY YNFAPFFAFKCY 842 86
HLA-C*03:02 YSVLYNSASFS YSVIYNFAPFF 2405 260
HLA-A*02:11 SVLYNSASFST SVIYNFAPFFA 3830 425
HLA-A*33:03 SVLYNSASFSTFK SVIYNFAPFFAFK 2778 320
HLA-A*31:01 YNSASFSTFK YNFAPFFAFK 607 73
HLA-C*12:02 SVLYNSASF SVIYNFAPF 507 63
HLA-B*35:01 SASFSTFKCY FAPFFAFKCY 490 65
HLA-A*25:01 YSVLYNSASF YSVIYNFAPF 2498 338
HLA-A*23:01 SVLYNSASF SVIYNFAPF 990 145
HLA-A*30:02 VLYNSASFS VIYNFAPFF 2919 448
HLA-A*02:06 YSVLYNSASF YSVIYNFAPF 2478 397
HLA-A*31:01 NSASFSTFK NFAPFFAFK 293 47
HLA-B*15:03 VLYNSASFSTF VIYNFAPFFAF 38 235
HLA-A*29:02 LYNSASFSTF IYNFAPFFAF 387 63
HLA-A*29:02 SVLYNSASF SVIYNFAPF 1130 186
HLA-C*12:03 SVLYNSASF SVIYNFAPF 748 127
HLA-A*31:01 SVLYNSASFSTFK SVIYNFAPFFAFK 857 150
HLA-A*02:01 VLYNSASFST VIYNFAPFFA 243 43
HLA-A*23:01 YNSASFSTF YNFAPFFAF 352 63
HLA-A*03:01 VLYNSASFSTFKC VIYNFAPFFAFKC 312 1619
HLA-C*02:02 SVLYNSASF SVIYNFAPF 1090 218
HLA-C*02:10 SVLYNSASF SVIYNFAPF 1090 218
HLA-A*24:02 SVLYNSASF SVIYNFAPF 1977 410
HLA-A*03:01 LYNSASFSTFK IYNFAPFFAFK 295 1419
HLA-A*03:01 NSASFSTFK NFAPFFAFK 113 494
HLA-B*15:01 SVLYNSASF SVIYNFAPF 52 12
HLA-B*35:01 SVLYNSASF SVIYNFAPF 153 36
HLA-B*35:01 YNSASFSTF YNFAPFFAF 760 180
HLA-A*02:02 VLYNSASFST VIYNFAPFFA 202 49
HLA-A*31:01 VLYNSASFSTFK VIYNFAPFFAFK 565 139
HLA-A*01:01 SASFSTFKCY FAPFFAFKCY 461 1849
HLA-A*11:01 SASFSTFK FAPFFAFK 452 1795
HLA-A*03:01 VLYNSASFSTFK VIYNFAPFFAFK 7 27
HLA-A*02:11 VLYNSASFST VIYNFAPFFA 77 20
HLA-A*68:01 SASFSTFK FAPFFAFK 1114 290
HLA-A*03:02 LYNSASFSTFK IYNFAPFFAFK 202 760
HLA-A*68:02 CVADYSVLYNSA CVADYSVIYNFA 1306 349
HLA-A*31:01 LYNSASFSTFK IYNFAPFFAFK 299 81
HLA-B*15:01 YSVLYNSASFSTF YSVIYNFAPFFAF 164 604
HLA-A*29:02 YSVLYNSASF YSVIYNFAPF 1696 462
HLA-A*03:02 NSASFSTFK NFAPFFAFK 37 135
HLA-A*30:02 NSASFSTFKCY NFAPFFAFKCY 387 1395
HLA-C*12:03 SASFSTFKCY FAPFFAFKCY 498 139
HLA-A*30:02 VLYNSASFSTFKCY VIYNFAPFFAFKCY 272 973
HLA-B*15:01 LYNSASFSTF IYNFAPFFAF 468 1565
HLA-A*68:01 NSASFSTFK NFAPFFAFK 4 13
HLA-C*03:02 SVLYNSASF SVIYNFAPF 29 9
HLA-A*11:01 YNSASFSTFK YNFAPFFAFK 12 38
HLA-A*23:01 YSVLYNSASF YSVIYNFAPF 1120 364
HLA-A*02:06 SASFSTFKCYGV FAPFFAFKCYGV 1416 481
HLA-C*03:02 YSVLYNSASFSTF YSVIYNFAPFFAF 113 331
HLA-A*29:02 LYNSASFSTFKCY IYNFAPFFAFKCY 297 105
HLA-A*68:01 VLYNSASFSTFK VIYNFAPFFAFK 257 91
HLA-A*03:02 VLYNSASFSTFK VIYNFAPFFAFK 13 36
HLA-C*14:02 SVLYNSASF SVIYNFAPF 152 56
HLA-B*15:03 VLYNSASF VIYNFAPF 34 92
HLA-B*58:01 YSVLYNSASFSTF YSVIYNFAPFFAF 429 1153
HLA-C*12:02 SASFSTFKCY FAPFFAFKCY 710 275
HLA-C*03:03 SVLYNSASF SVIYNFAPF 114 45
HLA-C*03:04 SVLYNSASF SVIYNFAPF 114 45
HLA-A*02:11 VLYNSASFS VIYNFAPFF 258 645
HLA-A*68:01 NSASFSTFKC NFAPFFAFKC 281 702
HLA-A*23:01 DYSVLYNSASF DYSVIYNFAPF 1039 424
HLA-A*33:03 LYNSASFSTFK IYNFAPFFAFK 1158 476
HLA-A*03:01 YNSASFSTFK YNFAPFFAFK 80 194
HLA-B*35:01 YSVLYNSASF YSVIYNFAPF 328 136
HLA-A*30:02 SVLYNSASF SVIYNFAPF 1057 444
HLA-A*23:01 SVLYNSASFSTF SVIYNFAPFFAF 656 277
HLA-B*15:01 VLYNSASF VIYNFAPF 224 518
HLA-B*15:01 SASFSTFKCY FAPFFAFKCY 256 561
HLA-C*03:02 SASFSTFKCY FAPFFAFKCY 212 97
HLA-C*14:02 LYNSASFSTF IYNFAPFFAF 20 43
HLA-A*68:01 YSVLYNSASFSTFK YSVIYNFAPFFAFK 144 67
HLA-A*68:01 SVLYNSASFSTFK SVIYNFAPFFAFK 41 20
HLA-A*03:01 SVLYNSASFSTFK SVIYNFAPFFAFK 47 96

S373P

Reference  ASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYAD
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ASVYAWNRKRISNCVADYSVIYNFAPFFAFKCYGVSPTKLNDLCFTNVYAD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*32:01 VLYNSASFS VIYNFAPFF 22186 48
HLA-A*23:01 LYNSASFS IYNFAPFF 22508 99
HLA-A*24:02 LYNSASFS IYNFAPFF 25164 136
HLA-A*23:01 VLYNSASFS VIYNFAPFF 32767 178
HLA-A*29:02 VLYNSASFS VIYNFAPFF 10439 76
HLA-C*03:02 VLYNSASFS VIYNFAPFF 13004 100
HLA-B*15:03 VLYNSASFS VIYNFAPFF 3280 27
HLA-A*26:01 SVLYNSASFS SVIYNFAPFF 21993 202
HLA-C*14:02 LYNSASFS IYNFAPFF 5693 80
HLA-A*32:01 SVLYNSASFS SVIYNFAPFF 14340 227
HLA-A*30:02 ASFSTFKCY APFFAFKCY 43 2647
HLA-A*29:02 SVLYNSASFS SVIYNFAPFF 16185 274
HLA-B*15:01 ASFSTFKCY APFFAFKCY 107 6085
HLA-B*15:01 SVLYNSASFS SVIYNFAPFF 2838 50
HLA-A*26:01 SVLYNSASF SVIYNFAPF 1313 24
HLA-A*02:06 ASFSTFKCYGV APFFAFKCYGV 231 11537
HLA-A*23:01 SVLYNSASFS SVIYNFAPFF 24524 498
HLA-C*03:02 SVLYNSASFS SVIYNFAPFF 8888 192
HLA-C*16:01 ASFSTFKCY APFFAFKCY 68 3117
HLA-A*68:02 SVLYNSASFST SVIYNFAPFFA 14147 319
HLA-C*12:03 ASFSTFKCY APFFAFKCY 115 5066
HLA-C*16:01 VLYNSASFS VIYNFAPFF 18639 432
HLA-B*15:03 SVLYNSASFS SVIYNFAPFF 2850 68
HLA-A*23:01 DYSVLYNSASFS DYSVIYNFAPFF 14260 341
HLA-C*03:02 ASFSTFKCY APFFAFKCY 64 2656
HLA-A*01:01 NSASFSTFKCY NFAPFFAFKCY 328 13051
HLA-A*68:02 VLYNSASFST VIYNFAPFFA 11417 297
HLA-A*25:01 SVLYNSASF SVIYNFAPF 2252 59
HLA-C*12:03 VLYNSASFS VIYNFAPFF 12383 333
HLA-C*16:01 NSASFSTF NFAPFFAF 243 8562
HLA-A*11:01 ASFSTFKCY APFFAFKCY 379 12606
HLA-C*14:02 VLYNSASFS VIYNFAPFF 11085 360
HLA-A*23:01 NSASFSTF NFAPFFAF 12240 424
HLA-A*68:02 SVLYNSASF SVIYNFAPF 6927 241
HLA-A*29:02 YNSASFSTF YNFAPFFAF 1671 60
HLA-B*15:01 VLYNSASFS VIYNFAPFF 8189 317
HLA-B*35:01 ASFSTFKCY APFFAFKCY 2345 92
HLA-B*58:01 YSVLYNSASFS YSVIYNFAPFF 6920 277
HLA-C*12:02 ASFSTFKCY APFFAFKCY 338 8222
HLA-A*68:02 NSASFSTFKCYGV NFAPFFAFKCYGV 48 1043
HLA-A*02:06 SVLYNSASF SVIYNFAPF 2112 98
HLA-A*02:06 SVLYNSASFST SVIYNFAPFFA 4097 193
HLA-C*14:02 NSASFSTF NFAPFFAF 2544 120
HLA-B*15:03 ASFSTFKCY APFFAFKCY 25 529
HLA-A*68:01 SVLYNSASF SVIYNFAPF 6337 311
HLA-B*15:01 VLYNSASFSTF VIYNFAPFFAF 50 951
HLA-A*30:02 SASFSTFKCY FAPFFAFKCY 71 1241
HLA-C*14:02 SFSTFKCY PFFAFKCY 386 6449
HLA-B*15:03 YSVLYNSASFS YSVIYNFAPFF 3170 196
HLA-A*11:01 LYNSASFSTFK IYNFAPFFAFK 43 681
HLA-A*32:01 YNSASFSTF YNFAPFFAF 4333 294
HLA-A*33:03 YNSASFSTFK YNFAPFFAFK 823 57
HLA-A*26:01 YSVLYNSASF YSVIYNFAPF 1544 107
HLA-B*18:01 YNSASFSTF YNFAPFFAF 3495 284
HLA-A*02:06 VLYNSASFST VIYNFAPFFA 710 58
HLA-A*33:03 NSASFSTFK NFAPFFAFK 181 16
HLA-A*30:01 LYNSASFST IYNFAPFFA 3467 316
HLA-A*11:01 NSASFSTFK NFAPFFAFK 9 94
HLA-A*29:02 NSASFSTFKCY NFAPFFAFKCY 662 64
HLA-A*29:02 YNSASFSTFKCY YNFAPFFAFKCY 842 86
HLA-C*03:02 YSVLYNSASFS YSVIYNFAPFF 2405 260
HLA-A*29:02 ASFSTFKCY APFFAFKCY 201 1830
HLA-A*02:11 SVLYNSASFST SVIYNFAPFFA 3830 425
HLA-A*33:03 SVLYNSASFSTFK SVIYNFAPFFAFK 2778 320
HLA-A*31:01 YNSASFSTFK YNFAPFFAFK 607 73
HLA-C*12:02 SVLYNSASF SVIYNFAPF 507 63
HLA-B*35:01 SASFSTFKCY FAPFFAFKCY 490 65
HLA-A*25:01 YSVLYNSASF YSVIYNFAPF 2498 338
HLA-A*23:01 SVLYNSASF SVIYNFAPF 990 145
HLA-A*30:02 VLYNSASFS VIYNFAPFF 2919 448
HLA-A*02:06 YSVLYNSASF YSVIYNFAPF 2478 397
HLA-A*31:01 NSASFSTFK NFAPFFAFK 293 47
HLA-B*15:03 VLYNSASFSTF VIYNFAPFFAF 38 235
HLA-A*29:02 LYNSASFSTF IYNFAPFFAF 387 63
HLA-A*29:02 SVLYNSASF SVIYNFAPF 1130 186
HLA-C*12:03 SVLYNSASF SVIYNFAPF 748 127
HLA-A*31:01 SVLYNSASFSTFK SVIYNFAPFFAFK 857 150
HLA-A*02:01 VLYNSASFST VIYNFAPFFA 243 43
HLA-A*23:01 YNSASFSTF YNFAPFFAF 352 63
HLA-A*03:01 VLYNSASFSTFKC VIYNFAPFFAFKC 312 1619
HLA-C*02:02 SVLYNSASF SVIYNFAPF 1090 218
HLA-C*02:10 SVLYNSASF SVIYNFAPF 1090 218
HLA-A*24:02 SVLYNSASF SVIYNFAPF 1977 410
HLA-A*03:01 LYNSASFSTFK IYNFAPFFAFK 295 1419
HLA-A*03:01 NSASFSTFK NFAPFFAFK 113 494
HLA-B*15:01 SVLYNSASF SVIYNFAPF 52 12
HLA-B*35:01 SVLYNSASF SVIYNFAPF 153 36
HLA-B*35:01 YNSASFSTF YNFAPFFAF 760 180
HLA-A*02:02 VLYNSASFST VIYNFAPFFA 202 49
HLA-A*31:01 VLYNSASFSTFK VIYNFAPFFAFK 565 139
HLA-A*01:01 SASFSTFKCY FAPFFAFKCY 461 1849
HLA-A*11:01 SASFSTFK FAPFFAFK 452 1795
HLA-A*03:01 VLYNSASFSTFK VIYNFAPFFAFK 7 27
HLA-A*02:11 VLYNSASFST VIYNFAPFFA 77 20
HLA-A*68:01 SASFSTFK FAPFFAFK 1114 290
HLA-A*03:02 LYNSASFSTFK IYNFAPFFAFK 202 760
HLA-A*31:01 LYNSASFSTFK IYNFAPFFAFK 299 81
HLA-B*15:01 YSVLYNSASFSTF YSVIYNFAPFFAF 164 604
HLA-A*29:02 YSVLYNSASF YSVIYNFAPF 1696 462
HLA-A*03:02 NSASFSTFK NFAPFFAFK 37 135
HLA-A*30:02 NSASFSTFKCY NFAPFFAFKCY 387 1395
HLA-C*12:03 SASFSTFKCY FAPFFAFKCY 498 139
HLA-A*30:02 VLYNSASFSTFKCY VIYNFAPFFAFKCY 272 973
HLA-B*15:01 LYNSASFSTF IYNFAPFFAF 468 1565
HLA-A*68:01 NSASFSTFK NFAPFFAFK 4 13
HLA-C*03:02 SVLYNSASF SVIYNFAPF 29 9
HLA-A*11:01 YNSASFSTFK YNFAPFFAFK 12 38
HLA-A*23:01 YSVLYNSASF YSVIYNFAPF 1120 364
HLA-A*02:06 SASFSTFKCYGV FAPFFAFKCYGV 1416 481
HLA-C*03:02 YSVLYNSASFSTF YSVIYNFAPFFAF 113 331
HLA-A*29:02 LYNSASFSTFKCY IYNFAPFFAFKCY 297 105
HLA-A*68:01 VLYNSASFSTFK VIYNFAPFFAFK 257 91
HLA-A*03:02 VLYNSASFSTFK VIYNFAPFFAFK 13 36
HLA-C*14:02 SVLYNSASF SVIYNFAPF 152 56
HLA-B*15:03 VLYNSASF VIYNFAPF 34 92
HLA-B*58:01 YSVLYNSASFSTF YSVIYNFAPFFAF 429 1153
HLA-C*12:02 SASFSTFKCY FAPFFAFKCY 710 275
HLA-C*03:03 SVLYNSASF SVIYNFAPF 114 45
HLA-C*03:04 SVLYNSASF SVIYNFAPF 114 45
HLA-A*02:11 VLYNSASFS VIYNFAPFF 258 645
HLA-A*68:01 NSASFSTFKC NFAPFFAFKC 281 702
HLA-A*23:01 DYSVLYNSASF DYSVIYNFAPF 1039 424
HLA-A*33:03 LYNSASFSTFK IYNFAPFFAFK 1158 476
HLA-A*03:01 YNSASFSTFK YNFAPFFAFK 80 194
HLA-B*35:01 YSVLYNSASF YSVIYNFAPF 328 136
HLA-A*30:02 SVLYNSASF SVIYNFAPF 1057 444
HLA-A*23:01 SVLYNSASFSTF SVIYNFAPFFAF 656 277
HLA-B*15:01 VLYNSASF VIYNFAPF 224 518
HLA-B*15:01 SASFSTFKCY FAPFFAFKCY 256 561
HLA-C*03:02 SASFSTFKCY FAPFFAFKCY 212 97
HLA-C*14:02 LYNSASFSTF IYNFAPFFAF 20 43
HLA-A*68:01 YSVLYNSASFSTFK YSVIYNFAPFFAFK 144 67
HLA-A*68:01 SVLYNSASFSTFK SVIYNFAPFFAFK 41 20
HLA-A*03:01 SVLYNSASFSTFK SVIYNFAPFFAFK 47 96

375-376 ST->FA

Reference  VYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFV
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    VYAWNRKRISNCVADYSVIYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*32:01 VLYNSASFS VIYNFAPFF 22186 48
HLA-A*23:01 LYNSASFS IYNFAPFF 22508 99
HLA-A*24:02 LYNSASFS IYNFAPFF 25164 136
HLA-A*23:01 VLYNSASFS VIYNFAPFF 32767 178
HLA-A*29:02 VLYNSASFS VIYNFAPFF 10439 76
HLA-C*03:02 VLYNSASFS VIYNFAPFF 13004 100
HLA-B*15:03 VLYNSASFS VIYNFAPFF 3280 27
HLA-A*26:01 SVLYNSASFS SVIYNFAPFF 21993 202
HLA-C*14:02 LYNSASFS IYNFAPFF 5693 80
HLA-A*32:01 SVLYNSASFS SVIYNFAPFF 14340 227
HLA-A*30:02 ASFSTFKCY APFFAFKCY 43 2647
HLA-A*29:02 SVLYNSASFS SVIYNFAPFF 16185 274
HLA-B*15:01 ASFSTFKCY APFFAFKCY 107 6085
HLA-B*15:01 SVLYNSASFS SVIYNFAPFF 2838 50
HLA-A*02:06 ASFSTFKCYGV APFFAFKCYGV 231 11537
HLA-A*23:01 SVLYNSASFS SVIYNFAPFF 24524 498
HLA-C*15:02 FSTFKCYGV FFAFKCYGV 431 20837
HLA-C*03:02 SVLYNSASFS SVIYNFAPFF 8888 192
HLA-C*16:01 ASFSTFKCY APFFAFKCY 68 3117
HLA-A*68:02 SVLYNSASFST SVIYNFAPFFA 14147 319
HLA-C*12:03 ASFSTFKCY APFFAFKCY 115 5066
HLA-C*16:01 VLYNSASFS VIYNFAPFF 18639 432
HLA-B*15:03 SVLYNSASFS SVIYNFAPFF 2850 68
HLA-A*23:01 DYSVLYNSASFS DYSVIYNFAPFF 14260 341
HLA-C*03:02 ASFSTFKCY APFFAFKCY 64 2656
HLA-A*11:01 STFKCYGVSPTK FAFKCYGVSPTK 25 1030
HLA-A*01:01 NSASFSTFKCY NFAPFFAFKCY 328 13051
HLA-A*68:02 VLYNSASFST VIYNFAPFFA 11417 297
HLA-C*12:03 VLYNSASFS VIYNFAPFF 12383 333
HLA-C*16:01 NSASFSTF NFAPFFAF 243 8562
HLA-A*11:01 ASFSTFKCY APFFAFKCY 379 12606
HLA-C*14:02 VLYNSASFS VIYNFAPFF 11085 360
HLA-A*23:01 NSASFSTF NFAPFFAF 12240 424
HLA-A*29:02 YNSASFSTF YNFAPFFAF 1671 60
HLA-C*16:01 FSTFKCYGV FFAFKCYGV 302 8277
HLA-B*15:01 VLYNSASFS VIYNFAPFF 8189 317
HLA-B*35:01 ASFSTFKCY APFFAFKCY 2345 92
HLA-B*58:01 YSVLYNSASFS YSVIYNFAPFF 6920 277
HLA-C*12:02 ASFSTFKCY APFFAFKCY 338 8222
HLA-A*03:01 STFKCYGVSPTK FAFKCYGVSPTK 83 1880
HLA-A*68:02 NSASFSTFKCYGV NFAPFFAFKCYGV 48 1043
HLA-A*02:06 SVLYNSASFST SVIYNFAPFFA 4097 193
HLA-C*14:02 NSASFSTF NFAPFFAF 2544 120
HLA-B*15:03 ASFSTFKCY APFFAFKCY 25 529
HLA-C*03:02 STFKCYGVS FAFKCYGVS 8370 424
HLA-B*15:01 VLYNSASFSTF VIYNFAPFFAF 50 951
HLA-A*03:02 STFKCYGVSPTK FAFKCYGVSPTK 142 2541
HLA-A*30:02 SASFSTFKCY FAPFFAFKCY 71 1241
HLA-C*14:02 SFSTFKCY PFFAFKCY 386 6449
HLA-B*15:03 YSVLYNSASFS YSVIYNFAPFF 3170 196
HLA-A*11:01 LYNSASFSTFK IYNFAPFFAFK 43 681
HLA-A*30:01 STFKCYGVS FAFKCYGVS 438 6895
HLA-A*68:02 FSTFKCYGV FFAFKCYGV 17 261
HLA-A*32:01 YNSASFSTF YNFAPFFAF 4333 294
HLA-A*02:06 FSTFKCYGV FFAFKCYGV 61 882
HLA-A*33:03 YNSASFSTFK YNFAPFFAFK 823 57
HLA-A*11:01 FSTFKCYGVSPTK FFAFKCYGVSPTK 426 5482
HLA-B*18:01 YNSASFSTF YNFAPFFAF 3495 284
HLA-A*02:06 VLYNSASFST VIYNFAPFFA 710 58
HLA-A*33:03 NSASFSTFK NFAPFFAFK 181 16
HLA-A*30:01 LYNSASFST IYNFAPFFA 3467 316
HLA-C*14:02 FSTFKCYGV FFAFKCYGV 4043 371
HLA-A*11:01 NSASFSTFK NFAPFFAFK 9 94
HLA-A*29:02 NSASFSTFKCY NFAPFFAFKCY 662 64
HLA-A*29:02 YNSASFSTFKCY YNFAPFFAFKCY 842 86
HLA-C*03:02 YSVLYNSASFS YSVIYNFAPFF 2405 260
HLA-A*29:02 ASFSTFKCY APFFAFKCY 201 1830
HLA-A*02:11 SVLYNSASFST SVIYNFAPFFA 3830 425
HLA-A*33:03 SVLYNSASFSTFK SVIYNFAPFFAFK 2778 320
HLA-A*31:01 YNSASFSTFK YNFAPFFAFK 607 73
HLA-B*35:01 SASFSTFKCY FAPFFAFKCY 490 65
HLA-A*30:01 STFKCYGVSPTK FAFKCYGVSPTK 194 1428
HLA-A*30:02 VLYNSASFS VIYNFAPFF 2919 448
HLA-A*31:01 NSASFSTFK NFAPFFAFK 293 47
HLA-B*15:03 VLYNSASFSTF VIYNFAPFFAF 38 235
HLA-A*29:02 LYNSASFSTF IYNFAPFFAF 387 63
HLA-A*31:01 SVLYNSASFSTFK SVIYNFAPFFAFK 857 150
HLA-A*02:01 VLYNSASFST VIYNFAPFFA 243 43
HLA-A*23:01 YNSASFSTF YNFAPFFAF 352 63
HLA-A*03:01 VLYNSASFSTFKC VIYNFAPFFAFKC 312 1619
HLA-A*03:01 LYNSASFSTFK IYNFAPFFAFK 295 1419
HLA-A*03:01 NSASFSTFK NFAPFFAFK 113 494
HLA-B*35:01 YNSASFSTF YNFAPFFAF 760 180
HLA-A*02:02 VLYNSASFST VIYNFAPFFA 202 49
HLA-A*31:01 VLYNSASFSTFK VIYNFAPFFAFK 565 139
HLA-A*01:01 SASFSTFKCY FAPFFAFKCY 461 1849
HLA-A*11:01 SASFSTFK FAPFFAFK 452 1795
HLA-A*03:01 VLYNSASFSTFK VIYNFAPFFAFK 7 27
HLA-A*02:11 VLYNSASFST VIYNFAPFFA 77 20
HLA-A*68:01 SASFSTFK FAPFFAFK 1114 290
HLA-A*03:02 LYNSASFSTFK IYNFAPFFAFK 202 760
HLA-A*31:01 LYNSASFSTFK IYNFAPFFAFK 299 81
HLA-B*15:01 YSVLYNSASFSTF YSVIYNFAPFFAF 164 604
HLA-A*03:02 NSASFSTFK NFAPFFAFK 37 135
HLA-A*30:02 NSASFSTFKCY NFAPFFAFKCY 387 1395
HLA-C*12:03 SASFSTFKCY FAPFFAFKCY 498 139
HLA-A*30:02 VLYNSASFSTFKCY VIYNFAPFFAFKCY 272 973
HLA-B*15:01 LYNSASFSTF IYNFAPFFAF 468 1565
HLA-A*68:01 NSASFSTFK NFAPFFAFK 4 13
HLA-A*11:01 YNSASFSTFK YNFAPFFAFK 12 38
HLA-A*02:06 SASFSTFKCYGV FAPFFAFKCYGV 1416 481
HLA-C*03:02 YSVLYNSASFSTF YSVIYNFAPFFAF 113 331
HLA-A*68:01 FSTFKCYGVSPTK FFAFKCYGVSPTK 288 832
HLA-A*29:02 LYNSASFSTFKCY IYNFAPFFAFKCY 297 105
HLA-A*68:01 VLYNSASFSTFK VIYNFAPFFAFK 257 91
HLA-A*03:02 VLYNSASFSTFK VIYNFAPFFAFK 13 36
HLA-B*58:01 YSVLYNSASFSTF YSVIYNFAPFFAF 429 1153
HLA-C*12:02 SASFSTFKCY FAPFFAFKCY 710 275
HLA-A*02:11 VLYNSASFS VIYNFAPFF 258 645
HLA-A*68:01 NSASFSTFKC NFAPFFAFKC 281 702
HLA-A*33:03 LYNSASFSTFK IYNFAPFFAFK 1158 476
HLA-A*03:01 YNSASFSTFK YNFAPFFAFK 80 194
HLA-A*23:01 SVLYNSASFSTF SVIYNFAPFFAF 656 277
HLA-B*15:01 SASFSTFKCY FAPFFAFKCY 256 561
HLA-C*03:02 SASFSTFKCY FAPFFAFKCY 212 97
HLA-C*14:02 LYNSASFSTF IYNFAPFFAF 20 43
HLA-A*68:01 YSVLYNSASFSTFK YSVIYNFAPFFAFK 144 67
HLA-A*30:01 TFKCYGVSPTK AFKCYGVSPTK 319 155
HLA-A*68:01 SVLYNSASFSTFK SVIYNFAPFFAFK 41 20
HLA-A*03:01 SVLYNSASFSTFK SVIYNFAPFFAFK 47 96
HLA-A*02:01 FSTFKCYGV FFAFKCYGV 457 926

D405N

Reference  YGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    YGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGKIADYNYKLPDDFT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:01 FVIRGDEVR FVIRGNEVS 23 15265
HLA-A*68:01 SFVIRGDEVR SFVIRGNEVS 186 29639
HLA-A*68:01 DSFVIRGDEVR DSFVIRGNEVS 220 29286
HLA-A*33:03 FVIRGDEVR FVIRGNEVS 320 29448
HLA-A*33:03 SFVIRGDEVR SFVIRGNEVS 459 31986
HLA-C*14:02 SFVIRGDEV SFVIRGNEV 216 46
HLA-C*06:02 IRGDEVRQI IRGNEVSQI 147 642

R408S

Reference  SPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGKIADYNYKLPDDFTGCV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:01 FVIRGDEVR FVIRGNEVS 23 15265
HLA-A*68:01 SFVIRGDEVR SFVIRGNEVS 186 29639
HLA-A*68:01 DSFVIRGDEVR DSFVIRGNEVS 220 29286
HLA-A*33:03 FVIRGDEVR FVIRGNEVS 320 29448
HLA-A*33:03 SFVIRGDEVR SFVIRGNEVS 459 31986
HLA-A*30:01 RQIAPGQTGK SQIAPGQTGK 275 1253
HLA-C*06:02 IRGDEVRQI IRGNEVSQI 147 642
HLA-B*15:03 RQIAPGQT SQIAPGQT 478 1764
HLA-A*03:01 RQIAPGQTGK SQIAPGQTGK 49 180
HLA-B*15:03 RQIAPGQTGKIADY SQIAPGQTGKIADY 17 56
HLA-A*30:02 RQIAPGQTGKIADY SQIAPGQTGKIADY 324 1063
HLA-B*15:03 RQIAPGQTGKI SQIAPGQTGKI 236 727
HLA-B*15:03 RQIAPGQTG SQIAPGQTG 39 107
HLA-A*03:02 RQIAPGQTGK SQIAPGQTGK 123 246

N440K

Reference  TGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFE
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TGKIADYNYKLPDDFTGCVIAWNSNKLDSKPSGNYNYLYRLLRKSKLKPFE

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*11:01 CVIAWNSNN CVIAWNSNK 24486 26
HLA-A*68:01 CVIAWNSNN CVIAWNSNK 11802 16
HLA-A*68:01 FTGCVIAWNSNN FTGCVIAWNSNK 25655 59
HLA-A*03:01 CVIAWNSNN CVIAWNSNK 24643 61
HLA-A*03:02 CVIAWNSNN CVIAWNSNK 22621 61
HLA-A*11:01 GCVIAWNSNN GCVIAWNSNK 32767 94
HLA-A*03:01 GCVIAWNSNN GCVIAWNSNK 32767 128
HLA-A*11:01 TGCVIAWNSNN TGCVIAWNSNK 32767 153
HLA-A*68:01 TGCVIAWNSNN TGCVIAWNSNK 32767 180
HLA-A*68:01 DFTGCVIAWNSNN DFTGCVIAWNSNK 32767 255
HLA-A*03:02 GCVIAWNSNN GCVIAWNSNK 32767 277
HLA-A*11:01 FTGCVIAWNSNN FTGCVIAWNSNK 32767 408
HLA-A*31:01 CVIAWNSNN CVIAWNSNK 18631 279
HLA-A*33:03 CVIAWNSNN CVIAWNSNK 20952 493
HLA-A*30:01 CVIAWNSNN CVIAWNSNK 11396 467
HLA-A*30:02 NLDSKVGGNYNYLY KLDSKPSGNYNYLY 3335 366
HLA-A*02:02 NLDSKVGGNYNYL KLDSKPSGNYNYL 1730 219
HLA-A*02:11 NLDSKVGGNYNYL KLDSKPSGNYNYL 671 104
HLA-A*30:02 NLDSKVGGNY KLDSKPSGNY 422 69
HLA-B*15:01 NLDSKVGGNY KLDSKPSGNY 1404 287
HLA-A*01:01 NLDSKVGGNY KLDSKPSGNY 371 887
HLA-A*01:01 NLDSKVGGNYNYLY KLDSKPSGNYNYLY 193 427
HLA-A*02:11 VIAWNSNNL VIAWNSNKL 269 586
HLA-A*68:02 FTGCVIAWNSNNL FTGCVIAWNSNKL 461 960

445-446 VG->PS

Reference  DYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTE
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    DYNYKLPDDFTGCVIAWNSNKLDSKPSGNYNYLYRLLRKSKLKPFERDISTE

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*07:02 KVGGNYNYL KPSGNYNYL 12674 46
HLA-B*42:01 KVGGNYNYL KPSGNYNYL 7890 37
HLA-A*02:11 KVGGNYNYL KPSGNYNYL 111 9769
HLA-B*42:01 SKVGGNYNYL SKPSGNYNYL 18106 267
HLA-A*02:11 KVGGNYNYLYRL KPSGNYNYLYRL 274 16428
HLA-B*07:02 SKVGGNYNYL SKPSGNYNYL 23912 402
HLA-A*02:02 KVGGNYNYL KPSGNYNYL 279 10673
HLA-A*02:06 KVGGNYNYL KPSGNYNYL 452 12158
HLA-A*23:01 VGGNYNYLYRLF PSGNYNYLYRLL 222 5615
HLA-A*24:02 VGGNYNYLYRLF PSGNYNYLYRLL 391 7198
HLA-A*31:01 KVGGNYNYLYRLFR KPSGNYNYLYRLLR 36 634
HLA-A*30:02 KVGGNYNY KPSGNYNY 420 6251
HLA-A*01:01 VGGNYNYLY PSGNYNYLY 2993 213
HLA-B*15:03 SKVGGNYNY SKPSGNYNY 25 286
HLA-A*30:02 NLDSKVGGNYNYLY KLDSKPSGNYNYLY 3335 366
HLA-A*23:01 KVGGNYNYLYRLF KPSGNYNYLYRLL 410 3592
HLA-A*02:02 NLDSKVGGNYNYL KLDSKPSGNYNYL 1730 219
HLA-A*31:01 KVGGNYNYLYR KPSGNYNYLYR 66 491
HLA-A*30:02 VGGNYNYLY PSGNYNYLY 45 291
HLA-A*02:11 NLDSKVGGNYNYL KLDSKPSGNYNYL 671 104
HLA-B*58:01 KVGGNYNYLY KPSGNYNYLY 1217 190
HLA-A*30:02 NLDSKVGGNY KLDSKPSGNY 422 69
HLA-B*15:03 SKVGGNYNYLY SKPSGNYNYLY 313 1847
HLA-A*31:01 VGGNYNYLYRLFR PSGNYNYLYRLLR 253 1405
HLA-A*68:01 GGNYNYLYR SGNYNYLYR 1245 229
HLA-A*33:03 GGNYNYLYR SGNYNYLYR 1064 201
HLA-B*15:01 NLDSKVGGNY KLDSKPSGNY 1404 287
HLA-A*29:02 VGGNYNYLY PSGNYNYLY 94 438
HLA-A*31:01 VGGNYNYLYR PSGNYNYLYR 138 585
HLA-A*29:02 KVGGNYNYLY KPSGNYNYLY 100 414
HLA-A*01:01 NLDSKVGGNY KLDSKPSGNY 371 887
HLA-A*33:03 DSKVGGNYNYLYR DSKPSGNYNYLYR 528 224
HLA-A*11:01 GGNYNYLYR SGNYNYLYR 876 391
HLA-A*01:01 NLDSKVGGNYNYLY KLDSKPSGNYNYLY 193 427

F456L

Reference  GCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCN
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    GCVIAWNSNKLDSKPSGNYNYLYRLLRKSKLKPFERDISTEIYQAGNKPCN

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*03:01 YLYRLFRKSN YLYRLLRKSK 23374 45
HLA-A*03:02 YLYRLFRKSN YLYRLLRKSK 28215 271
HLA-A*31:01 LYRLFRKSN LYRLLRKSK 21575 378
HLA-A*68:01 YRLFRKSNLK YRLLRKSKLK 353 10794
HLA-A*30:01 LYRLFRKSN LYRLLRKSK 1444 52
HLA-C*14:02 LFRKSNLKPF LLRKSKLKPF 252 6649
HLA-A*23:01 VGGNYNYLYRLF PSGNYNYLYRLL 222 5615
HLA-B*15:03 RLFRKSNLKPF RLLRKSKLKPF 56 1161
HLA-A*24:02 VGGNYNYLYRLF PSGNYNYLYRLL 391 7198
HLA-A*31:01 KVGGNYNYLYRLFR KPSGNYNYLYRLLR 36 634
HLA-A*30:01 YLYRLFRKSN YLYRLLRKSK 5606 319
HLA-A*32:01 RLFRKSNLKPF RLLRKSKLKPF 121 2034
HLA-B*08:01 LFRKSNLKPF LLRKSKLKPF 2405 152
HLA-A*03:02 RLFRKSNLKP RLLRKSKLKP 220 3428
HLA-C*07:02 FRKSNLKPF LRKSKLKPF 135 1964
HLA-A*03:01 RLFRKSNLKP RLLRKSKLKP 32 461
HLA-A*11:01 YRLFRKSNLK YRLLRKSKLK 170 2359
HLA-A*03:02 LYRLFRKSNLK LYRLLRKSKLK 242 3337
HLA-A*11:01 RLFRKSNLK RLLRKSKLK 24 323
HLA-A*03:01 LYRLFRKSNLK LYRLLRKSKLK 65 872
HLA-A*03:02 YRLFRKSNLK YRLLRKSKLK 44 586
HLA-A*03:01 RLFRKSNLKPF RLLRKSKLKPF 439 5734
HLA-A*23:01 GNYNYLYRLF GNYNYLYRLL 181 2187
HLA-B*15:01 RLFRKSNLKPF RLLRKSKLKPF 113 1339
HLA-C*06:02 FRKSNLKPF LRKSKLKPF 190 2150
HLA-B*15:01 LFRKSNLKPF LLRKSKLKPF 735 71
HLA-C*14:02 FRKSNLKPF LRKSKLKPF 232 2377
HLA-A*24:02 GNYNYLYRLF GNYNYLYRLL 325 2976
HLA-A*03:01 YRLFRKSNLK YRLLRKSKLK 15 134
HLA-A*23:01 KVGGNYNYLYRLF KPSGNYNYLYRLL 410 3592
HLA-A*23:01 NYNYLYRLF NYNYLYRLL 20 168
HLA-C*07:01 FRKSNLKPF LRKSKLKPF 250 1942
HLA-B*15:03 FRKSNLKPF LRKSKLKPF 72 548
HLA-A*24:02 NYNYLYRLF NYNYLYRLL 21 158
HLA-A*74:01 RLFRKSNLK RLLRKSKLK 77 527
HLA-A*30:01 YRLFRKSNLK YRLLRKSKLK 383 2456
HLA-A*30:01 RLFRKSNLK RLLRKSKLK 14 87
HLA-A*31:01 RLFRKSNLK RLLRKSKLK 25 155
HLA-A*74:01 RLFRKSNLKPFER RLLRKSKLKPFER 219 1329
HLA-A*03:02 RLFRKSNLK RLLRKSKLK 8 48
HLA-A*31:01 VGGNYNYLYRLFR PSGNYNYLYRLLR 253 1405
HLA-A*30:01 RLFRKSNLKP RLLRKSKLKP 325 1678
HLA-A*31:01 NYLYRLFRK NYLYRLLRK 98 483
HLA-B*15:03 YRLFRKSNLKPF YRLLRKSKLKPF 454 2132
HLA-A*03:02 RLFRKSNLKPFER RLLRKSKLKPFER 316 1433
HLA-A*31:01 LYRLFRKSNLK LYRLLRKSKLK 356 1594
HLA-A*33:03 LFRKSNLKPFER LLRKSKLKPFER 331 1387
HLA-A*33:03 NYLYRLFRK NYLYRLLRK 156 644
HLA-A*03:02 YLYRLFRKSNLK YLYRLLRKSKLK 134 511
HLA-A*03:01 RLFRKSNLK RLLRKSKLK 4 14
HLA-A*31:01 RLFRKSNLKPFER RLLRKSKLKPFER 21 73
HLA-A*31:01 YNYLYRLFRK YNYLYRLLRK 135 466
HLA-A*31:01 LFRKSNLKPFER LLRKSKLKPFER 89 268
HLA-B*27:05 FRKSNLKPF LRKSKLKPF 381 1113
HLA-A*30:01 LYRLFRKSNLK LYRLLRKSKLK 192 553
HLA-A*33:03 YNYLYRLFRK YNYLYRLLRK 352 977
HLA-A*31:01 YRLFRKSNLKPFER YRLLRKSKLKPFER 464 1243
HLA-A*68:01 YNYLYRLFRK YNYLYRLLRK 234 572
HLA-C*14:02 LYRLFRKSNL LYRLLRKSKL 364 880
HLA-B*15:03 YLYRLFRKSNLKPF YLYRLLRKSKLKPF 342 801
HLA-B*27:05 YRLFRKSNLK YRLLRKSKLK 36 84
HLA-B*08:01 FRKSNLKPF LRKSKLKPF 777 344
HLA-A*33:03 NYLYRLFR NYLYRLLR 166 373
HLA-A*31:01 NYLYRLFR NYLYRLLR 336 723
HLA-A*31:01 GNYNYLYRLFR GNYNYLYRLLR 103 218
HLA-A*03:02 YLYRLFRK YLYRLLRK 327 676
HLA-A*03:01 YLYRLFRKSNLK YLYRLLRKSKLK 72 147

N460K

Reference  AWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    AWNSNKLDSKPSGNYNYLYRLLRKSKLKPFERDISTEIYQAGNKPCNGVAG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*03:01 YLYRLFRKSN YLYRLLRKSK 23374 45
HLA-A*03:02 YLYRLFRKSN YLYRLLRKSK 28215 271
HLA-A*31:01 LYRLFRKSN LYRLLRKSK 21575 378
HLA-A*68:01 YRLFRKSNLK YRLLRKSKLK 353 10794
HLA-A*30:01 LYRLFRKSN LYRLLRKSK 1444 52
HLA-C*14:02 LFRKSNLKPF LLRKSKLKPF 252 6649
HLA-B*15:03 RLFRKSNLKPF RLLRKSKLKPF 56 1161
HLA-A*30:01 YLYRLFRKSN YLYRLLRKSK 5606 319
HLA-A*32:01 RLFRKSNLKPF RLLRKSKLKPF 121 2034
HLA-B*08:01 LFRKSNLKPF LLRKSKLKPF 2405 152
HLA-A*03:02 RLFRKSNLKP RLLRKSKLKP 220 3428
HLA-C*07:02 FRKSNLKPF LRKSKLKPF 135 1964
HLA-A*03:01 RLFRKSNLKP RLLRKSKLKP 32 461
HLA-A*11:01 YRLFRKSNLK YRLLRKSKLK 170 2359
HLA-A*03:02 LYRLFRKSNLK LYRLLRKSKLK 242 3337
HLA-A*11:01 RLFRKSNLK RLLRKSKLK 24 323
HLA-A*03:01 LYRLFRKSNLK LYRLLRKSKLK 65 872
HLA-A*03:02 YRLFRKSNLK YRLLRKSKLK 44 586
HLA-A*03:01 RLFRKSNLKPF RLLRKSKLKPF 439 5734
HLA-B*15:01 RLFRKSNLKPF RLLRKSKLKPF 113 1339
HLA-C*06:02 FRKSNLKPF LRKSKLKPF 190 2150
HLA-B*15:01 LFRKSNLKPF LLRKSKLKPF 735 71
HLA-C*14:02 FRKSNLKPF LRKSKLKPF 232 2377
HLA-A*03:01 YRLFRKSNLK YRLLRKSKLK 15 134
HLA-C*07:01 FRKSNLKPF LRKSKLKPF 250 1942
HLA-B*15:03 FRKSNLKPF LRKSKLKPF 72 548
HLA-A*11:01 KSNLKPFER KSKLKPFER 401 2898
HLA-A*74:01 RLFRKSNLK RLLRKSKLK 77 527
HLA-A*30:01 YRLFRKSNLK YRLLRKSKLK 383 2456
HLA-A*30:01 RLFRKSNLK RLLRKSKLK 14 87
HLA-A*31:01 RLFRKSNLK RLLRKSKLK 25 155
HLA-A*74:01 RLFRKSNLKPFER RLLRKSKLKPFER 219 1329
HLA-A*03:02 RLFRKSNLK RLLRKSKLK 8 48
HLA-A*30:01 RLFRKSNLKP RLLRKSKLKP 325 1678
HLA-B*15:03 YRLFRKSNLKPF YRLLRKSKLKPF 454 2132
HLA-A*03:02 RLFRKSNLKPFER RLLRKSKLKPFER 316 1433
HLA-A*30:01 KSNLKPFER KSKLKPFER 964 213
HLA-A*31:01 LYRLFRKSNLK LYRLLRKSKLK 356 1594
HLA-A*33:03 LFRKSNLKPFER LLRKSKLKPFER 331 1387
HLA-A*03:02 YLYRLFRKSNLK YLYRLLRKSKLK 134 511
HLA-A*03:01 RLFRKSNLK RLLRKSKLK 4 14
HLA-A*31:01 RLFRKSNLKPFER RLLRKSKLKPFER 21 73
HLA-A*31:01 LFRKSNLKPFER LLRKSKLKPFER 89 268
HLA-B*27:05 FRKSNLKPF LRKSKLKPF 381 1113
HLA-A*30:01 LYRLFRKSNLK LYRLLRKSKLK 192 553
HLA-B*15:03 RKSNLKPF RKSKLKPF 191 546
HLA-A*31:01 YRLFRKSNLKPFER YRLLRKSKLKPFER 464 1243
HLA-C*14:02 LYRLFRKSNL LYRLLRKSKL 364 880
HLA-B*15:03 YLYRLFRKSNLKPF YLYRLLRKSKLKPF 342 801
HLA-B*27:05 YRLFRKSNLK YRLLRKSKLK 36 84
HLA-B*08:01 FRKSNLKPF LRKSKLKPF 777 344
HLA-A*03:01 YLYRLFRKSNLK YLYRLLRKSKLK 72 147

477-478 ST->NK

Reference  LYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGV
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    LYRLLRKSKLKPFERDISTEIYQAGNKPCNGVAGPNCYSPLQSYGFRPTYGV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*11:01 STEIYQAGST STEIYQAGNK 30358 67
HLA-A*68:01 STEIYQAGST STEIYQAGNK 22142 157
HLA-B*15:03 YQAGSTPCNGVEGF YQAGNKPCNGVAGP 217 27207
HLA-A*03:01 STEIYQAGST STEIYQAGNK 32241 308
HLA-B*35:01 TPCNGVEGF KPCNGVAGP 319 30470
HLA-B*15:01 YQAGSTPCNGVEGF YQAGNKPCNGVAGP 408 27219
HLA-A*02:11 YQAGSTPCNGV YQAGNKPCNGV 173 678
HLA-B*50:01 TEIYQAGSTP TEIYQAGNKP 464 1807
HLA-A*02:06 YQAGSTPCNGV YQAGNKPCNGV 39 146
HLA-A*02:01 YQAGSTPCNGV YQAGNKPCNGV 420 1490
HLA-C*14:02 IYQAGSTPC IYQAGNKPC 134 459
HLA-A*02:02 YQAGSTPCNGV YQAGNKPCNGV 107 233

E484A

Reference  SNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYR
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    SKLKPFERDISTEIYQAGNKPCNGVAGPNCYSPLQSYGFRPTYGVGHQPYR

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*40:02 VEGFNCYFPL VAGPNCYSPL 31 28153
HLA-B*40:01 VEGFNCYFPL VAGPNCYSPL 76 29734
HLA-C*01:02 EGFNCYFPL AGPNCYSPL 14564 97
HLA-B*15:03 YQAGSTPCNGVEGF YQAGNKPCNGVAGP 217 27207
HLA-C*01:02 VEGFNCYFPL VAGPNCYSPL 20165 183
HLA-A*68:02 EGFNCYFPL AGPNCYSPL 117 11181
HLA-B*35:01 TPCNGVEGF KPCNGVAGP 319 30470
HLA-B*15:01 YQAGSTPCNGVEGF YQAGNKPCNGVAGP 408 27219
HLA-C*03:02 VEGFNCYFPLQSY VAGPNCYSPLQSY 14989 314
HLA-A*02:11 GVEGFNCYFPL GVAGPNCYSPL 464 2693
HLA-B*35:01 NGVEGFNCY NGVAGPNCY 346 1951
HLA-A*02:06 GVEGFNCYFPL GVAGPNCYSPL 400 2162

F486P

Reference  LKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVV
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    LKPFERDISTEIYQAGNKPCNGVAGPNCYSPLQSYGFRPTYGVGHQPYRVV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*40:02 VEGFNCYFPL VAGPNCYSPL 31 28153
HLA-B*40:01 VEGFNCYFPL VAGPNCYSPL 76 29734
HLA-B*07:02 GFNCYFPL GPNCYSPL 27420 143
HLA-C*01:02 EGFNCYFPL AGPNCYSPL 14564 97
HLA-B*15:03 YQAGSTPCNGVEGF YQAGNKPCNGVAGP 217 27207
HLA-C*01:02 VEGFNCYFPL VAGPNCYSPL 20165 183
HLA-B*42:01 GFNCYFPL GPNCYSPL 15642 154
HLA-A*68:02 EGFNCYFPL AGPNCYSPL 117 11181
HLA-B*35:01 TPCNGVEGF KPCNGVAGP 319 30470
HLA-B*15:01 YQAGSTPCNGVEGF YQAGNKPCNGVAGP 408 27219
HLA-A*29:02 FNCYFPLQSY PNCYSPLQSY 73 4504
HLA-B*15:03 FNCYFPLQSY PNCYSPLQSY 101 6104
HLA-C*03:02 FNCYFPLQSY PNCYSPLQSY 225 12092
HLA-C*03:02 VEGFNCYFPLQSY VAGPNCYSPLQSY 14989 314
HLA-A*29:02 GFNCYFPLQSY GPNCYSPLQSY 191 7026
HLA-A*02:11 GVEGFNCYFPL GVAGPNCYSPL 464 2693
HLA-B*35:01 NGVEGFNCY NGVAGPNCY 346 1951
HLA-A*02:06 GVEGFNCYFPL GVAGPNCYSPL 400 2162
HLA-A*30:02 FNCYFPLQSY PNCYSPLQSY 425 2051

F490S

Reference  ERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSF
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ERDISTEIYQAGNKPCNGVAGPNCYSPLQSYGFRPTYGVGHQPYRVVVLSF

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*40:02 VEGFNCYFPL VAGPNCYSPL 31 28153
HLA-B*40:01 VEGFNCYFPL VAGPNCYSPL 76 29734
HLA-A*68:01 YFPLQSYGFQ YSPLQSYGFR 14480 50
HLA-B*07:02 GFNCYFPL GPNCYSPL 27420 143
HLA-C*03:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 27639 179
HLA-C*01:02 EGFNCYFPL AGPNCYSPL 14564 97
HLA-A*31:01 YFPLQSYGFQ YSPLQSYGFR 16290 110
HLA-B*15:03 FPLQSYGFQPTN SPLQSYGFRPTY 20159 178
HLA-B*15:03 YFPLQSYGFQPTN YSPLQSYGFRPTY 22168 197
HLA-A*33:03 YFPLQSYGFQ YSPLQSYGFR 11148 101
HLA-C*01:02 VEGFNCYFPL VAGPNCYSPL 20165 183
HLA-A*30:02 FPLQSYGFQPTN SPLQSYGFRPTY 21475 197
HLA-C*16:01 YFPLQSYGFQPTN YSPLQSYGFRPTY 29358 276
HLA-B*42:01 GFNCYFPL GPNCYSPL 15642 154
HLA-A*33:03 FPLQSYGFQ SPLQSYGFR 23527 238
HLA-A*68:02 EGFNCYFPL AGPNCYSPL 117 11181
HLA-A*31:01 CYFPLQSYGFQ CYSPLQSYGFR 8535 105
HLA-A*33:03 CYFPLQSYGFQ CYSPLQSYGFR 11311 156
HLA-A*29:02 FNCYFPLQSY PNCYSPLQSY 73 4504
HLA-B*15:03 FNCYFPLQSY PNCYSPLQSY 101 6104
HLA-C*03:02 FNCYFPLQSY PNCYSPLQSY 225 12092
HLA-A*33:03 NCYFPLQSYGFQ NCYSPLQSYGFR 22134 435
HLA-A*30:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 18743 373
HLA-A*29:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 19514 389
HLA-C*03:02 VEGFNCYFPLQSY VAGPNCYSPLQSY 14989 314
HLA-A*29:02 GFNCYFPLQSY GPNCYSPLQSY 191 7026
HLA-C*14:02 YFPLQSYGF YSPLQSYGF 18 646
HLA-B*35:01 FPLQSYGF SPLQSYGF 197 6313
HLA-B*53:01 FPLQSYGF SPLQSYGF 323 8460
HLA-A*29:02 YFPLQSYGF YSPLQSYGF 213 4114
HLA-A*23:01 YFPLQSYGF YSPLQSYGF 49 724
HLA-C*16:01 YFPLQSYGF YSPLQSYGF 4518 311
HLA-A*24:02 YFPLQSYGF YSPLQSYGF 50 655
HLA-C*03:02 YFPLQSYGF YSPLQSYGF 3990 334
HLA-C*01:02 YFPLQSYGF YSPLQSYGF 2910 404
HLA-A*02:11 GVEGFNCYFPL GVAGPNCYSPL 464 2693
HLA-A*02:06 GVEGFNCYFPL GVAGPNCYSPL 400 2162
HLA-C*07:02 YFPLQSYGF YSPLQSYGF 447 2163
HLA-A*30:02 FNCYFPLQSY PNCYSPLQSY 425 2051
HLA-A*29:02 CYFPLQSYGF CYSPLQSYGF 93 444
HLA-A*23:01 NCYFPLQSYGF NCYSPLQSYGF 271 1221
HLA-A*23:01 CYFPLQSYGFQ CYSPLQSYGFR 498 1935
HLA-A*23:01 CYFPLQSYGF CYSPLQSYGF 10 28

Q498R

Reference  YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPAT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    YQAGNKPCNGVAGPNCYSPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPAT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*03:02 QSYGFQPTN QSYGFRPTY 12903 18
HLA-B*15:01 LQSYGFQPTN LQSYGFRPTY 6135 9
HLA-C*16:01 QSYGFQPTN QSYGFRPTY 10868 16
HLA-A*29:02 QSYGFQPTN QSYGFRPTY 26152 43
HLA-B*15:03 QSYGFQPTN QSYGFRPTY 6543 11
HLA-B*15:03 LQSYGFQPTN LQSYGFRPTY 2045 4
HLA-C*12:03 QSYGFQPTN QSYGFRPTY 12696 25
HLA-B*15:03 PLQSYGFQPTN PLQSYGFRPTY 22802 60
HLA-C*14:02 SYGFQPTN SYGFRPTY 20230 66
HLA-A*68:01 YFPLQSYGFQ YSPLQSYGFR 14480 50
HLA-C*03:02 LQSYGFQPTN LQSYGFRPTY 23421 125
HLA-B*15:01 FQPTNGVGY FRPTYGVGH 166 29043
HLA-A*30:02 QSYGFQPTN QSYGFRPTY 5297 32
HLA-B*35:01 QSYGFQPTN QSYGFRPTY 24615 156
HLA-C*03:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 27639 179
HLA-A*31:01 YFPLQSYGFQ YSPLQSYGFR 16290 110
HLA-C*16:01 LQSYGFQPTN LQSYGFRPTY 27149 187
HLA-A*30:02 LQSYGFQPTN LQSYGFRPTY 7508 54
HLA-B*15:01 QSYGFQPTN QSYGFRPTY 21529 157
HLA-C*12:02 QSYGFQPTN QSYGFRPTY 21029 169
HLA-B*15:03 FPLQSYGFQPTN SPLQSYGFRPTY 20159 178
HLA-B*15:03 YFPLQSYGFQPTN YSPLQSYGFRPTY 22168 197
HLA-A*33:03 YFPLQSYGFQ YSPLQSYGFR 11148 101
HLA-A*30:02 FPLQSYGFQPTN SPLQSYGFRPTY 21475 197
HLA-A*29:02 LQSYGFQPTN LQSYGFRPTY 28458 265
HLA-C*16:01 YFPLQSYGFQPTN YSPLQSYGFRPTY 29358 276
HLA-B*15:03 FQPTNGVGY FRPTYGVGH 63 6390
HLA-A*29:02 GFQPTNGVGY GFRPTYGVGH 188 18753
HLA-A*33:03 FPLQSYGFQ SPLQSYGFR 23527 238
HLA-C*14:02 QSYGFQPTN QSYGFRPTY 25941 277
HLA-C*12:03 LQSYGFQPTN LQSYGFRPTY 26641 325
HLA-A*31:01 CYFPLQSYGFQ CYSPLQSYGFR 8535 105
HLA-B*15:03 LQSYGFQPTNG LQSYGFRPTYG 6387 82
HLA-A*32:01 QSYGFQPTN QSYGFRPTY 16619 226
HLA-A*11:01 QSYGFQPTN QSYGFRPTY 22068 301
HLA-A*33:03 CYFPLQSYGFQ CYSPLQSYGFR 11311 156
HLA-C*02:02 QSYGFQPTN QSYGFRPTY 26598 412
HLA-C*02:10 QSYGFQPTN QSYGFRPTY 26598 412
HLA-A*33:03 NCYFPLQSYGFQ NCYSPLQSYGFR 22134 435
HLA-A*30:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 18743 373
HLA-A*29:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 19514 389
HLA-B*15:01 LQSYGFQPTNGVGY LQSYGFRPTYGVGH 180 8335
HLA-B*15:01 FQPTNGVGYQPY FRPTYGVGHQPY 290 11634
HLA-B*15:03 YGFQPTNGVGY YGFRPTYGVGH 368 10641
HLA-A*30:02 GFQPTNGVGY GFRPTYGVGH 169 4730
HLA-A*30:02 QSYGFQPTNGVGY QSYGFRPTYGVGH 258 7114
HLA-B*15:03 LQSYGFQPTNGVGY LQSYGFRPTYGVGH 113 2917
HLA-C*07:02 FQPTNGVGYQPY FRPTYGVGHQPY 6169 356
HLA-B*57:01 QSYGFQPTN QSYGFRPTY 4070 293
HLA-A*30:01 QSYGFQPTN QSYGFRPTY 3720 308
HLA-B*57:01 LQSYGFQPTN LQSYGFRPTY 3839 375
HLA-C*14:02 FQPTNGVGYQPY FRPTYGVGHQPY 3107 366
HLA-B*15:03 FQPTNGVGYQPY FRPTYGVGHQPY 183 1236
HLA-A*31:01 QPTNGVGYQPYR RPTYGVGHQPYR 3100 478
HLA-B*58:01 QSYGFQPTN QSYGFRPTY 1532 249
HLA-A*23:01 SYGFQPTNGV SYGFRPTYGV 2697 483
HLA-A*02:11 YGFQPTNGV YGFRPTYGV 307 59
HLA-B*15:03 LQSYGFQPTNGV LQSYGFRPTYGV 1971 442
HLA-A*23:01 CYFPLQSYGFQ CYSPLQSYGFR 498 1935
HLA-A*02:02 YGFQPTNGV YGFRPTYGV 868 281
HLA-A*31:01 GFQPTNGVGYQPYR GFRPTYGVGHQPYR 616 201
HLA-A*02:06 YGFQPTNGV YGFRPTYGV 174 61
HLA-A*68:02 YGFQPTNGV YGFRPTYGV 73 26
HLA-C*12:03 YGFQPTNGV YGFRPTYGV 127 355
HLA-A*02:06 QSYGFQPTNGV QSYGFRPTYGV 1121 425
HLA-A*68:02 QSYGFQPTNGV QSYGFRPTYGV 122 47
HLA-A*02:06 LQSYGFQPT LQSYGFRPT 339 871

N501Y

Reference  GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    GNKPCNGVAGPNCYSPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*03:02 QSYGFQPTN QSYGFRPTY 12903 18
HLA-B*15:01 LQSYGFQPTN LQSYGFRPTY 6135 9
HLA-C*16:01 QSYGFQPTN QSYGFRPTY 10868 16
HLA-A*29:02 QSYGFQPTN QSYGFRPTY 26152 43
HLA-B*15:03 QSYGFQPTN QSYGFRPTY 6543 11
HLA-B*15:03 LQSYGFQPTN LQSYGFRPTY 2045 4
HLA-C*12:03 QSYGFQPTN QSYGFRPTY 12696 25
HLA-B*15:03 PLQSYGFQPTN PLQSYGFRPTY 22802 60
HLA-C*14:02 TNGVGYQPY TYGVGHQPY 5468 16
HLA-C*14:02 SYGFQPTN SYGFRPTY 20230 66
HLA-C*03:02 LQSYGFQPTN LQSYGFRPTY 23421 125
HLA-B*15:01 FQPTNGVGY FRPTYGVGH 166 29043
HLA-A*30:02 QSYGFQPTN QSYGFRPTY 5297 32
HLA-B*35:01 QSYGFQPTN QSYGFRPTY 24615 156
HLA-C*03:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 27639 179
HLA-C*16:01 LQSYGFQPTN LQSYGFRPTY 27149 187
HLA-A*30:02 LQSYGFQPTN LQSYGFRPTY 7508 54
HLA-B*15:01 QSYGFQPTN QSYGFRPTY 21529 157
HLA-C*12:02 QSYGFQPTN QSYGFRPTY 21029 169
HLA-B*15:03 FPLQSYGFQPTN SPLQSYGFRPTY 20159 178
HLA-B*15:03 YFPLQSYGFQPTN YSPLQSYGFRPTY 22168 197
HLA-A*30:02 FPLQSYGFQPTN SPLQSYGFRPTY 21475 197
HLA-A*29:02 LQSYGFQPTN LQSYGFRPTY 28458 265
HLA-C*16:01 YFPLQSYGFQPTN YSPLQSYGFRPTY 29358 276
HLA-B*15:03 FQPTNGVGY FRPTYGVGH 63 6390
HLA-A*29:02 GFQPTNGVGY GFRPTYGVGH 188 18753
HLA-C*14:02 QSYGFQPTN QSYGFRPTY 25941 277
HLA-C*12:03 LQSYGFQPTN LQSYGFRPTY 26641 325
HLA-B*15:03 LQSYGFQPTNG LQSYGFRPTYG 6387 82
HLA-A*32:01 QSYGFQPTN QSYGFRPTY 16619 226
HLA-A*11:01 QSYGFQPTN QSYGFRPTY 22068 301
HLA-C*02:02 QSYGFQPTN QSYGFRPTY 26598 412
HLA-C*02:10 QSYGFQPTN QSYGFRPTY 26598 412
HLA-A*30:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 18743 373
HLA-A*29:02 YFPLQSYGFQPTN YSPLQSYGFRPTY 19514 389
HLA-B*15:01 LQSYGFQPTNGVGY LQSYGFRPTYGVGH 180 8335
HLA-B*15:01 FQPTNGVGYQPY FRPTYGVGHQPY 290 11634
HLA-C*03:02 NGVGYQPY YGVGHQPY 10463 322
HLA-B*15:03 YGFQPTNGVGY YGFRPTYGVGH 368 10641
HLA-A*30:02 GFQPTNGVGY GFRPTYGVGH 169 4730
HLA-A*30:02 QSYGFQPTNGVGY QSYGFRPTYGVGH 258 7114
HLA-B*15:03 LQSYGFQPTNGVGY LQSYGFRPTYGVGH 113 2917
HLA-C*16:01 NGVGYQPY YGVGHQPY 8669 488
HLA-C*07:02 FQPTNGVGYQPY FRPTYGVGHQPY 6169 356
HLA-B*57:01 QSYGFQPTN QSYGFRPTY 4070 293
HLA-A*30:01 QSYGFQPTN QSYGFRPTY 3720 308
HLA-A*02:11 NGVGYQPYRV YGVGHQPYRV 5989 500
HLA-B*15:03 NGVGYQPY YGVGHQPY 4677 418
HLA-B*57:01 LQSYGFQPTN LQSYGFRPTY 3839 375
HLA-C*14:02 FQPTNGVGYQPY FRPTYGVGHQPY 3107 366
HLA-A*29:02 TNGVGYQPY TYGVGHQPY 2031 243
HLA-A*31:01 TNGVGYQPYR TYGVGHQPYR 811 103
HLA-A*33:03 TNGVGYQPYR TYGVGHQPYR 573 79
HLA-B*15:03 FQPTNGVGYQPY FRPTYGVGHQPY 183 1236
HLA-A*31:01 QPTNGVGYQPYR RPTYGVGHQPYR 3100 478
HLA-B*58:01 QSYGFQPTN QSYGFRPTY 1532 249
HLA-A*23:01 SYGFQPTNGV SYGFRPTYGV 2697 483
HLA-A*02:11 YGFQPTNGV YGFRPTYGV 307 59
HLA-B*15:03 LQSYGFQPTNGV LQSYGFRPTYGV 1971 442
HLA-A*68:01 PTNGVGYQPYR PTYGVGHQPYR 1073 303
HLA-A*33:03 PTNGVGYQPYR PTYGVGHQPYR 1345 417
HLA-A*02:02 YGFQPTNGV YGFRPTYGV 868 281
HLA-A*31:01 GFQPTNGVGYQPYR GFRPTYGVGHQPYR 616 201
HLA-A*29:02 PTNGVGYQPY PTYGVGHQPY 1211 401
HLA-A*31:01 PTNGVGYQPYR PTYGVGHQPYR 1377 470
HLA-A*02:06 YGFQPTNGV YGFRPTYGV 174 61
HLA-A*68:01 TNGVGYQPYR TYGVGHQPYR 263 740
HLA-A*68:02 YGFQPTNGV YGFRPTYGV 73 26
HLA-C*12:03 YGFQPTNGV YGFRPTYGV 127 355
HLA-A*02:06 QSYGFQPTNGV QSYGFRPTYGV 1121 425
HLA-A*68:02 QSYGFQPTNGV QSYGFRPTYGV 122 47
HLA-A*30:02 PTNGVGYQPY PTYGVGHQPY 465 205
HLA-A*31:01 NGVGYQPYR YGVGHQPYR 438 207

Y505H

Reference  CNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    CNGVAGPNCYSPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*14:02 TNGVGYQPY TYGVGHQPY 5468 16
HLA-B*15:01 FQPTNGVGY FRPTYGVGH 166 29043
HLA-B*15:03 FQPTNGVGY FRPTYGVGH 63 6390
HLA-A*29:02 GFQPTNGVGY GFRPTYGVGH 188 18753
HLA-B*15:01 LQSYGFQPTNGVGY LQSYGFRPTYGVGH 180 8335
HLA-C*14:02 GYQPYRVVV GHQPYRVVV 78 3539
HLA-B*15:01 FQPTNGVGYQPY FRPTYGVGHQPY 290 11634
HLA-C*03:02 NGVGYQPY YGVGHQPY 10463 322
HLA-A*24:02 GYQPYRVVVLSF GHQPYRVVVLSF 220 6955
HLA-A*23:01 GYQPYRVVVLSF GHQPYRVVVLSF 107 3241
HLA-B*15:03 YGFQPTNGVGY YGFRPTYGVGH 368 10641
HLA-A*30:02 GFQPTNGVGY GFRPTYGVGH 169 4730
HLA-A*30:02 QSYGFQPTNGVGY QSYGFRPTYGVGH 258 7114
HLA-B*15:03 LQSYGFQPTNGVGY LQSYGFRPTYGVGH 113 2917
HLA-C*14:02 GYQPYRVVVL GHQPYRVVVL 213 4430
HLA-C*14:02 VGYQPYRVVV VGHQPYRVVV 413 7561
HLA-C*16:01 NGVGYQPY YGVGHQPY 8669 488
HLA-C*07:02 FQPTNGVGYQPY FRPTYGVGHQPY 6169 356
HLA-A*02:11 YQPYRVVVL HQPYRVVVL 332 4009
HLA-A*02:11 NGVGYQPYRV YGVGHQPYRV 5989 500
HLA-B*15:03 NGVGYQPY YGVGHQPY 4677 418
HLA-A*02:06 YQPYRVVVL HQPYRVVVL 223 2206
HLA-C*14:02 FQPTNGVGYQPY FRPTYGVGHQPY 3107 366
HLA-A*29:02 TNGVGYQPY TYGVGHQPY 2031 243
HLA-A*31:01 TNGVGYQPYR TYGVGHQPYR 811 103
HLA-A*02:02 YQPYRVVVL HQPYRVVVL 360 2683
HLA-A*33:03 TNGVGYQPYR TYGVGHQPYR 573 79
HLA-B*15:03 FQPTNGVGYQPY FRPTYGVGHQPY 183 1236
HLA-A*31:01 QPTNGVGYQPYR RPTYGVGHQPYR 3100 478
HLA-C*01:02 YQPYRVVVL HQPYRVVVL 41 241
HLA-A*02:06 YQPYRVVVLSFEL HQPYRVVVLSFEL 430 2495
HLA-C*03:03 YQPYRVVVL HQPYRVVVL 410 2128
HLA-C*03:04 YQPYRVVVL HQPYRVVVL 410 2128
HLA-C*07:02 YQPYRVVVL HQPYRVVVL 135 590
HLA-C*12:03 YQPYRVVVL HQPYRVVVL 132 555
HLA-A*68:01 PTNGVGYQPYR PTYGVGHQPYR 1073 303
HLA-C*14:02 YQPYRVVVL HQPYRVVVL 102 347
HLA-C*16:01 YQPYRVVVL HQPYRVVVL 214 726
HLA-A*33:03 PTNGVGYQPYR PTYGVGHQPYR 1345 417
HLA-A*31:01 GFQPTNGVGYQPYR GFRPTYGVGHQPYR 616 201
HLA-A*29:02 PTNGVGYQPY PTYGVGHQPY 1211 401
HLA-C*12:03 VGYQPYRVV VGHQPYRVV 398 1196
HLA-A*31:01 PTNGVGYQPYR PTYGVGHQPYR 1377 470
HLA-A*68:01 TNGVGYQPYR TYGVGHQPYR 263 740
HLA-A*23:01 YQPYRVVVLSF HQPYRVVVLSF 465 1280
HLA-A*30:02 PTNGVGYQPY PTYGVGHQPY 465 205
HLA-A*31:01 NGVGYQPYR YGVGHQPYR 438 207

D614G

Reference  PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    PCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*05:01 YQDVNCTEV YQGVNCTEV 82 8597
HLA-C*08:02 YQDVNCTEV YQGVNCTEV 89 8066
HLA-A*02:11 DVNCTEVPV GVNCTEVPV 2140 72
HLA-A*02:02 DVNCTEVPV GVNCTEVPV 4099 213
HLA-A*68:02 DVNCTEVPV GVNCTEVPV 36 659
HLA-A*02:06 DVNCTEVPV GVNCTEVPV 3807 208
HLA-A*68:02 QVAVLYQDV QVAVLYQGV 183 13
HLA-A*68:02 NQVAVLYQDV NQVAVLYQGV 650 52
HLA-A*02:06 QVAVLYQDV QVAVLYQGV 1312 148
HLA-A*02:11 QVAVLYQDV QVAVLYQGV 2169 268
HLA-A*68:02 NTSNQVAVLYQDV NTSNQVAVLYQGV 1858 231
HLA-A*68:02 TSNQVAVLYQDV TSNQVAVLYQGV 3281 457
HLA-A*02:02 QVAVLYQDV QVAVLYQGV 1107 188
HLA-A*02:01 YQDVNCTEV YQGVNCTEV 75 315
HLA-A*02:06 YQDVNCTEV YQGVNCTEV 17 57
HLA-A*02:11 VLYQDVNCT VLYQGVNCT 224 74
HLA-A*02:11 YQDVNCTEV YQGVNCTEV 31 93
HLA-A*02:11 VLYQDVNCTEVP VLYQGVNCTEVP 1000 402
HLA-A*02:02 NQVAVLYQDV NQVAVLYQGV 269 116
HLA-A*02:11 AVLYQDVNCTEV AVLYQGVNCTEV 500 238
HLA-A*02:01 NQVAVLYQDV NQVAVLYQGV 558 267
HLA-A*02:06 NQVAVLYQDV NQVAVLYQGV 36 18

H655Y

Reference  TPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TPTWRVYSTGSNVFQTRAGCLIGAEYVNNSYECDIPIGAGICASYQTQTKS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*15:01 RAGCLIGAEH RAGCLIGAEY 7377 156
HLA-A*30:02 RAGCLIGAEH RAGCLIGAEY 1881 43
HLA-B*15:01 FQTRAGCLIGAEH FQTRAGCLIGAEY 7512 178
HLA-B*15:03 FQTRAGCLIGAEH FQTRAGCLIGAEY 5076 125
HLA-A*30:02 AGCLIGAEH AGCLIGAEY 5331 179
HLA-B*15:03 RAGCLIGAEH RAGCLIGAEY 5254 179
HLA-A*30:02 QTRAGCLIGAEH QTRAGCLIGAEY 8425 342
HLA-B*15:03 AGCLIGAEH AGCLIGAEY 9025 461
HLA-A*02:11 HVNNSYECDIPI YVNNSYECDIPI 1593 109
HLA-A*02:01 HVNNSYECDIPI YVNNSYECDIPI 2384 226
HLA-A*02:06 HVNNSYECDIPI YVNNSYECDIPI 837 92
HLA-A*02:02 HVNNSYECDIPI YVNNSYECDIPI 1466 187
HLA-A*02:11 CLIGAEHV CLIGAEYV 983 221
HLA-B*15:03 AEHVNNSY AEYVNNSY 986 267
HLA-B*18:01 AEHVNNSY AEYVNNSY 902 286

N679K

Reference  EHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENS
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    EYVNNSYECDIPIGAGICASYQTQTKSPRRARSVASQSIIAYTMSLGAENS

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:01 CASYQTQTN CASYQTQTK 28102 123
HLA-A*11:01 CASYQTQTN CASYQTQTK 32767 431
HLA-A*30:01 NSPRRARSVAS KSPRRARSVAS 4546 191
HLA-A*30:01 NSPRRARSV KSPRRARSV 7195 362
HLA-A*30:01 NSPRRARSVA KSPRRARSVA 630 33
HLA-A*68:01 TQTNSPRRAR TQTKSPRRAR 254 1790
HLA-A*68:01 QTNSPRRAR QTKSPRRAR 95 669
HLA-A*68:01 YQTQTNSPRR YQTQTKSPRR 206 675
HLA-A*68:01 QTQTNSPRR QTQTKSPRR 119 379
HLA-B*07:02 NSPRRARSVA KSPRRARSVA 69 24
HLA-A*31:01 QTQTNSPRR QTQTKSPRR 355 138
HLA-A*31:01 YQTQTNSPRR YQTQTKSPRR 965 450
HLA-A*33:03 TQTNSPRRAR TQTKSPRRAR 195 395

D796Y

Reference  AVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDL
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    AVEQDKNTQEVFAQVKQIYKTPPIKYFGGFNFSQILPDPSKPSKRSFIEDL

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*23:01 KDFGGFNF KYFGGFNF 15419 23
HLA-A*23:01 KDFGGFNFSQI KYFGGFNFSQI 15932 37
HLA-A*24:02 KDFGGFNF KYFGGFNF 21008 55
HLA-C*14:02 IYKTPPIKD IYKTPPIKY 16538 55
HLA-A*24:02 KDFGGFNFSQI KYFGGFNFSQI 20251 68
HLA-B*15:03 KQIYKTPPIKD KQIYKTPPIKY 7773 29
HLA-A*23:01 KDFGGFNFSQIL KYFGGFNFSQIL 15831 63
HLA-C*14:02 KDFGGFNF KYFGGFNF 22081 90
HLA-A*24:02 KDFGGFNFSQIL KYFGGFNFSQIL 21565 126
HLA-B*15:01 KQIYKTPPIKD KQIYKTPPIKY 22193 141
HLA-C*14:02 KDFGGFNFSQIL KYFGGFNFSQIL 14873 165
HLA-A*30:01 KDFGGFNFS KYFGGFNFS 9496 156
HLA-C*14:02 DFGGFNFSQIL YFGGFNFSQIL 6960 139
HLA-A*30:02 KQIYKTPPIKD KQIYKTPPIKY 15917 386
HLA-B*15:03 VKQIYKTPPIKD VKQIYKTPPIKY 16977 446
HLA-B*15:03 IKDFGGFNF IKYFGGFNF 97 4
HLA-B*15:03 PIKDFGGFNF PIKYFGGFNF 7546 321
HLA-B*15:03 TPPIKDFGGFNF TPPIKYFGGFNF 10071 484
HLA-B*15:03 KTPPIKDFGGFNF KTPPIKYFGGFNF 6427 331
HLA-A*32:01 KTPPIKDFGGFNF KTPPIKYFGGFNF 6031 381
HLA-A*23:01 DFGGFNFSQI YFGGFNFSQI 5424 461
HLA-B*15:03 YKTPPIKDFGGFNF YKTPPIKYFGGFNF 2588 394
HLA-C*06:02 YKTPPIKDF YKTPPIKYF 2488 460
HLA-C*07:02 YKTPPIKDF YKTPPIKYF 1804 378
HLA-A*23:01 IYKTPPIKDF IYKTPPIKYF 273 98
HLA-A*24:02 IYKTPPIKDF IYKTPPIKYF 375 147
HLA-C*14:02 IYKTPPIKDF IYKTPPIKYF 341 158
HLA-B*15:03 YKTPPIKDF YKTPPIKYF 92 43

N969K

Reference  ALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQID
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    ALGKLQDVVNQNAQALNTLVKQLSSKFGAISSVLNDILSRLDKVEAEVQID

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*03:01 TLVKQLSSN TLVKQLSSK 29207 56
HLA-A*68:01 NTLVKQLSSN NTLVKQLSSK 28063 86
HLA-A*11:01 TLVKQLSSN TLVKQLSSK 32767 125
HLA-A*03:02 TLVKQLSSN TLVKQLSSK 31915 131
HLA-A*11:01 NTLVKQLSSN NTLVKQLSSK 32767 147
HLA-A*03:01 ALNTLVKQLSSN ALNTLVKQLSSK 32767 154
HLA-A*03:02 ALNTLVKQLSSN ALNTLVKQLSSK 32767 304
HLA-A*03:01 NTLVKQLSSN NTLVKQLSSK 32767 482
HLA-A*68:02 SNFGAISSV SKFGAISSV 117 5329
HLA-B*15:03 SNFGAISSVL SKFGAISSVL 688 25
HLA-B*08:01 QLSSNFGAI QLSSKFGAI 4755 265
HLA-C*15:02 SNFGAISSV SKFGAISSV 374 5700
HLA-A*30:01 SSNFGAISS SSKFGAISS 1320 88
HLA-B*15:03 SNFGAISSV SKFGAISSV 727 49
HLA-A*30:01 SSNFGAISSV SSKFGAISSV 587 71
HLA-A*02:06 KQLSSNFGA KQLSSKFGA 62 269
HLA-A*02:01 KQLSSNFGAI KQLSSKFGAI 407 1567
HLA-A*02:11 KQLSSNFGA KQLSSKFGA 228 807
HLA-A*02:06 SNFGAISSV SKFGAISSV 361 1100
HLA-C*06:02 SNFGAISSV SKFGAISSV 1423 485
HLA-A*02:11 KQLSSNFGAI KQLSSKFGAI 152 428
HLA-A*02:06 KQLSSNFGAI KQLSSKFGAI 58 159
HLA-A*02:02 KQLSSNFGAI KQLSSKFGAI 261 668
HLA-B*15:03 KQLSSNFGA KQLSSKFGA 497 1076

N protein

N

P13L

Reference  MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSK
           |||||||||||| |||||||||||||||||||||||||
Mutated    MSDNGPQNQRNALRITFGGPSDSTGSNQNGERSGARSK

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*42:01 MSDNGPQNQRNAP MSDNGPQNQRNAL 11146 27
HLA-B*07:02 GPQNQRNAP GPQNQRNAL 2464 6
HLA-B*42:01 GPQNQRNAP GPQNQRNAL 3035 8
HLA-B*07:02 SDNGPQNQRNAP SDNGPQNQRNAL 11353 32
HLA-B*42:01 SDNGPQNQRNAP SDNGPQNQRNAL 13042 39
HLA-B*42:01 NGPQNQRNAP NGPQNQRNAL 12875 41
HLA-B*07:02 MSDNGPQNQRNAP MSDNGPQNQRNAL 13138 58
HLA-B*07:02 NGPQNQRNAP NGPQNQRNAL 14898 72
HLA-B*07:02 APRITFGGPS ALRITFGGPS 191 17534
HLA-B*42:01 PQNQRNAP PQNQRNAL 30142 436
HLA-B*07:02 GPQNQRNAPR GPQNQRNALR 13964 345
HLA-B*27:05 QRNAPRITF QRNALRITF 509 83
HLA-B*27:05 NQRNAPRITF NQRNALRITF 1716 350
HLA-B*27:05 GPQNQRNAPRITF GPQNQRNALRITF 2076 442
HLA-B*15:01 NQRNAPRITF NQRNALRITF 96 40

203-204 RG->KR

Reference  GGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQ
           |||||||||||||||||||||||||  |||||||||||||||||||||||||
Mutated    GGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNGGDAALALLLLDRLNQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:01 NSTPGSSRG NSTPGSSKR 32767 34
HLA-A*33:03 NSTPGSSRG NSTPGSSKR 32767 300
HLA-B*15:03 SRGTSPARM SKRTSPARM 2669 106
HLA-A*31:01 RNSTPGSSRG RNSTPGSSKR 7013 340
HLA-A*30:01 SSRNSTPGSSR SSRNSTPGSSK 356 20
HLA-A*30:01 GTSPARMAG RTSPARMAG 493 30
HLA-A*31:01 SSRNSTPGSSRG SSRNSTPGSSKR 3757 231
HLA-A*30:01 GTSPARMAGNGG RTSPARMAGNGG 6051 411
HLA-A*31:01 SSRNSTPGSSR SSRNSTPGSSK 127 1853
HLA-A*30:01 NSSRNSTPGSSR NSSRNSTPGSSK 4255 353
HLA-A*30:01 RNSTPGSSR RNSTPGSSK 2120 188
HLA-A*31:01 RNSTPGSSR RNSTPGSSK 123 1335
HLA-A*03:01 SSRNSTPGSSR SSRNSTPGSSK 4753 442
HLA-A*11:01 SSRNSTPGSSR SSRNSTPGSSK 2231 263
HLA-A*68:01 NSSRNSTPGSSR NSSRNSTPGSSK 270 1385
HLA-A*30:01 GSSRGTSPA GSSKRTSPA 555 145
HLA-A*30:01 SSRNSTPGSSRG SSRNSTPGSSKR 1625 469
HLA-A*30:01 SSRGTSPARMAG SSKRTSPARMAG 449 1031

S413R

Reference  KQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
           ||||||||||||||||||||||||| ||||||
Mutated    KQQTVTLLPAADLDDFSKQLQQSMSRADSTQA

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*31:01 KQLQQSMSS KQLQQSMSR 20016 55
HLA-A*30:01 MSSADSTQA MSRADSTQA 2953 37
HLA-A*33:03 DFSKQLQQSMSS DFSKQLQQSMSR 32767 494
HLA-B*15:03 KQLQQSMSS KQLQQSMSR 236 5105
HLA-A*30:01 SMSSADSTQA SMSRADSTQA 6453 416
HLA-A*02:02 FSKQLQQSMSSA FSKQLQQSMSRA 345 1138
HLA-A*02:11 FSKQLQQSMSSA FSKQLQQSMSRA 353 1118
HLA-A*02:11 QLQQSMSSA QLQQSMSRA 436 1175
HLA-A*02:02 SMSSADSTQA SMSRADSTQA 355 725

M protein

M

Q19E

Reference  MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNR
           |||||||||||||||||| |||||||||||||||||||||||||
Mutated    MADSNGTITVEELKKLLEEWNLVIGFLFLTWICLLQFAYANRNR

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*44:03 EQWNLVIGF EEWNLVIGF 1268 15
HLA-B*44:02 EQWNLVIGF EEWNLVIGF 2396 34
HLA-B*44:03 EQWNLVIGFLF EEWNLVIGFLF 5200 85
HLA-B*44:03 EQWNLVIGFL EEWNLVIGFL 8038 135
HLA-B*44:03 EQWNLVIGFLFLTW EEWNLVIGFLFLTW 5966 126
HLA-B*44:02 EQWNLVIGFLF EEWNLVIGFLF 6607 162
HLA-B*44:02 EQWNLVIGFL EEWNLVIGFL 9054 237
HLA-B*44:02 EQWNLVIGFLFLTW EEWNLVIGFLFLTW 5922 170
HLA-B*15:01 LEQWNLVIGF LEEWNLVIGF 256 8100
HLA-B*18:01 EQWNLVIGF EEWNLVIGF 482 16
HLA-A*02:06 EQWNLVIGFL EEWNLVIGFL 418 10916
HLA-B*15:03 EQWNLVIGF EEWNLVIGF 101 2397
HLA-B*18:01 EQWNLVIGFLF EEWNLVIGFLF 3471 190
HLA-B*40:02 EQWNLVIGFL EEWNLVIGFL 3775 245
HLA-B*15:03 LEQWNLVIGF LEEWNLVIGF 88 1227
HLA-B*40:02 EQWNLVIGF EEWNLVIGF 1765 242
HLA-B*15:03 KLLEQWNLVIGF KLLEEWNLVIGF 365 2285
HLA-A*02:11 LLEQWNLVI LLEEWNLVI 142 24
HLA-A*02:11 LLEQWNLVIGFL LLEEWNLVIGFL 1120 210
HLA-A*02:01 LLEQWNLVI LLEEWNLVI 644 131
HLA-A*29:02 QWNLVIGFLF EWNLVIGFLF 159 780
HLA-A*24:02 QWNLVIGFLF EWNLVIGFLF 53 246
HLA-A*23:01 QWNLVIGFLF EWNLVIGFLF 18 79
HLA-A*02:02 LLEQWNLVI LLEEWNLVI 781 187
HLA-A*02:06 LLEQWNLVI LLEEWNLVI 1869 487
HLA-B*40:02 LEQWNLVI LEEWNLVI 367 1301
HLA-A*02:02 LLEQWNLVIGFL LLEEWNLVIGFL 1047 329

E protein

E

T9I

Reference  MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAIL
           |||||||| |||||||||||||||||||||||||
Mutated    MYSFVSEEIGALIVNSVLLFLAFVVFLLVTLAIL

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*24:02 MYSFVSEET MYSFVSEEI 5532 18
HLA-A*23:01 MYSFVSEET MYSFVSEEI 5604 31
HLA-C*16:01 YSFVSEET YSFVSEEI 7157 226
HLA-C*14:02 MYSFVSEET MYSFVSEEI 901 30
HLA-C*12:03 YSFVSEET YSFVSEEI 10273 457
HLA-A*68:02 FVSEETGTLI FVSEEIGALI 247 22
HLA-A*68:02 MYSFVSEET MYSFVSEEI 3879 472
HLA-A*02:11 FVSEETGTLI FVSEEIGALI 307 45
HLA-A*02:01 FVSEETGTLI FVSEEIGALI 1293 202
HLA-A*02:06 FVSEETGTLI FVSEEIGALI 423 84
HLA-A*02:02 FVSEETGTLI FVSEEIGALI 85 20
HLA-A*26:01 FVSEETGTL FVSEEIGAL 1352 323
HLA-A*02:06 FVSEETGTL FVSEEIGAL 120 30
HLA-A*68:02 YSFVSEETGTLI YSFVSEEIGALI 1008 253
HLA-B*40:01 EETGTLIVNSVL EEIGALIVNSVL 1578 420
HLA-A*24:02 MYSFVSEETGTL MYSFVSEEIGAL 363 1234
HLA-A*23:01 MYSFVSEETGTL MYSFVSEEIGAL 431 1384
HLA-A*02:01 FVSEETGTL FVSEEIGAL 575 183
HLA-A*02:06 FVSEETGTLIV FVSEEIGALIV 670 227
HLA-A*02:11 FVSEETGTL FVSEEIGAL 97 35
HLA-B*44:03 EETGTLIVNSVLLF EEIGALIVNSVLLF 877 385

T11A

Reference  MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTA
           |||||||||| |||||||||||||||||||||||||
Mutated    MYSFVSEEIGALIVNSVLLFLAFVVFLLVTLAILTA

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:02 FVSEETGTLI FVSEEIGALI 247 22
HLA-C*03:03 GTLIVNSVL GALIVNSVL 2389 293
HLA-C*03:04 GTLIVNSVL GALIVNSVL 2389 293
HLA-A*02:11 FVSEETGTLI FVSEEIGALI 307 45
HLA-A*02:01 FVSEETGTLI FVSEEIGALI 1293 202
HLA-A*02:06 FVSEETGTLI FVSEEIGALI 423 84
HLA-A*02:02 FVSEETGTLI FVSEEIGALI 85 20
HLA-A*26:01 FVSEETGTL FVSEEIGAL 1352 323
HLA-A*02:06 FVSEETGTL FVSEEIGAL 120 30
HLA-A*68:02 YSFVSEETGTLI YSFVSEEIGALI 1008 253
HLA-B*40:01 EETGTLIVNSVL EEIGALIVNSVL 1578 420
HLA-A*24:02 MYSFVSEETGTL MYSFVSEEIGAL 363 1234
HLA-A*23:01 MYSFVSEETGTL MYSFVSEEIGAL 431 1384
HLA-A*02:01 FVSEETGTL FVSEEIGAL 575 183
HLA-A*02:06 FVSEETGTLIV FVSEEIGALIV 670 227
HLA-A*02:11 FVSEETGTL FVSEEIGAL 97 35
HLA-B*44:03 EETGTLIVNSVLLF EEIGALIVNSVLLF 877 385

NS3 protein

NS3

T223I

Reference  KDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHT
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    KDCVVLHSYFTSDYYQLYSTQLSTDIGVEHVTFFIYNKIVDEPEEHVQIHT

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-C*03:03 YSTQLSTDT YSTQLSTDI 12349 241
HLA-C*03:04 YSTQLSTDT YSTQLSTDI 12349 241
HLA-C*12:03 YSTQLSTDT YSTQLSTDI 11751 430
HLA-C*16:01 YSTQLSTDT YSTQLSTDI 7819 294
HLA-C*03:02 YSTQLSTDT YSTQLSTDI 6466 347
HLA-A*02:06 YQLYSTQLSTDT YQLYSTQLSTDI 4179 287
HLA-A*02:11 QLYSTQLSTDT QLYSTQLSTDI 5151 437
HLA-A*68:01 TGVEHVTFFIYNK IGVEHVTFFIYNK 213 1427
HLA-A*68:02 LSTDTGVEHV LSTDIGVEHV 1765 265
HLA-A*68:02 TGVEHVTFFI IGVEHVTFFI 212 1093
HLA-A*02:01 TQLSTDTGV TQLSTDIGV 1084 283
HLA-A*02:01 YSTQLSTDTGV YSTQLSTDIGV 1288 379
HLA-A*02:11 STQLSTDTGV STQLSTDIGV 1485 443
HLA-A*25:01 DTGVEHVTFF DIGVEHVTFF 180 596
HLA-A*02:11 TQLSTDTGV TQLSTDIGV 436 133
HLA-A*02:06 STQLSTDTGV STQLSTDIGV 264 83
HLA-A*02:11 YSTQLSTDTGV YSTQLSTDIGV 1184 381
HLA-A*26:01 DTGVEHVTFF DIGVEHVTFF 37 108
HLA-A*02:06 YSTQLSTDTGV YSTQLSTDIGV 157 56
HLA-C*03:02 TGVEHVTFF IGVEHVTFF 237 88
HLA-A*02:06 TQLSTDTGV TQLSTDIGV 70 26
HLA-B*15:03 TGVEHVTFF IGVEHVTFF 305 115
HLA-A*02:06 LYSTQLSTDTGV LYSTQLSTDIGV 855 330
HLA-C*16:01 TGVEHVTFF IGVEHVTFF 392 185

NS8 protein

NS8

G8stop

Reference  MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
           |||||||                                                                                                                  
Mutated    MKFLVFL‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑‑

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 YIDIGNYTV - 3 -
HLA-A*29:02 SFYEDFLEY - 3 -
HLA-A*31:01 HFYSKWYIR - 4 -
HLA-A*02:11 FLEYHDVRV - 5 -
HLA-A*33:03 HFYSKWYIR - 5 -
HLA-A*02:06 YIDIGNYTV - 6 -
HLA-B*15:03 IQYIDIGNY - 6 -
HLA-A*02:11 FLVFLGIITTV FLVFL 7 -
HLA-A*68:01 FTINCQEPK - 7 -
HLA-A*02:01 YIDIGNYTV - 8 -
HLA-A*02:02 FLEYHDVRV - 9 -
HLA-A*02:11 FLGIITTV FL 9 -
HLA-A*02:06 YVVDDPCPI - 10 -
HLA-A*02:11 FLEYHDVRVV - 10 -
HLA-B*15:03 LQSCTQHQPY - 10 -
HLA-C*14:02 SFYEDFLEY - 10 -
HLA-A*02:11 YVVDDPCPI - 13 -
HLA-A*31:01 IHFYSKWYIR - 13 -
HLA-B*53:01 CPIHFYSKW - 13 -
HLA-C*14:02 NYTVSCLPF - 13 -
HLA-B*15:01 LQSCTQHQPY - 14 -
HLA-A*29:02 CSFYEDFLEY - 15 -
HLA-A*02:02 YIDIGNYTV - 16 -
HLA-C*05:01 YIDIGNYTV - 16 -
HLA-A*02:06 YTVSCLPFTI - 18 -
HLA-B*15:01 LGIITTVAAF L 18 -
HLA-B*15:01 GIITTVAAF - 18 -
HLA-A*68:02 TVSCLPFTI - 19 -
HLA-A*02:11 FLGIITTVA FL 20 -
HLA-A*02:01 FLEYHDVRV - 22 -
HLA-A*31:01 KWYIRVGAR - 22 -
HLA-A*02:02 FLEYHDVRVV - 24 -
HLA-A*68:02 YTVSCLPFTI - 24 -
HLA-A*02:01 FLVFLGIITTV FLVFL 25 -
HLA-A*02:11 LVFLGIITTV LVFL 25 -
HLA-A*02:02 FLGIITTVA FL 27 -
HLA-A*02:02 FLGIITTV FL 29 -
HLA-A*02:02 YVVDDPCPI - 29 -
HLA-A*02:11 YTVSCLPFTI - 29 -
HLA-C*03:03 YVVDDPCPI - 29 -
HLA-C*03:04 YVVDDPCPI - 29 -
HLA-A*11:01 FTINCQEPK - 30 -
HLA-C*08:02 YIDIGNYTV - 30 -
HLA-A*02:06 LVFLGIITTV LVFL 31 -
HLA-A*02:11 SLQSCTQHQPYV - 31 -
HLA-A*31:01 HFYSKWYIRVGAR - 31 -
HLA-A*02:11 TVSCLPFTI - 32 -
HLA-A*33:03 HFYSKWYIRVGAR - 32 -
HLA-B*15:01 IQYIDIGNY - 32 -
HLA-B*40:01 LEYHDVRVVL - 32 -
HLA-A*33:03 IHFYSKWYIR - 35 -
HLA-A*02:02 YTVSCLPFTI - 36 -
HLA-A*02:11 KFLVFLGIITTV KFLVFL 36 -
HLA-C*14:02 EYHDVRVVL - 38 -
HLA-A*30:02 IQYIDIGNY - 39 -
HLA-B*15:03 SFYEDFLEY - 39 -
HLA-B*15:03 GIITTVAAF - 40 -
HLA-A*02:01 FLGIITTV FL 42 -
HLA-A*02:11 FLVFLGIITT FLVFL 45 -
HLA-A*02:01 FLEYHDVRVV - 46 -
HLA-A*02:02 FLGIITTVAA FL 47 -
HLA-A*24:02 NYTVSCLPF - 47 -
HLA-A*30:01 GSKSPIQYI - 47 -
HLA-A*02:11 FLGIITTVAA FL 48 -
HLA-B*40:02 LEYHDVRVVL - 49 -
HLA-C*03:02 YTVSCLPF - 52 -
HLA-A*23:01 NYTVSCLPF - 53 -
HLA-A*30:02 GSLVVRCSFY - 54 -
HLA-A*29:02 VRCSFYEDFLEY - 55 -
HLA-A*30:01 GARKSAPLI - 55 -
HLA-B*08:01 YIRVGARKSAPL - 55 -
HLA-C*03:02 YVVDDPCPI - 55 -
HLA-A*02:11 FLVFLGIITTVA FLVFL 56 -
HLA-A*02:02 FLVFLGIITTV FLVFL 57 -
HLA-A*68:02 YVVDDPCPI - 57 -
HLA-A*02:01 YVVDDPCPI - 59 -
HLA-A*02:06 YTVSCLPFT - 59 -
HLA-B*15:03 RKSAPLIEL - 59 -
HLA-A*29:02 RCSFYEDFLEY - 60 -
HLA-A*29:02 VVRCSFYEDFLEY - 61 -
HLA-A*02:02 TVSCLPFTI - 63 -
HLA-A*02:06 FLVFLGIITTV FLVFL 64 -
HLA-C*03:03 AAFHQECSL - 65 -
HLA-C*03:04 AAFHQECSL - 65 -
HLA-A*68:02 LVFLGIITTV LVFL 66 -
HLA-B*15:03 MKFLVFLGI MKFLVFL 73 -
HLA-C*16:01 AAFHQECSL - 73 -
HLA-A*31:01 CPIHFYSKWYIR - 74 -
HLA-A*30:01 RVGARKSAPLI - 75 -
HLA-A*01:01 CSFYEDFLEY - 76 -
HLA-A*02:06 FLEYHDVRV - 80 -
HLA-A*02:01 FLVFLGIITT FLVFL 83 -
HLA-A*02:02 FLVFLGIITT FLVFL 83 -
HLA-A*29:02 SLVVRCSFY - 84 -
HLA-A*30:02 LQSCTQHQPY - 84 -
HLA-A*02:06 TVSCLPFTI - 85 -
HLA-A*02:02 FLEYHDVRVVL - 86 -
HLA-A*30:02 CSFYEDFLEY - 89 -
HLA-A*02:11 VFLGIITTV VFL 90 -
HLA-A*30:02 SFYEDFLEY - 90 -
HLA-C*14:02 LEYHDVRVVL - 90 -
HLA-A*02:01 YTVSCLPFTI - 93 -
HLA-A*02:02 LVFLGIITTV LVFL 94 -
HLA-B*58:01 YTVSCLPFTI - 94 -
HLA-A*02:01 LVFLGIITTV LVFL 96 -
HLA-C*12:03 YVVDDPCPI - 97 -
HLA-A*29:02 YVVDDPCPIHFY - 98 -
HLA-A*31:01 HFYSKWYIRV - 98 -
HLA-A*02:11 KLGSLVVRC - 101 -
HLA-B*15:03 GNYTVSCLPF - 101 -
HLA-A*30:02 SLVVRCSFY - 103 -
HLA-A*26:01 YVVDDPCPIHFY - 106 -
HLA-A*02:02 SLQSCTQHQPYV - 108 -
HLA-A*29:02 SFYEDFLEYH - 110 -
HLA-A*68:02 FTINCQEPKL - 113 -
HLA-B*15:01 SLVVRCSFY - 115 -
HLA-C*14:02 FYEDFLEY - 116 -
HLA-A*33:03 DFLEYHDVR - 117 -
HLA-A*02:01 FLGIITTVA FL 118 -
HLA-B*42:01 EPKLGSLVV - 118 -
HLA-A*31:01 YSKWYIRVGAR - 120 -
HLA-A*03:02 FTINCQEPK - 121 -
HLA-A*02:01 FLGIITTVAA FL 122 -
HLA-A*30:02 KSPIQYIDIGNY - 122 -
HLA-B*40:02 LEYHDVRVV - 122 -
HLA-A*33:03 CPIHFYSKWYIR - 123 -
HLA-B*15:03 LGIITTVAAF L 123 -
HLA-C*14:02 FLEYHDVRVVL - 126 -
HLA-B*15:03 CSFYEDFLEY - 128 -
HLA-B*35:01 SFYEDFLEY - 128 -
HLA-A*68:01 PFTINCQEPK - 130 -
HLA-B*15:03 SLVVRCSFY - 130 -
HLA-B*15:01 FLGIITTVAAF FL 131 -
HLA-A*33:03 FYSKWYIRVGAR - 133 -
HLA-B*15:03 GSLVVRCSF - 133 -
HLA-A*02:06 FLGIITTV FL 134 -
HLA-A*02:06 FTINCQEPKL - 134 -
HLA-A*02:11 QYIDIGNYTV - 135 -
HLA-A*02:11 FLEYHDVRVVL - 137 -
HLA-A*02:01 KFLVFLGIITTV KFLVFL 138 -
HLA-B*57:01 LGSLVVRCSF - 138 -
HLA-A*02:02 FTINCQEPKL - 140 -
HLA-A*31:01 KWYIRVGARK - 145 -
HLA-A*68:01 HFYSKWYIR - 146 -
HLA-A*30:01 KWYIRVGARK - 149 -
HLA-C*03:02 SFYEDFLEY - 152 -
HLA-C*12:02 YVVDDPCPI - 156 -
HLA-A*31:01 PIHFYSKWYIR - 158 -
HLA-B*15:03 YTVSCLPF - 158 -
HLA-C*07:02 SFYEDFLEY - 160 -
HLA-A*33:03 YSKWYIRVGAR - 162 -
HLA-C*17:01 YVVDDPCPI - 163 -
HLA-A*02:01 SLQSCTQHQPYV - 164 -
HLA-B*38:01 IHFYSKWYI - 168 -
HLA-A*23:01 FYSKWYIRV - 171 -
HLA-A*29:02 LVVRCSFYEDFLEY - 171 -
HLA-A*02:11 SLQSCTQHQPYVV - 172 -
HLA-A*23:01 QYIDIGNYTV - 174 -
HLA-A*33:03 FYSKWYIR - 174 -
HLA-A*33:03 HFYSKWYIRV - 176 -
HLA-B*58:01 KSAPLIELCV - 177 -
HLA-A*23:01 VFLGIITTVAAF VFL 180 -
HLA-C*17:01 YIDIGNYTV - 181 -
HLA-B*58:01 LGSLVVRCSF - 182 -
HLA-A*31:01 SKWYIRVGAR - 183 -
HLA-A*02:01 FLVFLGIITTVA FLVFL 184 -
HLA-B*38:01 YHDVRVVLDF - 184 -
HLA-C*14:02 VFLGIITTV VFL 189 -
HLA-A*02:06 FLEYHDVRVV - 192 -
HLA-A*30:01 AGSKSPIQYI - 192 -
HLA-C*03:02 AAFHQECSL - 192 -
HLA-C*08:01 YIDIGNYTV - 192 -
HLA-C*12:03 AAFHQECSL - 192 -
HLA-A*11:01 SCLPFTINCQEPK - 193 -
HLA-A*29:02 FYEDFLEY - 195 -
HLA-A*31:01 FYSKWYIR - 195 -
HLA-A*30:02 KLGSLVVRCSFY - 199 -
HLA-B*15:03 SPIQYIDIGNY - 201 -
HLA-B*58:01 GSLVVRCSF - 201 -
HLA-A*02:11 MKFLVFLGIITTV MKFLVFL 205 -
HLA-C*14:02 FYSKWYIRV - 207 -
HLA-B*58:01 CSFYEDFLEY - 208 -
HLA-C*03:02 CSFYEDFLEY - 211 -
HLA-A*02:02 KFLVFLGIITTV KFLVFL 215 -
HLA-B*58:01 KSAPLIELC - 217 -
HLA-B*42:01 QEPKLGSLVV - 218 -
HLA-B*15:01 LVFLGIITTVAAF LVFL 219 -
HLA-A*24:02 NYTVSCLPFTI - 221 -
HLA-B*50:01 LEYHDVRVV - 221 -
HLA-B*40:01 YEDFLEYHDVRVVL - 224 -
HLA-A*01:01 VVDDPCPIHFY - 225 -
HLA-B*07:02 RVGARKSAPL - 225 -
HLA-A*30:01 YSKWYIRVGA - 229 -
HLA-C*16:01 YVVDDPCPI - 229 -
HLA-A*23:01 NYTVSCLPFTI - 231 -
HLA-A*02:06 FLVFLGIITT FLVFL 234 -
HLA-A*30:02 RCSFYEDFLEY - 236 -
HLA-A*68:02 DVRVVLDFI - 236 -
HLA-A*33:03 DPCPIHFYSKWYIR - 238 -
HLA-C*16:01 YTVSCLPF - 240 -
HLA-A*02:01 TVSCLPFTI - 244 -
HLA-A*31:01 FYSKWYIRVGAR - 244 -
HLA-C*05:01 FLEYHDVRV - 244 -
HLA-A*68:02 YTVSCLPFT - 245 -
HLA-C*05:01 VVDDPCPIHF - 247 -
HLA-A*02:11 FLVFLGIITTVAA FLVFL 248 -
HLA-C*16:01 VAAFHQECSL - 251 -
HLA-B*15:03 KSPIQYIDIGNY - 252 -
HLA-A*68:02 FTINCQEPKLGSLV - 254 -
HLA-B*15:01 CSFYEDFLEY - 256 -
HLA-A*24:02 FYSKWYIRV - 261 -
HLA-A*68:02 YSKWYIRVGA - 262 -
HLA-A*02:02 FLVFLGIITTVA FLVFL 263 -
HLA-B*57:01 KLGSLVVRCSF - 263 -
HLA-A*01:01 CVDEAGSKSPIQY - 264 -
HLA-A*33:03 EDFLEYHDVR - 264 -
HLA-A*23:01 IGNYTVSCLPF - 272 -
HLA-B*15:03 SLQSCTQHQPY - 275 -
HLA-C*02:02 YVVDDPCPI - 275 -
HLA-C*02:10 YVVDDPCPI - 275 -
HLA-B*57:01 GSLVVRCSF - 276 -
HLA-A*02:06 FLGIITTVAA FL 282 -
HLA-A*68:02 TTVAAFHQECSL - 288 -
HLA-A*32:01 TVSCLPFTI - 294 -
HLA-A*02:02 SLVVRCSFYEDFL - 298 -
HLA-A*02:11 IQYIDIGNYTV - 299 -
HLA-A*30:02 PIQYIDIGNY - 304 -
HLA-A*24:02 QYIDIGNYTV - 310 -
HLA-A*02:11 YIDIGNYTVS - 313 -
HLA-A*02:06 IQYIDIGNYTV - 320 -
HLA-B*15:01 VVRCSFYEDF - 326 -
HLA-B*40:01 LEYHDVRVV - 328 -
HLA-B*15:03 RCSFYEDFLEY - 332 -
HLA-B*15:01 SLQSCTQHQPY - 333 -
HLA-C*14:02 YEDFLEYHDVRVVL - 333 -
HLA-A*68:01 YVVDDPCPIHFYSK - 335 -
HLA-A*02:02 VFLGIITTVA VFL 336 -
HLA-A*31:01 IHFYSKWYIRVGAR - 336 -
HLA-C*03:02 GIITTVAAF - 338 -
HLA-B*08:01 VGARKSAPL - 346 -
HLA-C*14:02 YHDVRVVL - 346 -
HLA-A*33:03 KWYIRVGAR - 347 -
HLA-B*15:03 QSCTQHQPY - 350 -
HLA-B*15:01 SPIQYIDIGNY - 352 -
HLA-B*40:02 YEDFLEYHDV - 352 -
HLA-A*33:03 WYIRVGARK - 359 -
HLA-A*33:03 SKWYIRVGAR - 361 -
HLA-C*03:02 YVVDDPCPIHF - 364 -
HLA-A*02:06 LVFLGIITT LVFL 366 -
HLA-A*02:02 SLQSCTQHQPYVV - 376 -
HLA-A*02:06 KFLVFLGIITTV KFLVFL 382 -
HLA-A*30:01 KWYIRVGAR - 382 -
HLA-C*16:01 IGNYTVSCL - 383 -
HLA-B*15:03 SKSPIQYIDIGNY - 384 -
HLA-A*30:02 QSCTQHQPY - 386 -
HLA-B*15:03 PIQYIDIGNY - 390 -
HLA-A*02:06 FLGIITTVA FL 391 -
HLA-A*30:02 SLQSCTQHQPY - 393 -
HLA-A*11:01 CSFYEDFLEY - 395 -
HLA-A*68:01 FTINCQEPKL - 395 -
HLA-C*16:01 QSCTQHQPY - 397 -
HLA-A*33:03 PIHFYSKWYIR - 398 -
HLA-B*08:01 SLVVRCSF - 399 -
HLA-B*15:03 AAFHQECSL - 400 -
HLA-C*16:01 GSLVVRCSF - 400 -
HLA-A*11:01 VVDDPCPIHFYSK - 401 -
HLA-A*29:02 GSLVVRCSFY - 402 -
HLA-A*68:01 YSKWYIRVGARK - 402 -
HLA-C*15:02 KSAPLIELCV - 403 -
HLA-C*07:02 EYHDVRVVL - 404 -
HLA-A*29:02 IQYIDIGNY - 410 -
HLA-A*02:11 YIDIGNYTVSCL - 412 -
HLA-B*40:06 LEYHDVRVV - 412 -
HLA-A*68:02 YIDIGNYTV - 413 -
HLA-B*15:03 YHDVRVVLDF - 413 -
HLA-A*33:03 FTINCQEPK - 416 -
HLA-B*38:01 YHDVRVVL - 417 -
HLA-A*24:02 IGNYTVSCLPF - 426 -
HLA-A*30:01 HFYSKWYIR - 430 -
HLA-C*15:02 YTVSCLPFTI - 430 -
HLA-B*15:03 CQEPKLGSL - 432 -
HLA-B*15:01 VFLGIITTVAAF VFL 439 -
HLA-C*12:03 SFYEDFLEY - 443 -
HLA-B*42:01 YIRVGARKSAPL - 448 -
HLA-B*15:03 VRCSFYEDFLEY - 449 -
HLA-B*58:01 KLGSLVVRCSF - 450 -
HLA-C*14:02 CSFYEDFLEY - 454 -
HLA-B*15:01 YTVSCLPF - 456 -
HLA-A*30:02 SKSPIQYIDIGNY - 458 -
HLA-A*02:11 DFLEYHDVRVV - 459 -
HLA-A*11:01 LPFTINCQEPK - 466 -
HLA-B*40:02 YEDFLEYHDVRVVL - 468 -
HLA-B*15:03 IQYIDIGNYT - 483 -
HLA-B*15:03 FLGIITTVAAF FL 484 -
HLA-B*58:01 TVSCLPFTI - 484 -
HLA-B*15:01 FLVFLGIITTVAAF FLVFL 485 -
HLA-C*16:01 SFYEDFLEY - 486 -
HLA-A*30:02 SPIQYIDIGNY - 491 -
HLA-A*02:06 FTINCQEPKLGSL - 492 -
HLA-A*23:01 GNYTVSCLPF - 495 -
HLA-A*33:03 IHFYSKWYIRVGAR - 497 -
HLA-C*14:02 FYEDFLEYH - 497 -
HLA-A*02:01 FLEYHDVRVVL - 499 -
HLA-A*02:06 LQSCTQHQPYV - 500 -
HLA-A*31:01 WYIRVGARK - 500 -

NS9b protein

NS9b

I5T

Reference  MDPKISEMHPALRLVDPQIQLAVTRMENAV
           |||| |||||||||||||||||||||||||
Mutated    MDPKTSEMHSALRLVDPQIQLAVTRMENAV

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*68:02 MDPKISEMHPAL MDPKTSEMHSAL 6619 217
HLA-A*02:01 KISEMHPAL KTSEMHSAL 139 3161
HLA-A*02:11 KISEMHPAL KTSEMHSAL 14 277
HLA-B*58:01 KISEMHPAL KTSEMHSAL 5915 431
HLA-C*15:02 KISEMHPAL KTSEMHSAL 746 60
HLA-C*16:01 KISEMHPAL KTSEMHSAL 189 18
HLA-C*12:03 KISEMHPAL KTSEMHSAL 1242 122
HLA-A*68:01 ISEMHPALR TSEMHSALR 372 42
HLA-A*02:06 KISEMHPAL KTSEMHSAL 62 376
HLA-C*12:02 KISEMHPAL KTSEMHSAL 2061 349
HLA-C*03:03 KISEMHPAL KTSEMHSAL 177 34
HLA-C*03:04 KISEMHPAL KTSEMHSAL 177 34
HLA-A*68:01 KISEMHPALR KTSEMHSALR 312 67
HLA-A*02:02 KISEMHPAL KTSEMHSAL 42 187
HLA-C*03:02 KISEMHPAL KTSEMHSAL 371 92
HLA-B*44:02 ISEMHPALRL TSEMHSALRL 493 128
HLA-A*11:01 KISEMHPALR KTSEMHSALR 471 125
HLA-B*44:03 ISEMHPALRL TSEMHSALRL 577 160
HLA-A*30:01 KISEMHPAL KTSEMHSAL 455 143
HLA-C*16:01 ISEMHPAL TSEMHSAL 248 665
HLA-A*33:03 ISEMHPALR TSEMHSALR 395 148
HLA-A*02:11 KISEMHPALRLV KTSEMHSALRLV 249 617
HLA-A*30:01 KISEMHPALRLV KTSEMHSALRLV 722 292
HLA-C*15:02 ISEMHPALRL TSEMHSALRL 480 1127
HLA-A*31:01 PKISEMHPALR PKTSEMHSALR 687 297
HLA-C*17:01 KISEMHPAL KTSEMHSAL 241 105

P10S

Reference  MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQN
           ||||||||| |||||||||||||||||||||||||
Mutated    MDPKTSEMHSALRLVDPQIQLAVTRMENAVGRDQN

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*42:01 HPALRLVDPQIQL HSALRLVDPQIQL 148 15057
HLA-B*42:01 HPALRLVDPQI HSALRLVDPQI 297 15937
HLA-A*68:02 MDPKISEMHPAL MDPKTSEMHSAL 6619 217
HLA-A*02:01 KISEMHPAL KTSEMHSAL 139 3161
HLA-A*02:11 KISEMHPAL KTSEMHSAL 14 277
HLA-B*58:01 KISEMHPAL KTSEMHSAL 5915 431
HLA-C*15:02 KISEMHPAL KTSEMHSAL 746 60
HLA-A*02:11 PALRLVDPQIQL SALRLVDPQIQL 3683 325
HLA-C*16:01 KISEMHPAL KTSEMHSAL 189 18
HLA-C*12:03 KISEMHPAL KTSEMHSAL 1242 122
HLA-A*68:01 ISEMHPALR TSEMHSALR 372 42
HLA-B*38:01 MHPALRLVDPQI MHSALRLVDPQI 3064 395
HLA-A*02:06 KISEMHPAL KTSEMHSAL 62 376
HLA-C*12:02 KISEMHPAL KTSEMHSAL 2061 349
HLA-A*02:02 PALRLVDPQIQL SALRLVDPQIQL 2220 388
HLA-C*03:03 KISEMHPAL KTSEMHSAL 177 34
HLA-C*03:04 KISEMHPAL KTSEMHSAL 177 34
HLA-A*68:01 KISEMHPALR KTSEMHSALR 312 67
HLA-A*02:02 KISEMHPAL KTSEMHSAL 42 187
HLA-C*03:02 KISEMHPAL KTSEMHSAL 371 92
HLA-B*44:02 ISEMHPALRL TSEMHSALRL 493 128
HLA-A*11:01 KISEMHPALR KTSEMHSALR 471 125
HLA-B*44:03 ISEMHPALRL TSEMHSALRL 577 160
HLA-A*30:01 KISEMHPAL KTSEMHSAL 455 143
HLA-C*16:01 ISEMHPAL TSEMHSAL 248 665
HLA-A*33:03 ISEMHPALR TSEMHSALR 395 148
HLA-A*02:11 KISEMHPALRLV KTSEMHSALRLV 249 617
HLA-A*30:01 KISEMHPALRLV KTSEMHSALRLV 722 292
HLA-C*15:02 ISEMHPALRL TSEMHSALRL 480 1127
HLA-A*31:01 PKISEMHPALR PKTSEMHSALR 687 297
HLA-C*17:01 KISEMHPAL KTSEMHSAL 241 105
HLA-B*15:03 SEMHPALRL SEMHSALRL 493 245

NS9c protein

NS9c

G50N

Reference  AAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
           ||||||||||||||||||||||||| |||||||||||||||||||||||
Mutated    AAVKPLLVPHHVVATVQEIQLQAAVNELLLLEWLAMAVMLLLLCCCLTD

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*18:01 GELLLLEWLAM NELLLLEWLAM 4979 247
HLA-B*18:01 GELLLLEW NELLLLEW 3915 401
HLA-B*40:01 GELLLLEWL NELLLLEWL 28 140
HLA-A*02:11 QLQAAVGEL QLQAAVNEL 120 27
HLA-A*02:11 IQLQAAVGEL IQLQAAVNEL 338 81
HLA-B*40:02 GELLLLEWL NELLLLEWL 52 204
HLA-B*40:02 GELLLLEWLAM NELLLLEWLAM 201 772
HLA-A*02:01 QLQAAVGEL QLQAAVNEL 1290 358
HLA-A*02:02 QLQAAVGEL QLQAAVNEL 92 28
HLA-B*58:01 VGELLLLEW VNELLLLEW 330 1071
HLA-A*02:02 IQLQAAVGEL IQLQAAVNEL 170 58
HLA-A*02:01 LQAAVGELL LQAAVNELL 938 352
HLA-A*02:02 LQAAVGELL LQAAVNELL 44 17
HLA-B*40:06 GELLLLEWLA NELLLLEWLA 268 677
HLA-B*40:02 GELLLLEWLA NELLLLEWLA 475 1195
HLA-A*02:11 LQAAVGELL LQAAVNELL 386 154
HLA-A*02:01 IQLQAAVGEL IQLQAAVNEL 1138 475
HLA-A*02:01 QLQAAVGELL QLQAAVNELL 961 403
HLA-A*02:01 GELLLLEWLAMA NELLLLEWLAMA 109 258
HLA-A*02:02 QLQAAVGELL QLQAAVNELL 35 15
HLA-A*02:02 IQLQAAVGELL IQLQAAVNELL 724 313
HLA-A*02:11 QLQAAVGELL QLQAAVNELL 303 131
HLA-B*58:01 AVGELLLLEW AVNELLLLEW 196 87
HLA-A*02:11 GELLLLEWLAMA NELLLLEWLAMA 29 61
HLA-B*57:01 AVGELLLLEW AVNELLLLEW 432 206
HLA-A*68:02 EIQLQAAVGELL EIQLQAAVNELL 697 346

NSP1 protein

NSP1

K47R

Reference  QVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIK
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    QVRDVLVRGFGDSVEEVLSEARQHLRDGTCGLVEVEKGVLPQLEQPYVFIK

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*03:01 VLSEARQHLK VLSEARQHLR 53 1609
HLA-A*33:03 VLSEARQHLK VLSEARQHLR 5493 188
HLA-A*33:03 EVLSEARQHLK EVLSEARQHLR 4779 180
HLA-A*33:03 LSEARQHLK LSEARQHLR 5690 242
HLA-A*11:01 VLSEARQHLK VLSEARQHLR 120 2107
HLA-A*31:01 VLSEARQHLK VLSEARQHLR 1630 95
HLA-A*31:01 LSEARQHLK LSEARQHLR 1851 132
HLA-A*11:01 LSEARQHLK LSEARQHLR 223 2597
HLA-A*03:02 VLSEARQHLK VLSEARQHLR 46 397
HLA-B*42:01 HLKDGTCGL HLRDGTCGL 1455 390
HLA-A*68:01 LSEARQHLK LSEARQHLR 1065 302
HLA-A*68:01 VLSEARQHLK VLSEARQHLR 1008 287
HLA-A*68:01 EVLSEARQHLK EVLSEARQHLR 361 119

S135R

Reference  HVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    HVGEIPVAYRKVLLRKNGNKGAGGHRYGADLKSFDLGDELGTDPYEDFQEN

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*58:01 HSYGADLKSF HRYGADLKSF 59 18326
HLA-B*27:05 HSYGADLKSF HRYGADLKSF 15851 60
HLA-B*57:01 HSYGADLKSF HRYGADLKSF 158 23790
HLA-B*27:05 HSYGADLKSFDL HRYGADLKSFDL 23268 171
HLA-B*15:01 HSYGADLKSF HRYGADLKSF 94 6548
HLA-C*03:02 HSYGADLKSF HRYGADLKSF 94 6500
HLA-C*16:01 HSYGADLKSF HRYGADLKSF 329 14251
HLA-B*15:03 RKNGNKGAGGHSY RKNGNKGAGGHRY 183 1186
HLA-B*15:03 NKGAGGHSY NKGAGGHRY 129 774
HLA-B*15:03 GNKGAGGHSY GNKGAGGHRY 478 2611

NSP2 protein

NSP2

A510V

Reference  VTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKG
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    VTCAKEIKESVQTFFKLVNKFLALCVDSIIIGGAKLKALNLGETFVTHSKG

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 KLVNKFLALCA KLVNKFLALCV 570 36
HLA-A*02:11 LVNKFLALCA LVNKFLALCV 1115 86
HLA-A*02:01 KLVNKFLALCA KLVNKFLALCV 1500 149
HLA-A*68:02 LVNKFLALCA LVNKFLALCV 1807 288
HLA-A*02:01 LVNKFLALCA LVNKFLALCV 2999 496
HLA-A*02:02 LVNKFLALCA LVNKFLALCV 589 104
HLA-A*02:06 KLVNKFLALCA KLVNKFLALCV 1452 263
HLA-A*02:06 LVNKFLALCA LVNKFLALCV 826 159
HLA-A*02:02 KLVNKFLALCA KLVNKFLALCV 1736 352
HLA-A*02:11 ALCADSIII ALCVDSIII 122 371
HLA-A*02:11 KFLALCADSI KFLALCVDSI 204 70
HLA-A*02:01 KFLALCADSI KFLALCVDSI 425 147
HLA-A*11:01 ADSIIIGGAK VDSIIIGGAK 113 318
HLA-A*11:01 CADSIIIGGAK CVDSIIIGGAK 1080 445
HLA-A*02:06 KFLALCADSI KFLALCVDSI 923 383
HLA-A*02:02 ALCADSIII ALCVDSIII 209 487
HLA-A*02:06 FLALCADSI FLALCVDSI 35 17
HLA-A*02:02 KFLALCADSI KFLALCVDSI 47 23
HLA-A*02:01 FLALCADSI FLALCVDSI 16 8

NSP3 protein

NSP3

T24I

Reference  APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTE
           ||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    APTKVTFGDDTVIEVQGYKSVNIIFELDERIDKVLNEKCSAYTVELGTE

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*58:01 ITFELDERI IIFELDERI 270 4454
HLA-B*15:03 VQGYKSVNIT VQGYKSVNII 3702 395
HLA-A*02:01 ITFELDERI IIFELDERI 1637 223
HLA-A*02:11 ITFELDERI IIFELDERI 261 37
HLA-A*02:02 ITFELDERI IIFELDERI 428 65
HLA-A*24:02 VQGYKSVNITF VQGYKSVNIIF 194 811
HLA-A*24:02 IEVQGYKSVNITF IEVQGYKSVNIIF 366 1499
HLA-A*68:02 ITFELDERI IIFELDERI 253 1036
HLA-A*68:01 NITFELDER NIIFELDER 68 20
HLA-A*33:03 NITFELDER NIIFELDER 874 262
HLA-A*23:01 IEVQGYKSVNITF IEVQGYKSVNIIF 191 635
HLA-C*03:03 YKSVNITFEL YKSVNIIFEL 305 1007
HLA-C*03:04 YKSVNITFEL YKSVNIIFEL 305 1007
HLA-A*23:01 VIEVQGYKSVNITF VIEVQGYKSVNIIF 413 1337
HLA-A*23:01 VQGYKSVNITF VQGYKSVNIIF 111 353
HLA-A*02:11 KSVNITFEL KSVNIIFEL 169 55
HLA-C*14:02 GYKSVNITF GYKSVNIIF 53 160
HLA-A*11:01 ITFELDERIDK IIFELDERIDK 446 1259
HLA-A*02:01 KSVNITFEL KSVNIIFEL 863 307
HLA-C*03:02 YKSVNITFEL YKSVNIIFEL 299 784
HLA-A*68:01 VNITFELDER VNIIFELDER 1032 394
HLA-A*02:06 KSVNITFEL KSVNIIFEL 80 31
HLA-C*16:01 YKSVNITFEL YKSVNIIFEL 310 793
HLA-A*68:02 NITFELDERI NIIFELDERI 209 533
HLA-A*24:02 GYKSVNITF GYKSVNIIF 83 192
HLA-A*02:11 ITFELDERIDKV IIFELDERIDKV 397 175
HLA-A*68:01 SVNITFELDER SVNIIFELDER 405 180
HLA-A*24:02 QGYKSVNITF QGYKSVNIIF 208 455
HLA-A*02:06 ITFELDERI IIFELDERI 402 185
HLA-A*02:11 YKSVNITFEL YKSVNIIFEL 715 337
HLA-C*03:03 KSVNITFEL KSVNIIFEL 115 233
HLA-C*03:04 KSVNITFEL KSVNIIFEL 115 233

G489S

Reference  DAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQ
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    DAPYIVGDVVQEGVLTAVVIPTKKASGTTEMLAKALRKVPTDNYITTYPGQ

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*11:01 AGGTTEMLAK ASGTTEMLAK 1254 37
HLA-A*03:01 AGGTTEMLAK ASGTTEMLAK 3665 277
HLA-A*03:02 AGGTTEMLAK ASGTTEMLAK 2689 228
HLA-C*03:03 KAGGTTEML KASGTTEML 2418 212
HLA-C*03:04 KAGGTTEML KASGTTEML 2418 212
HLA-C*16:01 KAGGTTEML KASGTTEML 1012 116
HLA-C*17:01 KAGGTTEML KASGTTEML 1802 287
HLA-A*31:01 AGGTTEMLAKALR ASGTTEMLAKALR 787 133
HLA-B*58:01 KAGGTTEML KASGTTEML 2117 440
HLA-C*16:01 KAGGTTEM KASGTTEM 863 191
HLA-A*03:02 GGTTEMLAKALRK SGTTEMLAKALRK 1693 453
HLA-A*11:01 KAGGTTEMLAK KASGTTEMLAK 589 203
HLA-A*03:01 KAGGTTEMLAK KASGTTEMLAK 1236 449
HLA-A*03:01 GGTTEMLAKALRK SGTTEMLAKALRK 467 181
HLA-A*31:01 GGTTEMLAKALR SGTTEMLAKALR 677 335

G1001S

Reference  TKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKET
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    TKYLVQQESPFVMMSAPPAQYELKHSTFTCASEYTGNYQCGHYKHITSKET

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*35:01 GTFTCASEY STFTCASEY 1717 134
HLA-A*68:02 GTFTCASEYT STFTCASEYT 2659 275
HLA-A*68:01 GTFTCASEY STFTCASEY 883 99
HLA-C*12:03 GTFTCASEY STFTCASEY 284 32
HLA-C*14:02 GTFTCASEY STFTCASEY 1255 161
HLA-C*16:01 GTFTCASEY STFTCASEY 224 30
HLA-C*12:02 GTFTCASEY STFTCASEY 513 86
HLA-A*26:01 GTFTCASEY STFTCASEY 1665 281
HLA-C*03:02 GTFTCASEY STFTCASEY 105 18
HLA-C*02:02 GTFTCASEY STFTCASEY 540 157
HLA-C*02:10 GTFTCASEY STFTCASEY 540 157
HLA-B*15:03 GTFTCASEY STFTCASEY 83 26
HLA-A*30:02 HGTFTCASEYTGNY HSTFTCASEYTGNY 1377 435
HLA-C*16:01 HGTFTCASEY HSTFTCASEY 906 297
HLA-A*01:01 GTFTCASEY STFTCASEY 584 201
HLA-C*14:02 QYELKHGTF QYELKHSTF 115 40
HLA-A*29:02 GTFTCASEYTGNY STFTCASEYTGNY 645 225
HLA-A*01:01 HGTFTCASEY HSTFTCASEY 830 292
HLA-C*03:02 HGTFTCASEY HSTFTCASEY 339 129
HLA-B*15:03 PPAQYELKHGTF PPAQYELKHSTF 691 285
HLA-A*30:02 GTFTCASEYT STFTCASEYT 656 287
HLA-A*11:01 GTFTCASEY STFTCASEY 115 51
HLA-B*15:03 PAQYELKHGTF PAQYELKHSTF 163 74
HLA-B*15:03 AQYELKHGTFT AQYELKHSTFT 281 136
HLA-A*30:02 GTFTCASEYTGNY STFTCASEYTGNY 152 74
HLA-B*15:03 HGTFTCASEY HSTFTCASEY 232 116

NSP4 protein

NSP4

T327I

Reference  MRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFY
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    MRFRRAFGEYSHVVAFNTLLFLMSFIVLCLTPVYSFLPGVYSVIYLYLTFY

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-A*02:11 NTLLFLMSFT NTLLFLMSFI 1059 51
HLA-A*68:02 NTLLFLMSFT NTLLFLMSFI 741 41
HLA-A*02:11 FNTLLFLMSFT FNTLLFLMSFI 1509 110
HLA-A*02:11 TLLFLMSFT TLLFLMSFI 82 6
HLA-A*68:02 TLLFLMSFT TLLFLMSFI 3858 286
HLA-A*68:02 FTVLCLTPVYSFL FIVLCLTPVYSFL 129 1580
HLA-A*02:11 AFNTLLFLMSFT AFNTLLFLMSFI 4598 420
HLA-A*68:02 FTVLCLTPV FIVLCLTPV 8 83
HLA-A*68:02 SFTVLCLTPV SFIVLCLTPV 63 597
HLA-A*02:01 TLLFLMSFT TLLFLMSFI 239 26
HLA-A*02:01 NTLLFLMSFT NTLLFLMSFI 1593 179
HLA-A*02:02 TLLFLMSFT TLLFLMSFI 235 28
HLA-B*15:01 LLFLMSFTVL LLFLMSFIVL 229 1839
HLA-A*02:11 LFLMSFTV LFLMSFIV 279 2222
HLA-A*02:02 NTLLFLMSFT NTLLFLMSFI 1462 186
HLA-A*02:11 LLFLMSFT LLFLMSFI 2935 377
HLA-A*32:01 LLFLMSFTV LLFLMSFIV 369 2631
HLA-A*02:06 LLFLMSFTV LLFLMSFIV 34 231
HLA-C*12:03 FTVLCLTPV FIVLCLTPV 161 1041
HLA-C*14:02 LFLMSFTVL LFLMSFIVL 18 112
HLA-A*02:11 AFNTLLFLMSFTV AFNTLLFLMSFIV 74 448
HLA-C*16:01 FTVLCLTPVY FIVLCLTPVY 395 2359
HLA-A*02:06 TLLFLMSFT TLLFLMSFI 397 68
HLA-A*02:01 LLFLMSFTV LLFLMSFIV 9 50
HLA-A*02:11 VAFNTLLFLMSFTV VAFNTLLFLMSFIV 225 1206
HLA-A*02:01 AFNTLLFLMSFTV AFNTLLFLMSFIV 357 1842
HLA-A*68:02 NTLLFLMSFTV NTLLFLMSFIV 106 539
HLA-A*02:11 NTLLFLMSFTV NTLLFLMSFIV 59 300
HLA-A*02:01 NTLLFLMSFTV NTLLFLMSFIV 212 1074
HLA-C*03:03 FTVLCLTPV FIVLCLTPV 302 1526
HLA-C*03:04 FTVLCLTPV FIVLCLTPV 302 1526
HLA-B*15:03 LLFLMSFTVL LLFLMSFIVL 318 1563
HLA-A*02:02 LLFLMSFTV LLFLMSFIV 11 53
HLA-A*02:06 NTLLFLMSFT NTLLFLMSFI 945 197
HLA-A*02:11 SFTVLCLTPV SFIVLCLTPV 250 53
HLA-A*02:11 FNTLLFLMSFTV FNTLLFLMSFIV 23 108
HLA-A*02:01 FNTLLFLMSFTV FNTLLFLMSFIV 131 602
HLA-C*03:02 FTVLCLTPV FIVLCLTPV 198 902
HLA-C*14:02 FLMSFTVL FLMSFIVL 475 2138
HLA-C*12:02 FTVLCLTPV FIVLCLTPV 218 961
HLA-C*03:03 FLMSFTVL FLMSFIVL 309 1359
HLA-C*03:04 FLMSFTVL FLMSFIVL 309 1359
HLA-A*26:01 FTVLCLTPVY FIVLCLTPVY 176 760
HLA-A*02:01 SFTVLCLTPV SFIVLCLTPV 470 111
HLA-B*15:01 FLMSFTVLCL FLMSFIVLCL 455 1914
HLA-B*15:03 LFLMSFTVL LFLMSFIVL 353 1462
HLA-A*68:01 FTVLCLTPVY FIVLCLTPVY 485 1972
HLA-A*02:02 FNTLLFLMSFTV FNTLLFLMSFIV 186 704
HLA-B*15:01 LMSFTVLCL LMSFIVLCL 110 408
HLA-C*03:02 FLMSFTVL FLMSFIVL 352 1285
HLA-A*02:02 NTLLFLMSFTV NTLLFLMSFIV 424 1515
HLA-A*02:11 LLFLMSFTV LLFLMSFIV 2 7
HLA-C*03:02 FTVLCLTPVY FIVLCLTPVY 50 175
HLA-B*15:03 LMSFTVLCL LMSFIVLCL 54 186
HLA-C*12:02 FTVLCLTPVY FIVLCLTPVY 331 1137
HLA-A*02:02 LLFLMSFTVL LLFLMSFIVL 42 144
HLA-A*68:02 MSFTVLCLTPV MSFIVLCLTPV 34 114
HLA-C*03:02 LMSFTVLCL LMSFIVLCL 467 1520
HLA-A*02:01 LLFLMSFTVL LLFLMSFIVL 74 240
HLA-A*02:11 LLFLMSFTVL LLFLMSFIVL 25 80
HLA-A*02:02 SFTVLCLTPV SFIVLCLTPV 261 84
HLA-A*02:02 LFLMSFTVLCL LFLMSFIVLCL 73 216
HLA-A*02:06 LLFLMSFTVL LLFLMSFIVL 331 973
HLA-C*16:01 MSFTVLCL MSFIVLCL 171 496
HLA-A*68:02 FLMSFTVLCLTPV FLMSFIVLCLTPV 331 927
HLA-A*68:02 MSFTVLCLT MSFIVLCLT 68 186
HLA-A*02:06 MSFTVLCLT MSFIVLCLT 239 650
HLA-A*02:11 TVLCLTPVYSFL IVLCLTPVYSFL 533 199
HLA-B*15:03 FLMSFTVL FLMSFIVL 371 993
HLA-A*02:02 FLMSFTVLCL FLMSFIVLCL 3 8
HLA-A*02:02 LLFLMSFTVLCL LLFLMSFIVLCL 134 356
HLA-A*02:01 LLFLMSFTVLCL LLFLMSFIVLCL 237 602
HLA-A*02:01 LFLMSFTVLCL LFLMSFIVLCL 73 185
HLA-A*02:06 FLMSFTVLCL FLMSFIVLCL 15 38
HLA-C*03:02 TVLCLTPVY IVLCLTPVY 136 54
HLA-A*23:01 LFLMSFTVL LFLMSFIVL 411 1026
HLA-A*02:06 TLLFLMSFTV TLLFLMSFIV 47 116
HLA-B*08:01 FLMSFTVL FLMSFIVL 118 291
HLA-A*02:06 NTLLFLMSFTV NTLLFLMSFIV 373 906
HLA-A*02:01 TLLFLMSFTV TLLFLMSFIV 14 33
HLA-A*02:06 VAFNTLLFLMSFTV VAFNTLLFLMSFIV 479 1101
HLA-A*02:06 MSFTVLCLTPV MSFIVLCLTPV 48 110
HLA-B*58:01 MSFTVLCLT MSFIVLCLT 412 943
HLA-A*02:01 FLMSFTVLCL FLMSFIVLCL 4 9
HLA-A*02:02 FLMSFTVLCLTP FLMSFIVLCLTP 194 430
HLA-A*02:11 TLLFLMSFTV TLLFLMSFIV 5 11
HLA-A*02:02 FTVLCLTPV FIVLCLTPV 23 11
HLA-A*02:01 FTVLCLTPV FIVLCLTPV 25 12
HLA-A*30:02 FTVLCLTPVY FIVLCLTPVY 327 671
HLA-A*02:02 TVLCLTPVYSFL IVLCLTPVYSFL 176 86
HLA-B*58:01 MSFTVLCLTP MSFIVLCLTP 497 1015
HLA-A*02:11 FTVLCLTPV FIVLCLTPV 12 6

A380V

Reference  NDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFN
           ||||||||||||||||||||||||| |||||||||||||||||||||||||
Mutated    NDVSFLAHIQWMVMFTPLVPFWITIVYIICISTKHFYWFFSNYLKRRVVFN

Export table to csv 
Allele Reference peptide Mutated peptide Reference affinity (IC50, nM) Mutated affinity (IC50, nM)
HLA-B*51:01 VPFWITIA VPFWITIV 4209 275
HLA-A*02:11 LVPFWITIA LVPFWITIV 598 44
HLA-A*02:06 ITIAYIICI ITIVYIICI 43 420
HLA-A*02:01 ITIAYIICI ITIVYIICI 202 1746
HLA-A*02:11 VMFTPLVPFWITIA VMFTPLVPFWITIV 347 44
HLA-A*02:11 ITIAYIICI ITIVYIICI 36 274
HLA-A*02:01 LVPFWITIA LVPFWITIV 3110 430
HLA-A*68:02 ITIAYIICI ITIVYIICI 164 1130
HLA-B*58:01 IAYIICISTKHFYW IVYIICISTKHFYW 144 966
HLA-A*02:02 ITIAYIICI ITIVYIICI 383 2542
HLA-A*02:02 LVPFWITIA LVPFWITIV 1517 257
HLA-A*02:06 LVPFWITIA LVPFWITIV 449 79
HLA-A*02:11 WITIAYIICI WITIVYIICI 447 2491
HLA-A*68:02 LVPFWITIA LVPFWITIV 912 168
HLA-A*02:01 VMFTPLVPFWITIA VMFTPLVPFWITIV 694 145
HLA-B*57:01 IAYIICISTKHFYW IVYIICISTKHFYW 162 774
HLA-A*03:01 IAYIICISTK IVYIICISTK 190 47
HLA-A*23:01 AYIICISTKHF VYIICISTKHF 317 89
HLA-A*24:02 AYIICISTKHF VYIICISTKHF 845 241
HLA-A*03:02 IAYIICISTK IVYIICISTK 426 127
HLA-A*11:01 ITIAYIICISTK ITIVYIICISTK